HBVdb

Dataset for protein Pol of genotype E

[Download (right click)] [Alignment] [Repertoires]

321 sequence(s)

>gnl|hbvpro|AB091255_Pol_P-E Product feature CHAIN AB091255_Pol_P-E of FT:mat_peptide AB091255_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-129). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPIATKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB091256_Pol_P-E Product feature CHAIN AB091256_Pol_P-E of FT:mat_peptide AB091256_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-212). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFSGLYSSTIPVFNPHWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHHYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRIKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVCRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB106564_Pol_C-E Product feature CHAIN AB106564_Pol_C-E of FT:mat_peptide AB106564_Pol_C-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA325). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYLHTLWKAGILYKR
ETTRYASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQASGMCSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRTASCLHQAAVRKAAYPNHSTFERHSSSGHAAELHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
GSRNLYVSLMLLFKTCGRKLHLYPHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYPLNFMGYVIGSWGSLPQEHIKQKIKDCFRKLPVTRPIDWKARQGIVGLLG
FAAPFTQCGYPALMPLYACIQSGQAFTFSPTYKAFLCQQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB194947_Pol_P-E Product feature CHAIN AB194947_Pol_P-E of FT:mat_peptide AB194947_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR954). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPTFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPLSTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHRSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB194948_Pol_P-E Product feature CHAIN AB194948_Pol_P-E of FT:mat_peptide AB194948_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR936). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPNNVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFYGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQCKHQKSRLGPQSQQRPLDGSQPGRSG
SIRAGVHSPTRRPSGGEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGARSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB201287_Pol_P-E Product feature CHAIN AB201287_Pol_P-E of FT:mat_peptide AB201287_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin11). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTPKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRFFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNTNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AB201288_Pol_P-E Product feature CHAIN AB201288_Pol_P-E of FT:mat_peptide AB201288_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin89). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPARRPFGVEPSGSGHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGNAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGRQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB201289_Pol_P-E Product feature CHAIN AB201289_Pol_P-E of FT:mat_peptide AB201289_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin269). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB201290_Pol_P-E Product feature CHAIN AB201290_Pol_P-E of FT:mat_peptide AB201290_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin293). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLERSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSTSCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205129_Pol_P-E Product feature CHAIN AB205129_Pol_P-E of FT:mat_peptide AB205129_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758-2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSRQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHSIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPGTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACVQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205189_Pol_P-E Product feature CHAIN AB205189_Pol_P-E of FT:mat_peptide AB205189_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G138). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEGLPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTSSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRARVHSPTRRPFGVEPSGSRHAKNIANRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPFRGRLGIFRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205190_Pol_P-E Product feature CHAIN AB205190_Pol_P-E of FT:mat_peptide AB205190_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G123). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDCPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQNSRLGPQSQQRPLDRSQQGRSG
SIRAGVLSPARRPFGVEPSGSRHVTNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKGPVS
SCWWLQFRNSEPCSDYCLTHLINLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYIARLSSTSRISNHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIQLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205191_Pol_P-E Product feature CHAIN AB205191_Pol_P-E of FT:mat_peptide AB205191_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G166). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRARVHSPTRRPFGVEPSGSRHAKNSANRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFAA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205192_Pol_P-E Product feature CHAIN AB205192_Pol_P-E of FT:mat_peptide AB205192_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
GTTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHSIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACVQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTYIYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB219533_Pol_P-E Product feature CHAIN AB219533_Pol_P-E of FT:mat_peptide AB219533_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate UK5). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFYGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGQQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPSGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKKPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRDLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLEALYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYEIGSFGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVCRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB274969_Pol_P-E Product feature CHAIN AB274969_Pol_P-E of FT:mat_peptide AB274969_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLYQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSG
CIRAGVHSPTRKPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274970_Pol_P-E Product feature CHAIN AB274970_Pol_P-E of FT:mat_peptide AB274970_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPHLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHTKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHKYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYSCIQSKQAFTFSPTYKAFLYTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274971_Pol_P-E Product feature CHAIN AB274971_Pol_P-E of FT:mat_peptide AB274971_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274974_Pol_P-E Product feature CHAIN AB274974_Pol_P-E of FT:mat_peptide AB274974_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRSLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLLQSSVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274975_Pol_P-E Product feature CHAIN AB274975_Pol_P-E of FT:mat_peptide AB274975_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSG
CIRAGVHSPTRRPFGMEPSGSRHANNIANRSAYCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274976_Pol_P-E Product feature CHAIN AB274976_Pol_P-E of FT:mat_peptide AB274976_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFSGLYSTTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGMEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSEQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPINRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274977_Pol_P-E Product feature CHAIN AB274977_Pol_P-E of FT:mat_peptide AB274977_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLFLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKPPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYSWEQELHHGAFLDGPSRMGEESIHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHPPTRRPFGVEPSGSRHATNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYQNLFPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274978_Pol_P-E Product feature CHAIN AB274978_Pol_P-E of FT:mat_peptide AB274978_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSG
CIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSNRPVF
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHITLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274979_Pol_P-E Product feature CHAIN AB274979_Pol_P-E of FT:mat_peptide AB274979_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFAGLYSSTIPVFNPHWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAFLDGPSRMGEKSVHHQSSGIFSRPPVGSRIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFESHSSSGHSVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNMHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGHTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274980_Pol_P-E Product feature CHAIN AB274980_Pol_P-E of FT:mat_peptide AB274980_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
NIHLHQDIVNKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLRQSAVRQAAYPNHSTFERHSSSGHAVEFHNIPPGSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYIARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFAHSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274981_Pol_P-E Product feature CHAIN AB274981_Pol_P-E of FT:mat_peptide AB274981_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLHNVSIPWTHKVGNFAGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRVGEESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRTQRGRSE
CIRAGVHSPTRRPFGVEPSGSRHAKNIANRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDP
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGFPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELIAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFHPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274982_Pol_P-E Product feature CHAIN AB274982_Pol_P-E of FT:mat_peptide AB274982_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLHNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEEFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPCGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB274984_Pol_P-E Product feature CHAIN AB274984_Pol_P-E of FT:mat_peptide AB274984_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=834 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPDVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGMEPSGSRHANNIASTAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKGPAIPCWWLQFR
NSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWPKFAV
PNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIKHQYRTLPNLHDSCSRNLYVS
LMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTA
VTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQC
GYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHTAE
LLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLPFQPT
TGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB915175_Pol_P-E Product feature CHAIN AB915175_Pol_P-E of FT:mat_peptide AB915175_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHLQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKKPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB915178_Pol_P-E Product feature CHAIN AB915178_Pol_P-E of FT:mat_peptide AB915178_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA4). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESIHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLXRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAANPNHSTFERYSSPGHAVEFQDIPPSSAGXQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACXQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB915180_Pol_P-E Product feature CHAIN AB915180_Pol_P-E of FT:mat_peptide AB915180_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA6). Non-functional genomic sequence. [Hepadnaviridae] (length=836 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAKDLNLEVPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSLYSWEQELHHGAFLDGPSRMGEESVHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWAHSPTRRPFGVESSGSRHAKNIASRSASCLHQSAVRKAAYSNHSTFERHSSSGHAVEFHDIPPSSAGSHSCWWLQ
FRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWPKF
AVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDSCSRