HBVdb

Dataset for protein LHBs of genotype E

[Download (right click)] [Alignment] [Repertoires]

346 sequence(s)

>gnl|hbvpro|AB091255_LHBs_P-E Product feature CHAIN AB091255_LHBs_P-E of FT:mat_peptide AB091255_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-129). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091256_LHBs_P-E Product feature CHAIN AB091256_LHBs_P-E of FT:mat_peptide AB091256_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-212). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLI
SSIFSRTGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTITGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB106564_LHBs_C-E Product feature CHAIN AB106564_LHBs_C-E of FT:mat_peptide AB106564_LHBs_C-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA325). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTKPLGCVPDHQLDPAFRANTRNPDWDHNPNKDHWTDANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMPKTSPAEPPPASTKRQSGRQPTPITPPLRDTHPQAMQRNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPADGNC
TCTPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194947_LHBs_P-E Product feature CHAIN AB194947_LHBs_P-E of FT:mat_peptide AB194947_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR954). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTDPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194948_LHBs_P-E Product feature CHAIN AB194948_LHBs_P-E of FT:mat_peptide AB194948_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR936). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFSANTRNPDWDHNPNKDHWTEANQVGVGAFGPGFTPPHGGLLGGSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYRPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPGLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB201287_LHBs_P-E Product feature CHAIN AB201287_LHBs_P-E of FT:mat_peptide AB201287_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin11). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGFLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB201288_LHBs_P-E Product feature CHAIN AB201288_LHBs_P-E of FT:mat_peptide AB201288_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin89). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPLASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB201289_LHBs_P-E Product feature CHAIN AB201289_LHBs_P-E of FT:mat_peptide AB201289_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin269). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB201290_LHBs_P-E Product feature CHAIN AB201290_LHBs_P-E of FT:mat_peptide AB201290_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin293). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWKEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205129_LHBs_P-E Product feature CHAIN AB205129_LHBs_P-E of FT:mat_peptide AB205129_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758-2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPDKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVSPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205189_LHBs_P-E Product feature CHAIN AB205189_LHBs_P-E of FT:mat_peptide AB205189_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G138). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205190_LHBs_P-E Product feature CHAIN AB205190_LHBs_P-E of FT:mat_peptide AB205190_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G123). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRTPDWDHNPNKDHWTEANKVGVGAFGPGFSPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLFLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGILPVCPLLPGSATTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFCCLWAYS
>gnl|hbvpro|AB205191_LHBs_P-E Product feature CHAIN AB205191_LHBs_P-E of FT:mat_peptide AB205191_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G166). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTVPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205192_LHBs_P-E Product feature CHAIN AB205192_LHBs_P-E of FT:mat_peptide AB205192_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVSPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB219529_LHBs_P-E Product feature CHAIN AB219529_LHBs_P-E of FT:mat_peptide AB219529_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate UK1). Non-functional genomic sequence. [Hepadnaviridae] (length=395 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDNNPNIDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVTPAGGSSSGTVNPVPTTASLISSIF
SRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIP
IPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB219533_LHBs_P-E Product feature CHAIN AB219533_LHBs_P-E of FT:mat_peptide AB219533_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate UK5). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDNNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKNLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNC
TCIPIPSSWAFAKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILKPFIPLLLISFCLWVYI
>gnl|hbvpro|AB274969_LHBs_P-E Product feature CHAIN AB274969_LHBs_P-E of FT:mat_peptide AB274969_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGSLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274970_LHBs_P-E Product feature CHAIN AB274970_LHBs_P-E of FT:mat_peptide AB274970_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGILKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274971_LHBs_P-E Product feature CHAIN AB274971_LHBs_P-E of FT:mat_peptide AB274971_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274973_LHBs_P-E Product feature CHAIN AB274973_LHBs_P-E of FT:mat_peptide AB274973_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=397 residues).
MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGSSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQVQQDHRVRGLPAGGSSSGTVNPVPTTASLISS
IFSRIGDHAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPIC
PGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSGGNCTC
IPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLCNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274974_LHBs_P-E Product feature CHAIN AB274974_LHBs_P-E of FT:mat_peptide AB274974_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASSNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGFSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274975_LHBs_P-E Product feature CHAIN AB274975_LHBs_P-E of FT:mat_peptide AB274975_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPTDPPTASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSISSRIGDPVPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274976_LHBs_P-E Product feature CHAIN AB274976_LHBs_P-E of FT:mat_peptide AB274976_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLNNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274977_LHBs_P-E Product feature CHAIN AB274977_LHBs_P-E of FT:mat_peptide AB274977_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLQTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPTTVSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274978_LHBs_P-E Product feature CHAIN AB274978_LHBs_P-E of FT:mat_peptide AB274978_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVTGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274979_LHBs_P-E Product feature CHAIN AB274979_LHBs_P-E of FT:mat_peptide AB274979_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPEFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPLA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRVTHPQAIQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274980_LHBs_P-E Product feature CHAIN AB274980_LHBs_P-E of FT:mat_peptide AB274980_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASANRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMFLRRFIIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWAWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274981_LHBs_P-E Product feature CHAIN AB274981_LHBs_P-E of FT:mat_peptide AB274981_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEPNEVGVSAFGPGFTPPHGGLLGWSPQA
QGTLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274982_LHBs_P-E Product feature CHAIN AB274982_LHBs_P-E of FT:mat_peptide AB274982_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLVGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|AB274985_LHBs_P-E Product feature CHAIN AB274985_LHBs_P-E of FT:mat_peptide AB274985_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=397 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEPNKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVRGLPAGGSSSGTVNPVPTTASLISS
IFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPIC
PGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTC
IPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB915175_LHBs_P-E Product feature CHAIN AB915175_LHBs_P-E of FT:mat_peptide AB915175_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRNLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB915177_LHBs_P-E Product feature CHAIN AB915177_LHBs_P-E of FT:mat_peptide AB915177_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB915178_LHBs_P-E Product feature CHAIN AB915178_LHBs_P-E of FT:mat_peptide AB915178_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA4). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWXEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTPVQAMQWNSKTFHQALQDXRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMCPSCCCLKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494690_LHBs_P-E Product feature CHAIN AM494690_LHBs_P-E of FT:mat_peptide AM494690_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR008). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494691_LHBs_P-E Product feature CHAIN AM494691_LHBs_P-E of FT:mat_peptide AM494691_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR024). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMXKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWALGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494692_LHBs_P-E Product feature CHAIN AM494692_LHBs_P-E of FT:mat_peptide AM494692_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR026). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFLPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGILGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494693_LHBs_P-E Product feature CHAIN AM494693_LHBs_P-E of FT:mat_peptide AM494693_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR039). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494694_LHBs_P-E Product feature CHAIN AM494694_LHBs_P-E of FT:mat_peptide AM494694_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR047). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGLTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRXGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494695_LHBs_P-E Product feature CHAIN AM494695_LHBs_P-E of FT:mat_peptide AM494695_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR053). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGDLLGWSPQA
QGMLKTLPADPPSASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPTDGNC
TCIPIPSSWAFGKFLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494696_LHBs_P-E Product feature CHAIN AM494696_LHBs_P-E of FT:mat_peptide AM494696_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR060). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGLTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494697_LHBs_P-E Product feature CHAIN AM494697_LHBs_P-E of FT:mat_peptide AM494697_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR063). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPL
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494699_LHBs_P-E Product feature CHAIN AM494699_LHBs_P-E of FT:mat_peptide AM494699_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR082). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494700_LHBs_P-E Product feature CHAIN AM494700_LHBs_P-E of FT:mat_peptide AM494700_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR083). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGLTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494701_LHBs_P-E Product feature CHAIN AM494701_LHBs_P-E of FT:mat_peptide AM494701_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR097). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494702_LHBs_P-E Product feature CHAIN AM494702_LHBs_P-E of FT:mat_peptide AM494702_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR106). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494703_LHBs_P-E Product feature CHAIN AM494703_LHBs_P-E of FT:mat_peptide AM494703_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR107). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWPEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494704_LHBs_P-E Product feature CHAIN AM494704_LHBs_P-E of FT:mat_peptide AM494704_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR112). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIAWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494705_LHBs_P-E Product feature CHAIN AM494705_LHBs_P-E of FT:mat_peptide AM494705_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR115). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494706_LHBs_P-E Product feature CHAIN AM494706_LHBs_P-E of FT:mat_peptide AM494706_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR131). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494707_LHBs_P-E Product feature CHAIN AM494707_LHBs_P-E of FT:mat_peptide AM494707_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR137). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494708_LHBs_P-E Product feature CHAIN AM494708_LHBs_P-E of FT:mat_peptide AM494708_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494709_LHBs_P-E Product feature CHAIN AM494709_LHBs_P-E of FT:mat_peptide AM494709_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR143). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPALNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494710_LHBs_P-E Product feature CHAIN AM494710_LHBs_P-E of FT:mat_peptide AM494710_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR144). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494711_LHBs_P-E Product feature CHAIN AM494711_LHBs_P-E of FT:mat_peptide AM494711_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR146). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHATTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLNTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSSHSLTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494712_LHBs_P-E Product feature CHAIN AM494712_LHBs_P-E of FT:mat_peptide AM494712_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR150). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPVSTNRQSGRQPTPITPPLRDTHPLAVQWNSKTFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDLAPNMESITSXFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSSHSLTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFLCLWVYI
>gnl|hbvpro|AM494713_LHBs_P-E Product feature CHAIN AM494713_LHBs_P-E of FT:mat_peptide AM494713_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR154). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRHSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494714_LHBs_P-E Product feature CHAIN AM494714_LHBs_P-E of FT:mat_peptide AM494714_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR165). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPVSTNRQSGRQPTPITPPLRDTHPLAVQWNSKTFHQALQDPRVRGLYPPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFLCLWVYI
>gnl|hbvpro|AM494715_LHBs_P-E Product feature CHAIN AM494715_LHBs_P-E of FT:mat_peptide AM494715_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR171). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494717_LHBs_P-E Product feature CHAIN AM494717_LHBs_P-E of FT:mat_peptide AM494717_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR187). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738144_LHBs_P-E Product feature CHAIN AY738144_LHBs_P-E of FT:mat_peptide AY738144_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTAANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSRSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVRWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738145_LHBs_C-E Product feature CHAIN AY738145_LHBs_C-E of FT:mat_peptide AY738145_LHBs_C-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTAANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVRWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738146_LHBs_P-E Product feature CHAIN AY738146_LHBs_P-E of FT:mat_peptide AY738146_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTAANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738147_LHBs_P-E Product feature CHAIN AY738147_LHBs_P-E of FT:mat_peptide AY738147_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 10/98). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTAANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFTIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY739674_LHBs_P-E Product feature CHAIN AY739674_LHBs_P-E of FT:mat_peptide AY739674_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY739675_LHBs_P-E Product feature CHAIN AY739675_LHBs_P-E of FT:mat_peptide AY739675_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWAWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY935700_LHBs_P-E Product feature CHAIN AY935700_LHBs_P-E of FT:mat_peptide AY935700_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate TH-HBV-012). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060822_LHBs_P-E Product feature CHAIN DQ060822_LHBs_P-E of FT:mat_peptide DQ060822_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8510-91). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060823_LHBs_P-E Product feature CHAIN DQ060823_LHBs_P-E of FT:mat_peptide DQ060823_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8504-91). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060824_LHBs_P-E Product feature CHAIN DQ060824_LHBs_P-E of FT:mat_peptide DQ060824_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0121-20). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTKANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060825_LHBs_P-E Product feature CHAIN DQ060825_LHBs_P-E of FT:mat_peptide DQ060825_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0262-09). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060826_LHBs_P-E Product feature CHAIN DQ060826_LHBs_P-E of FT:mat_peptide DQ060826_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0433-20). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060827_LHBs_P-E Product feature CHAIN DQ060827_LHBs_P-E of FT:mat_peptide DQ060827_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0317-04). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060828_LHBs_P-E Product feature CHAIN DQ060828_LHBs_P-E of FT:mat_peptide DQ060828_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0443-03). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060829_LHBs_P-E Product feature CHAIN DQ060829_LHBs_P-E of FT:mat_peptide DQ060829_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0350-03). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060830_LHBs_P-E Product feature CHAIN DQ060830_LHBs_P-E of FT:mat_peptide DQ060830_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 235-01). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239217_LHBs_P-E Product feature CHAIN EU239217_LHBs_P-E of FT:mat_peptide EU239217_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate G2451). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPSMESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239218_LHBs_P-E Product feature CHAIN EU239218_LHBs_P-E of FT:mat_peptide EU239218_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTDANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239219_LHBs_P-E Product feature CHAIN EU239219_LHBs_P-E of FT:mat_peptide EU239219_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW3). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTDANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSETVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239220_LHBs_P-E Product feature CHAIN EU239220_LHBs_P-E of FT:mat_peptide EU239220_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW5). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNLSTVNPLGFFPDHQLDPAFRANTRNPDWDNNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAVQWNSTTFHQNLQDPRVRGLYFPAGGSSSGTVNPVPTTASLT
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNC
TCTPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLLIFFWLWAYI
>gnl|hbvpro|EU239221_LHBs_P-E Product feature CHAIN EU239221_LHBs_P-E of FT:mat_peptide EU239221_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMAGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPSVRWFAGLSPTVWLSVIWMMWYWGPSLYHILSPFIPLLPIFLCLWAYI
>gnl|hbvpro|EU239222_LHBs_P-E Product feature CHAIN EU239222_LHBs_P-E of FT:mat_peptide EU239222_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGSSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQNPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVYLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239223_LHBs_P-E Product feature CHAIN EU239223_LHBs_P-E of FT:mat_peptide EU239223_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW4). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTKNPDWDHNPNKDHWTDANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWGWASARFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239224_LHBs_P-E Product feature CHAIN EU239224_LHBs_P-E of FT:mat_peptide EU239224_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKEHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNC
TCIPIPSSWAFGKFLWEWASARSSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239226_LHBs_P-E Product feature CHAIN EU239226_LHBs_P-E of FT:mat_peptide EU239226_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW6). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPSLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SPIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349226_LHBs_P-E Product feature CHAIN FJ349226_LHBs_P-E of FT:mat_peptide FJ349226_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate H6). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349237_LHBs_P-E Product feature CHAIN FJ349237_LHBs_P-E of FT:mat_peptide FJ349237_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C27). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349238_LHBs_P-E Product feature CHAIN FJ349238_LHBs_P-E of FT:mat_peptide FJ349238_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C65). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349239_LHBs_P-E Product feature CHAIN FJ349239_LHBs_P-E of FT:mat_peptide FJ349239_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C74). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545821_LHBs_P-E Product feature CHAIN FN545821_LHBs_P-E of FT:mat_peptide FN545821_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSXFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLLIFFCLWVYI
>gnl|hbvpro|FN545822_LHBs_P-E Product feature CHAIN FN545822_LHBs_P-E of FT:mat_peptide FN545822_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFXPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPLASTNRKSGRQPTPITPPLRETHPQAMKWNSTTFHQALQDPRIKGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545823_LHBs_P-E Product feature CHAIN FN545823_LHBs_P-E of FT:mat_peptide FN545823_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGXSPQA
QGMLTTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGGLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545841_LHBs_P-E Product feature CHAIN FN545841_LHBs_P-E of FT:mat_peptide FN545841_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545842_LHBs_P-E Product feature CHAIN FN545842_LHBs_P-E of FT:mat_peptide FN545842_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAIQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594748_LHBs_P-E Product feature CHAIN FN594748_LHBs_P-E of FT:mat_peptide FN594748_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne6). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTDANKVGVGAFGPGXTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594749_LHBs_P-E Product feature CHAIN FN594749_LHBs_P-E of FT:mat_peptide FN594749_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne8). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMKWNSTTFHQALQDPRVRGLYSPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCTLIPGSSTTSTGLTRACTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594750_LHBs_P-E Product feature CHAIN FN594750_LHBs_P-E of FT:mat_peptide FN594750_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne12). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPISNHSLTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594751_LHBs_P-E Product feature CHAIN FN594751_LHBs_P-E of FT:mat_peptide FN594751_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne52H). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTPLPADPPPASTNRQSGRQPTPITPPLRDTHPQAIQWNSKTFHQALQDPRVRGLHXSAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
IWPGYRWMCLRRFIIFLFILLLCLIFWWDLQDYQGMLRECPQTPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594752_LHBs_P-E Product feature CHAIN FN594752_LHBs_P-E of FT:mat_peptide FN594752_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne134). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDNNPNKDHWTEANEVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594756_LHBs_P-E Product feature CHAIN FN594756_LHBs_P-E of FT:mat_peptide FN594756_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne250). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTNNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVTGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594758_LHBs_P-E Product feature CHAIN FN594758_LHBs_P-E of FT:mat_peptide FN594758_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne341). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLQWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLXFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594759_LHBs_P-E Product feature CHAIN FN594759_LHBs_P-E of FT:mat_peptide FN594759_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne342). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLSWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLXPIFFCLWVYI
>gnl|hbvpro|FN594760_LHBs_P-E Product feature CHAIN FN594760_LHBs_P-E of FT:mat_peptide FN594760_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne362). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTSNPDWDDNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRRPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLXFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLMVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVXLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594761_LHBs_P-E Product feature CHAIN FN594761_LHBs_P-E of FT:mat_peptide FN594761_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne385). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTDANKVGVGAFGPGLTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFEKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLNNILSPFIPLXPIFCCLWVYI
>gnl|hbvpro|FN594762_LHBs_P-E Product feature CHAIN FN594762_LHBs_P-E of FT:mat_peptide FN594762_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne439). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWKKANKVGVGAFWPGLTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALLDPTVGGLSSPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSLTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594763_LHBs_P-E Product feature CHAIN FN594763_LHBs_P-E of FT:mat_peptide FN594763_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne446). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594765_LHBs_P-E Product feature CHAIN FN594765_LHBs_P-E of FT:mat_peptide FN594765_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne9447). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTXNPDWDHNPNKDHWTEANKVGVGSFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPACPLTPGSSTTSTGPCRTCTTLAQGTSMCPSCCCSKPSDGNC
TCIPIPSSWAXGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLNNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594766_LHBs_P-E Product feature CHAIN FN594766_LHBs_P-E of FT:mat_peptide FN594766_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne9449). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGSFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVRTTASLI
SSIFSRIGDPAPNMESTTSGFLGPLHVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRIFIFLFILLLCLIFLLDLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GQ161755_LHBs_P-E Product feature CHAIN GQ161755_LHBs_P-E of FT:mat_peptide GQ161755_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1694). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSFGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161757_LHBs_P-E Product feature CHAIN GQ161757_LHBs_P-E of FT:mat_peptide GQ161757_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1156). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGSSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSRFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161758_LHBs_P-E Product feature CHAIN GQ161758_LHBs_P-E of FT:mat_peptide GQ161758_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1506). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNYTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161759_LHBs_P-E Product feature CHAIN GQ161759_LHBs_P-E of FT:mat_peptide GQ161759_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU934). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161760_LHBs_P-E Product feature CHAIN GQ161760_LHBs_P-E of FT:mat_peptide GQ161760_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1374). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTIWQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLNFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSLTSCPP
ICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPLCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161761_LHBs_P-E Product feature CHAIN GQ161761_LHBs_P-E of FT:mat_peptide GQ161761_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1033). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPLHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161762_LHBs_P-E Product feature CHAIN GQ161762_LHBs_P-E of FT:mat_peptide GQ161762_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU716). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNYSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAQNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161763_LHBs_P-E Product feature CHAIN GQ161763_LHBs_P-E of FT:mat_peptide GQ161763_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1013). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKYLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161764_LHBs_P-E Product feature CHAIN GQ161764_LHBs_P-E of FT:mat_peptide GQ161764_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1056). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161765_LHBs_P-E Product feature CHAIN GQ161765_LHBs_P-E of FT:mat_peptide GQ161765_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU952). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161766_LHBs_P-E Product feature CHAIN GQ161766_LHBs_P-E of FT:mat_peptide GQ161766_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1671). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNYTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161768_LHBs_P-E Product feature CHAIN GQ161768_LHBs_P-E of FT:mat_peptide GQ161768_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU960). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGLTPPHGGLLGWSPQA
QGMLKTLPVDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161769_LHBs_P-E Product feature CHAIN GQ161769_LHBs_P-E of FT:mat_peptide GQ161769_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU865). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161770_LHBs_P-E Product feature CHAIN GQ161770_LHBs_P-E of FT:mat_peptide GQ161770_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU927). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFVGGAPVCLGQNLQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161771_LHBs_P-E Product feature CHAIN GQ161771_LHBs_P-E of FT:mat_peptide GQ161771_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU896). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161772_LHBs_P-E Product feature CHAIN GQ161772_LHBs_P-E of FT:mat_peptide GQ161772_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU873). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWKEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161773_LHBs_P-E Product feature CHAIN GQ161773_LHBs_P-E of FT:mat_peptide GQ161773_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1406). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161774_LHBs_P-E Product feature CHAIN GQ161774_LHBs_P-E of FT:mat_peptide GQ161774_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1501). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNYTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161775_LHBs_P-E Product feature CHAIN GQ161775_LHBs_P-E of FT:mat_peptide GQ161775_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU754). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQPLQNPRVRGQDFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPXSSTTSTGPCRTCTTXAQGXSMFPSCCCSKPSDGNC
TCIPIPSSWAFXKFLWEWASXRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161776_LHBs_P-E Product feature CHAIN GQ161776_LHBs_P-E of FT:mat_peptide GQ161776_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1178). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161777_LHBs_P-E Product feature CHAIN GQ161777_LHBs_P-E of FT:mat_peptide GQ161777_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU807). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKYLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161778_LHBs_P-E Product feature CHAIN GQ161778_LHBs_P-E of FT:mat_peptide GQ161778_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1035). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKSLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWGWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161779_LHBs_P-E Product feature CHAIN GQ161779_LHBs_P-E of FT:mat_peptide GQ161779_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU557). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQLGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161780_LHBs_P-E Product feature CHAIN GQ161780_LHBs_P-E of FT:mat_peptide GQ161780_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU50). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161781_LHBs_P-E Product feature CHAIN GQ161781_LHBs_P-E of FT:mat_peptide GQ161781_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU200). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDYWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161782_LHBs_P-E Product feature CHAIN GQ161782_LHBs_P-E of FT:mat_peptide GQ161782_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1489). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161783_LHBs_P-E Product feature CHAIN GQ161783_LHBs_P-E of FT:mat_peptide GQ161783_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU981). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPEFQANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPAVPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161784_LHBs_P-E Product feature CHAIN GQ161784_LHBs_P-E of FT:mat_peptide GQ161784_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU766). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161785_LHBs_P-E Product feature CHAIN GQ161785_LHBs_P-E of FT:mat_peptide GQ161785_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU758). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGTGFTPPHGGLLGWSPQA
QGTLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYPPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161786_LHBs_P-E Product feature CHAIN GQ161786_LHBs_P-E of FT:mat_peptide GQ161786_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1688). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQLGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161787_LHBs_P-E Product feature CHAIN GQ161787_LHBs_P-E of FT:mat_peptide GQ161787_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU841). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161789_LHBs_P-E Product feature CHAIN GQ161789_LHBs_P-E of FT:mat_peptide GQ161789_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1169). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161790_LHBs_P-E Product feature CHAIN GQ161790_LHBs_P-E of FT:mat_peptide GQ161790_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1408). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLNTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161791_LHBs_P-E Product feature CHAIN GQ161791_LHBs_P-E of FT:mat_peptide GQ161791_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU459). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161792_LHBs_P-E Product feature CHAIN GQ161792_LHBs_P-E of FT:mat_peptide GQ161792_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU605). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNHLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161793_LHBs_P-E Product feature CHAIN GQ161793_LHBs_P-E of FT:mat_peptide GQ161793_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU932). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161794_LHBs_P-E Product feature CHAIN GQ161794_LHBs_P-E of FT:mat_peptide GQ161794_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU846). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161796_LHBs_P-E Product feature CHAIN GQ161796_LHBs_P-E of FT:mat_peptide GQ161796_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1146). Non-functional genomic sequence. [Hepadnaviridae] (length=395 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPVDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNYTTFHQALQDPKVRPAGGSSSGTVNPVPTTASLISSIF
SRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIP
IPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161797_LHBs_P-E Product feature CHAIN GQ161797_LHBs_P-E of FT:mat_peptide GQ161797_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1660). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGVFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKIRGPYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161798_LHBs_P-E Product feature CHAIN GQ161798_LHBs_P-E of FT:mat_peptide GQ161798_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1222). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFVKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161799_LHBs_P-E Product feature CHAIN GQ161799_LHBs_P-E of FT:mat_peptide GQ161799_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU732). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLNTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161800_LHBs_P-E Product feature CHAIN GQ161800_LHBs_P-E of FT:mat_peptide GQ161800_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1039). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161801_LHBs_P-E Product feature CHAIN GQ161801_LHBs_P-E of FT:mat_peptide GQ161801_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU438). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWMEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GQ161802_LHBs_P-E Product feature CHAIN GQ161802_LHBs_P-E of FT:mat_peptide GQ161802_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU921). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161803_LHBs_P-E Product feature CHAIN GQ161803_LHBs_P-E of FT:mat_peptide GQ161803_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1700). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDQNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAVQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSTFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161804_LHBs_P-E Product feature CHAIN GQ161804_LHBs_P-E of FT:mat_peptide GQ161804_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1428). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161805_LHBs_P-E Product feature CHAIN GQ161805_LHBs_P-E of FT:mat_peptide GQ161805_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1410). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLNTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161807_LHBs_P-E Product feature CHAIN GQ161807_LHBs_P-E of FT:mat_peptide GQ161807_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1168). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGSSPQA
QGMLRTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161808_LHBs_P-E Product feature CHAIN GQ161808_LHBs_P-E of FT:mat_peptide GQ161808_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1398). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKSLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161810_LHBs_P-E Product feature CHAIN GQ161810_LHBs_P-E of FT:mat_peptide GQ161810_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU852). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMXKSLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWGWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161811_LHBs_P-E Product feature CHAIN GQ161811_LHBs_P-E of FT:mat_peptide GQ161811_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1361). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTVPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161812_LHBs_P-E Product feature CHAIN GQ161812_LHBs_P-E of FT:mat_peptide GQ161812_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1577). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161814_LHBs_P-E Product feature CHAIN GQ161814_LHBs_P-E of FT:mat_peptide GQ161814_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU625). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161815_LHBs_P-E Product feature CHAIN GQ161815_LHBs_P-E of FT:mat_peptide GQ161815_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1241). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSVTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPAVPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161816_LHBs_P-E Product feature CHAIN GQ161816_LHBs_P-E of FT:mat_peptide GQ161816_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1214). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161817_LHBs_P-E Product feature CHAIN GQ161817_LHBs_P-E of FT:mat_peptide GQ161817_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU630). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGTFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPVGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161818_LHBs_P-E Product feature CHAIN GQ161818_LHBs_P-E of FT:mat_peptide GQ161818_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1520). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLNTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161819_LHBs_P-E Product feature CHAIN GQ161819_LHBs_P-E of FT:mat_peptide GQ161819_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1062). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161820_LHBs_P-E Product feature CHAIN GQ161820_LHBs_P-E of FT:mat_peptide GQ161820_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1089). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDXNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQXLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIXFLFILLLCLIFLLVLLXYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLXPIFFCLWVYI
>gnl|hbvpro|GQ161821_LHBs_P-E Product feature CHAIN GQ161821_LHBs_P-E of FT:mat_peptide GQ161821_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1405). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLNTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161822_LHBs_P-E Product feature CHAIN GQ161822_LHBs_P-E of FT:mat_peptide GQ161822_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1086). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161824_LHBs_P-E Product feature CHAIN GQ161824_LHBs_P-E of FT:mat_peptide GQ161824_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU893). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPEFQANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPAVPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161825_LHBs_P-E Product feature CHAIN GQ161825_LHBs_P-E of FT:mat_peptide GQ161825_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1769). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRSPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMEGITSGFLGPLLVLQAGFFLLTKILKIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPTDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161827_LHBs_P-E Product feature CHAIN GQ161827_LHBs_P-E of FT:mat_peptide GQ161827_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU180). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161828_LHBs_P-E Product feature CHAIN GQ161828_LHBs_P-E of FT:mat_peptide GQ161828_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1399). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161829_LHBs_P-E Product feature CHAIN GQ161829_LHBs_P-E of FT:mat_peptide GQ161829_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU719). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161830_LHBs_P-E Product feature CHAIN GQ161830_LHBs_P-E of FT:mat_peptide GQ161830_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1365). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161831_LHBs_P-E Product feature CHAIN GQ161831_LHBs_P-E of FT:mat_peptide GQ161831_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU779). Non-functional genomic sequence. [Hepadnaviridae] (length=395 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPEHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRPAGGSSSGTVNPVPTTASLISSIS
SRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPG
NRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIP
IPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNIWSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161832_LHBs_P-E Product feature CHAIN GQ161832_LHBs_P-E of FT:mat_peptide GQ161832_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1091). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161833_LHBs_P-E Product feature CHAIN GQ161833_LHBs_P-E of FT:mat_peptide GQ161833_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU489). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161834_LHBs_P-E Product feature CHAIN GQ161834_LHBs_P-E of FT:mat_peptide GQ161834_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1128). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEATKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQPMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161835_LHBs_P-E Product feature CHAIN GQ161835_LHBs_P-E of FT:mat_peptide GQ161835_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU925). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSFGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161836_LHBs_P-E Product feature CHAIN GQ161836_LHBs_P-E of FT:mat_peptide GQ161836_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1051). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYLPAGGSSSGTVNPVPTTASLI
SSIFSTIGDPAPNMESITSGFLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363565_LHBs_P-E Product feature CHAIN HM363565_LHBs_P-E of FT:mat_peptide HM363565_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A186). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASANRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSAGNC
TCTPIPSSWAFGKYLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363566_LHBs_P-E Product feature CHAIN HM363566_LHBs_P-E of FT:mat_peptide HM363566_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1082). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFTANTRNPDWDHNPNKDHWTEANQVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLALNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLNNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363567_LHBs_P-E Product feature CHAIN HM363567_LHBs_P-E of FT:mat_peptide HM363567_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C16). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLDFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363568_LHBs_P-E Product feature CHAIN HM363568_LHBs_P-E of FT:mat_peptide HM363568_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C98). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363569_LHBs_P-E Product feature CHAIN HM363569_LHBs_P-E of FT:mat_peptide HM363569_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A51). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363570_LHBs_P-E Product feature CHAIN HM363570_LHBs_P-E of FT:mat_peptide HM363570_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A85). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363571_LHBs_P-E Product feature CHAIN HM363571_LHBs_P-E of FT:mat_peptide HM363571_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V16). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363572_LHBs_P-E Product feature CHAIN HM363572_LHBs_P-E of FT:mat_peptide HM363572_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V5). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWSEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRCLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSRFLGPLLVLQAGFFSLTKTLTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPISCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363573_LHBs_P-E Product feature CHAIN HM363573_LHBs_P-E of FT:mat_peptide HM363573_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V3). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNILGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363574_LHBs_P-E Product feature CHAIN HM363574_LHBs_P-E of FT:mat_peptide HM363574_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V70). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363575_LHBs_P-E Product feature CHAIN HM363575_LHBs_P-E of FT:mat_peptide HM363575_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V30). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363576_LHBs_P-E Product feature CHAIN HM363576_LHBs_P-E of FT:mat_peptide HM363576_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V43). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363577_LHBs_P-E Product feature CHAIN HM363577_LHBs_P-E of FT:mat_peptide HM363577_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C19). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSSPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363578_LHBs_P-E Product feature CHAIN HM363578_LHBs_P-E of FT:mat_peptide HM363578_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL802). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363579_LHBs_P-E Product feature CHAIN HM363579_LHBs_P-E of FT:mat_peptide HM363579_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A32). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363580_LHBs_P-E Product feature CHAIN HM363580_LHBs_P-E of FT:mat_peptide HM363580_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A79). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363581_LHBs_P-E Product feature CHAIN HM363581_LHBs_P-E of FT:mat_peptide HM363581_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A84). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363582_LHBs_P-E Product feature CHAIN HM363582_LHBs_P-E of FT:mat_peptide HM363582_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL314). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363583_LHBs_P-E Product feature CHAIN HM363583_LHBs_P-E of FT:mat_peptide HM363583_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V137). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMHITLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363584_LHBs_P-E Product feature CHAIN HM363584_LHBs_P-E of FT:mat_peptide HM363584_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V129). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMHITLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363585_LHBs_P-E Product feature CHAIN HM363585_LHBs_P-E of FT:mat_peptide HM363585_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1455). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLSFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM363586_LHBs_P-E Product feature CHAIN HM363586_LHBs_P-E of FT:mat_peptide HM363586_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A227). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTKANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTKFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM363587_LHBs_P-E Product feature CHAIN HM363587_LHBs_P-E of FT:mat_peptide HM363587_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V195). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDNNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSKIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363588_LHBs_P-E Product feature CHAIN HM363588_LHBs_P-E of FT:mat_peptide HM363588_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A100). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363589_LHBs_P-E Product feature CHAIN HM363589_LHBs_P-E of FT:mat_peptide HM363589_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A178). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363590_LHBs_P-E Product feature CHAIN HM363590_LHBs_P-E of FT:mat_peptide HM363590_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V119). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363591_LHBs_P-E Product feature CHAIN HM363591_LHBs_P-E of FT:mat_peptide HM363591_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A114). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363592_LHBs_P-E Product feature CHAIN HM363592_LHBs_P-E of FT:mat_peptide HM363592_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A153). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWIEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDINC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363593_LHBs_P-E Product feature CHAIN HM363593_LHBs_P-E of FT:mat_peptide HM363593_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1577). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLYLPAGGSHSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363594_LHBs_P-E Product feature CHAIN HM363594_LHBs_P-E of FT:mat_peptide HM363594_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V157). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRLPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363595_LHBs_P-E Product feature CHAIN HM363595_LHBs_P-E of FT:mat_peptide HM363595_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1219). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAQNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPGCLGQNSQSQISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363596_LHBs_P-E Product feature CHAIN HM363596_LHBs_P-E of FT:mat_peptide HM363596_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V87). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQETSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363597_LHBs_P-E Product feature CHAIN HM363597_LHBs_P-E of FT:mat_peptide HM363597_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A112). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRKSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363598_LHBs_P-E Product feature CHAIN HM363598_LHBs_P-E of FT:mat_peptide HM363598_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V15). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRMSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHLPTSCPP
ICPGYRWMCQRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQRTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363599_LHBs_P-E Product feature CHAIN HM363599_LHBs_P-E of FT:mat_peptide HM363599_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V144). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDHAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGLSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363600_LHBs_P-E Product feature CHAIN HM363600_LHBs_P-E of FT:mat_peptide HM363600_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C8). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQNPRVTGLYPPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363601_LHBs_P-E Product feature CHAIN HM363601_LHBs_P-E of FT:mat_peptide HM363601_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL911). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363602_LHBs_P-E Product feature CHAIN HM363602_LHBs_P-E of FT:mat_peptide HM363602_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A231). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFLPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPTTASRI
SSIFSRIGDLAPNMESITSGFLGPLLALQAGFFSLIKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM363603_LHBs_P-E Product feature CHAIN HM363603_LHBs_P-E of FT:mat_peptide HM363603_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1274). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMPKTLPSDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMETITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWSWGRGLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363604_LHBs_P-E Product feature CHAIN HM363604_LHBs_P-E of FT:mat_peptide HM363604_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A28). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTPPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRKPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363605_LHBs_P-E Product feature CHAIN HM363605_LHBs_P-E of FT:mat_peptide HM363605_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C58). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363606_LHBs_P-E Product feature CHAIN HM363606_LHBs_P-E of FT:mat_peptide HM363606_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V64). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGSSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363607_LHBs_P-E Product feature CHAIN HM363607_LHBs_P-E of FT:mat_peptide HM363607_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C78). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363608_LHBs_P-E Product feature CHAIN HM363608_LHBs_P-E of FT:mat_peptide HM363608_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A212). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASIKRQSGRQPTPITPPLRDTHPQAMQWNSRTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTVSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTNRTGPCRTCTTLAQGTSMIPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVRFAQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363609_LHBs_P-E Product feature CHAIN HM363609_LHBs_P-E of FT:mat_peptide HM363609_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A58). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGTFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM363610_LHBs_P-E Product feature CHAIN HM363610_LHBs_P-E of FT:mat_peptide HM363610_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C113). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
PGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHKALQDPRVRGLYLPAGGSSSGKVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363611_LHBs_P-E Product feature CHAIN HM363611_LHBs_P-E of FT:mat_peptide HM363611_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A67). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGTQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700550_LHBs_P-E Product feature CHAIN HQ700550_LHBs_P-E of FT:mat_peptide HQ700550_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_A032a). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGIQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNIEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700552_LHBs_P-E Product feature CHAIN HQ700552_LHBs_P-E of FT:mat_peptide HQ700552_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_030). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGIQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604166_LHBs_P-E Product feature CHAIN JN604166_LHBs_P-E of FT:mat_peptide JN604166_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 477-9536-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFXANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPTHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRETHPQAMXWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604168_LHBs_P-E Product feature CHAIN JN604168_LHBs_P-E of FT:mat_peptide JN604168_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 477-9824-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTXSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604235_LHBs_P-E Product feature CHAIN JN604235_LHBs_P-E of FT:mat_peptide JN604235_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 478-2158-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQXPTVRGLYFPAGGCSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ000008_LHBs_P-E Product feature CHAIN JQ000008_LHBs_P-E of FT:mat_peptide JQ000008_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMIKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSXGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ000009_LHBs_P-E Product feature CHAIN JQ000009_LHBs_P-E of FT:mat_peptide JQ000009_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMIKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170741_LHBs_P-E Product feature CHAIN KF170741_LHBs_P-E of FT:mat_peptide KF170741_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_047). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNIFSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170742_LHBs_P-E Product feature CHAIN KF170742_LHBs_P-E of FT:mat_peptide KF170742_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_125). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSXLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170750_LHBs_P-E Product feature CHAIN KF170750_LHBs_P-E of FT:mat_peptide KF170750_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_004). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFLPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMPKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFTLLLPIFFCLWVYI
>gnl|hbvpro|KF170751_LHBs_P-E Product feature CHAIN KF170751_LHBs_P-E of FT:mat_peptide KF170751_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_022). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWIEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWGWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170782_LHBs_P-E Product feature CHAIN KF170782_LHBs_P-E of FT:mat_peptide KF170782_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_002). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFLPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|KF170783_LHBs_P-E Product feature CHAIN KF170783_LHBs_P-E of FT:mat_peptide KF170783_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVSALYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170784_LHBs_P-E Product feature CHAIN KF170784_LHBs_P-E of FT:mat_peptide KF170784_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_066). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPAEPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSFGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170785_LHBs_P-E Product feature CHAIN KF170785_LHBs_P-E of FT:mat_peptide KF170785_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_084). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPIKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHKTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170786_LHBs_P-E Product feature CHAIN KF170786_LHBs_P-E of FT:mat_peptide KF170786_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_086). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170787_LHBs_P-E Product feature CHAIN KF170787_LHBs_P-E of FT:mat_peptide KF170787_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_110). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADSPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLT
SSIFSTIGDLVPNMESITSGFLGPLLVLQEGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIYLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170788_LHBs_P-E Product feature CHAIN KF170788_LHBs_P-E of FT:mat_peptide KF170788_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170789_LHBs_P-E Product feature CHAIN KF170789_LHBs_P-E of FT:mat_peptide KF170789_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170790_LHBs_P-E Product feature CHAIN KF170790_LHBs_P-E of FT:mat_peptide KF170790_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_121). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNQSTTNPLGFFPDHQLDPAFRANTSNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSETVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLSNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849713_LHBs_P-E Product feature CHAIN KF849713_LHBs_P-E of FT:mat_peptide KF849713_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA277). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849714_LHBs_P-E Product feature CHAIN KF849714_LHBs_P-E of FT:mat_peptide KF849714_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA439). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849715_LHBs_P-E Product feature CHAIN KF849715_LHBs_P-E of FT:mat_peptide KF849715_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA445). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRTGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849716_LHBs_P-E Product feature CHAIN KF849716_LHBs_P-E of FT:mat_peptide KF849716_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA278). Non-functional genomic sequence. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849717_LHBs_P-E Product feature CHAIN KF849717_LHBs_P-E of FT:mat_peptide KF849717_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA504). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPKMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849718_LHBs_P-E Product feature CHAIN KF849718_LHBs_P-E of FT:mat_peptide KF849718_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA72). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWXVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849719_LHBs_P-E Product feature CHAIN KF849719_LHBs_P-E of FT:mat_peptide KF849719_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA154). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849720_LHBs_P-E Product feature CHAIN KF849720_LHBs_P-E of FT:mat_peptide KF849720_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA265). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTEANEVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQXNSTTFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFLWFSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849721_LHBs_P-E Product feature CHAIN KF849721_LHBs_P-E of FT:mat_peptide KF849721_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA379). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849722_LHBs_P-E Product feature CHAIN KF849722_LHBs_P-E of FT:mat_peptide KF849722_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA386). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849723_LHBs_P-E Product feature CHAIN KF849723_LHBs_P-E of FT:mat_peptide KF849723_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA173). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGVTPPHGGLLGWSPQA
QGILKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPISNHSLTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849724_LHBs_P-E Product feature CHAIN KF849724_LHBs_P-E of FT:mat_peptide KF849724_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA274). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
HGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849726_LHBs_P-E Product feature CHAIN KF849726_LHBs_P-E of FT:mat_peptide KF849726_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA417). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849728_LHBs_P-E Product feature CHAIN KF849728_LHBs_P-E of FT:mat_peptide KF849728_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA423). Non-functional genomic sequence. [Hepadnaviridae] (length=395 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGILTTLPADPPPPSTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKAKPAGGSSSGTVNPVPTTASLISSIF
SRIGVPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIP
IPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922438_LHBs_P-E Product feature CHAIN KF922438_LHBs_P-E of FT:mat_peptide KF922438_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PO04v1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922439_LHBs_P-E Product feature CHAIN KF922439_LHBs_P-E of FT:mat_peptide KF922439_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PO04v2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM108610_LHBs_P-E Product feature CHAIN KM108610_LHBs_P-E of FT:mat_peptide KM108610_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH020overtE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFLPDHQLDPAFRANTKNPDWDHNPNKDHWNAANKVGVGAFGPGFTPPHGGLLGWSPQA
QGSLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSTIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KM108622_LHBs_P-E Product feature CHAIN KM108622_LHBs_P-E of FT:mat_peptide KM108622_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH116overtE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWDPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISSHSPTSCPQ
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM108623_LHBs_P-E Product feature CHAIN KM108623_LHBs_P-E of FT:mat_peptide KM108623_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH152OBIE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGIFPDHQLDPAFRANSRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGRLTSLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGPSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWGWASARFSWLSLLVPFVRWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM108624_LHBs_P-E Product feature CHAIN KM108624_LHBs_P-E of FT:mat_peptide KM108624_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH174OBIE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLISLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|KM108625_LHBs_P-E Product feature CHAIN KM108625_LHBs_P-E of FT:mat_peptide KM108625_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH188overtE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWSEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|KM108626_LHBs_P-E Product feature CHAIN KM108626_LHBs_P-E of FT:mat_peptide KM108626_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH193overtE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGLCRTCTTLAQGTSMFPSCCCSKSSDRNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KR139749_LHBs_P-E Product feature CHAIN KR139749_LHBs_P-E of FT:mat_peptide KR139749_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA45). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFEKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT192626_LHBs_P-E Product feature CHAIN KT192626_LHBs_P-E of FT:mat_peptide KT192626_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736891_LHBs_P-E Product feature CHAIN KU736891_LHBs_P-E of FT:mat_peptide KU736891_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736892_LHBs_P-E Product feature CHAIN KU736892_LHBs_P-E of FT:mat_peptide KU736892_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDXAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736893_LHBs_P-E Product feature CHAIN KU736893_LHBs_P-E of FT:mat_peptide KU736893_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Ethiopia_3). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736894_LHBs_P-E Product feature CHAIN KU736894_LHBs_P-E of FT:mat_peptide KU736894_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736895_LHBs_P-E Product feature CHAIN KU736895_LHBs_P-E of FT:mat_peptide KU736895_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736896_LHBs_P-E Product feature CHAIN KU736896_LHBs_P-E of FT:mat_peptide KU736896_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_3). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736897_LHBs_P-E Product feature CHAIN KU736897_LHBs_P-E of FT:mat_peptide KU736897_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_4). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736898_LHBs_P-E Product feature CHAIN KU736898_LHBs_P-E of FT:mat_peptide KU736898_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_5). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736899_LHBs_P-E Product feature CHAIN KU736899_LHBs_P-E of FT:mat_peptide KU736899_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_6). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSFGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736900_LHBs_P-E Product feature CHAIN KU736900_LHBs_P-E of FT:mat_peptide KU736900_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Somalia_2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736901_LHBs_P-E Product feature CHAIN KU736901_LHBs_P-E of FT:mat_peptide KU736901_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPSKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736902_LHBs_P-E Product feature CHAIN KU736902_LHBs_P-E of FT:mat_peptide KU736902_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_12). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736903_LHBs_P-E Product feature CHAIN KU736903_LHBs_P-E of FT:mat_peptide KU736903_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_13). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736904_LHBs_P-E Product feature CHAIN KU736904_LHBs_P-E of FT:mat_peptide KU736904_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_16). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMQKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736905_LHBs_P-E Product feature CHAIN KU736905_LHBs_P-E of FT:mat_peptide KU736905_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_17). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736906_LHBs_P-E Product feature CHAIN KU736906_LHBs_P-E of FT:mat_peptide KU736906_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_2). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736907_LHBs_P-E Product feature CHAIN KU736907_LHBs_P-E of FT:mat_peptide KU736907_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_3). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736908_LHBs_P-E Product feature CHAIN KU736908_LHBs_P-E of FT:mat_peptide KU736908_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_5). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736909_LHBs_P-E Product feature CHAIN KU736909_LHBs_P-E of FT:mat_peptide KU736909_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_6). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDXAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736910_LHBs_P-E Product feature CHAIN KU736910_LHBs_P-E of FT:mat_peptide KU736910_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_8). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736911_LHBs_P-E Product feature CHAIN KU736911_LHBs_P-E of FT:mat_peptide KU736911_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_9). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSRRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736912_LHBs_P-E Product feature CHAIN KU736912_LHBs_P-E of FT:mat_peptide KU736912_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_4). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736913_LHBs_P-E Product feature CHAIN KU736913_LHBs_P-E of FT:mat_peptide KU736913_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_7). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYIPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWAXARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLHNTLSPFILLLPIFFCLWVYI
>gnl|hbvpro|KX186584_LHBs_P-E Product feature CHAIN KX186584_LHBs_P-E of FT:mat_peptide KX186584_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Eafr). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623843_LHBs_P-E Product feature CHAIN LT623843_LHBs_P-E of FT:mat_peptide LT623843_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTXNPLGXFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPABPPPASTNRQSGRQPTPITPPLRDTHPQVMQWNSTTFRQALQDPRVRXLXXXAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMESITSGFLGPLLVLQEGFFXLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPISNHSPTSCPX
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|LT623844_LHBs_P-E Product feature CHAIN LT623844_LHBs_P-E of FT:mat_peptide LT623844_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGXTPPHGGLLGWSPQA
QGMLQTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHKALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDXAPNMESITSGFLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPXLYNILSPFIPLXPIFFCLWVYI
>gnl|hbvpro|LT623845_LHBs_P-E Product feature CHAIN LT623845_LHBs_P-E of FT:mat_peptide LT623845_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLTTLPANPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYYPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLXCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623846_LHBs_P-E Product feature CHAIN LT623846_LHBs_P-E of FT:mat_peptide LT623846_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWSEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623847_LHBs_P-E Product feature CHAIN LT623847_LHBs_P-E of FT:mat_peptide LT623847_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTXRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDANC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623848_LHBs_P-E Product feature CHAIN LT623848_LHBs_P-E of FT:mat_peptide LT623848_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623849_LHBs_P-E Product feature CHAIN LT623849_LHBs_P-E of FT:mat_peptide LT623849_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTVPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNXLSPFIPLXPIFFCLWVYI
>gnl|hbvpro|LT623850_LHBs_P-E Product feature CHAIN LT623850_LHBs_P-E of FT:mat_peptide LT623850_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623851_LHBs_P-E Product feature CHAIN LT623851_LHBs_P-E of FT:mat_peptide LT623851_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNXSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLSFLGEAPVCLGQNSQSPTSNHSPTSCPP
TCPGFRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVLFVQWFAGLSPTVWLSVIWMMWYWAPGLCNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772354_LHBs_P-E Product feature CHAIN MF772354_LHBs_P-E of FT:mat_peptide MF772354_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1067). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772355_LHBs_P-E Product feature CHAIN MF772355_LHBs_P-E of FT:mat_peptide MF772355_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 488). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVXPVPTTASLI
SSIFSRIGDLVPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQNLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772357_LHBs_P-E Product feature CHAIN MF772357_LHBs_P-E of FT:mat_peptide MF772357_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 222). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSKRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDLASNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQFPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQSLRNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772360_LHBs_P-E Product feature CHAIN MF772360_LHBs_P-E of FT:mat_peptide MF772360_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 666). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772362_LHBs_P-E Product feature CHAIN MF772362_LHBs_P-E of FT:mat_peptide MF772362_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 960). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464855_LHBs_P-E Product feature CHAIN MH464855_LHBs_P-E of FT:mat_peptide MH464855_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA133). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGLSWTVPLEXXGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASL
ISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGN
CTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464856_LHBs_P-E Product feature CHAIN MH464856_LHBs_P-E of FT:mat_peptide MH464856_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA134). Complete genome. [Hepadnaviridae] (length=400 residues).
MGLSWTVPLEXXGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASL
ISSIFSRIGDPAPNMESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDGN
CTCIPIPSSWAFGKFLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|MH580614_LHBs_P-E Product feature CHAIN MH580614_LHBs_P-E of FT:mat_peptide MH580614_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 177). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580615_LHBs_P-E Product feature CHAIN MH580615_LHBs_P-E of FT:mat_peptide MH580615_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 188). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580616_LHBs_P-E Product feature CHAIN MH580616_LHBs_P-E of FT:mat_peptide MH580616_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 190). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580617_LHBs_P-E Product feature CHAIN MH580617_LHBs_P-E of FT:mat_peptide MH580617_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 193). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTVPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580618_LHBs_P-E Product feature CHAIN MH580618_LHBs_P-E of FT:mat_peptide MH580618_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 199). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580619_LHBs_P-E Product feature CHAIN MH580619_LHBs_P-E of FT:mat_peptide MH580619_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 200). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580620_LHBs_P-E Product feature CHAIN MH580620_LHBs_P-E of FT:mat_peptide MH580620_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 201). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580621_LHBs_P-E Product feature CHAIN MH580621_LHBs_P-E of FT:mat_peptide MH580621_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 209). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580622_LHBs_P-E Product feature CHAIN MH580622_LHBs_P-E of FT:mat_peptide MH580622_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 210). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580623_LHBs_P-E Product feature CHAIN MH580623_LHBs_P-E of FT:mat_peptide MH580623_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 232). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580624_LHBs_P-E Product feature CHAIN MH580624_LHBs_P-E of FT:mat_peptide MH580624_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 226). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580625_LHBs_P-E Product feature CHAIN MH580625_LHBs_P-E of FT:mat_peptide MH580625_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 239). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580628_LHBs_P-E Product feature CHAIN MH580628_LHBs_P-E of FT:mat_peptide MH580628_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 304). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTVPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580629_LHBs_P-E Product feature CHAIN MH580629_LHBs_P-E of FT:mat_peptide MH580629_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 306). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTSASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580630_LHBs_P-E Product feature CHAIN MH580630_LHBs_P-E of FT:mat_peptide MH580630_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 310). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580631_LHBs_P-E Product feature CHAIN MH580631_LHBs_P-E of FT:mat_peptide MH580631_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 333). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNYSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580632_LHBs_P-E Product feature CHAIN MH580632_LHBs_P-E of FT:mat_peptide MH580632_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 334). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNYSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580634_LHBs_P-E Product feature CHAIN MH580634_LHBs_P-E of FT:mat_peptide MH580634_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 400). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPARNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580635_LHBs_P-E Product feature CHAIN MH580635_LHBs_P-E of FT:mat_peptide MH580635_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 401). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPARNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580636_LHBs_P-E Product feature CHAIN MH580636_LHBs_P-E of FT:mat_peptide MH580636_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 402). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPARNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580637_LHBs_P-E Product feature CHAIN MH580637_LHBs_P-E of FT:mat_peptide MH580637_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 408). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580638_LHBs_P-E Product feature CHAIN MH580638_LHBs_P-E of FT:mat_peptide MH580638_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 416). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|MH580640_LHBs_P-E Product feature CHAIN MH580640_LHBs_P-E of FT:mat_peptide MH580640_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 438). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580641_LHBs_P-E Product feature CHAIN MH580641_LHBs_P-E of FT:mat_peptide MH580641_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 439). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580644_LHBs_P-E Product feature CHAIN MH580644_LHBs_P-E of FT:mat_peptide MH580644_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 458). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTVPADPPPASTNRQSGRQPTPITLPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTANPVPTTVSLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580645_LHBs_P-E Product feature CHAIN MH580645_LHBs_P-E of FT:mat_peptide MH580645_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 472). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTCNHSPTSCPP
TCPGFRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPRSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580646_LHBs_P-E Product feature CHAIN MH580646_LHBs_P-E of FT:mat_peptide MH580646_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 476). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580647_LHBs_P-E Product feature CHAIN MH580647_LHBs_P-E of FT:mat_peptide MH580647_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 490). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580648_LHBs_P-E Product feature CHAIN MH580648_LHBs_P-E of FT:mat_peptide MH580648_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 522). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKDHWTQANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPLAVQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580649_LHBs_P-E Product feature CHAIN MH580649_LHBs_P-E of FT:mat_peptide MH580649_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 523). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKMLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580650_LHBs_P-E Product feature CHAIN MH580650_LHBs_P-E of FT:mat_peptide MH580650_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 619). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMRWNSPTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580651_LHBs_P-E Product feature CHAIN MH580651_LHBs_P-E of FT:mat_peptide MH580651_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 623). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPTDPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYPAGGSSSGTVNPVPTTASLIS
SIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCT
CIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580652_LHBs_P-E Product feature CHAIN MH580652_LHBs_P-E of FT:mat_peptide MH580652_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 668). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNYSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK321264_LHBs_P-E Product feature CHAIN MK321264_LHBs_P-E of FT:mat_peptide MK321264_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1332). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|X75657_LHBs_P-E Product feature CHAIN X75657_LHBs_P-E of FT:mat_peptide X75657_LHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Bas). Complete genome. [Hepadnaviridae] (length=399 residues).
MGLSWTVPLEWGKNISTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQA
QGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLI
SSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNC
TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
© 1998-2019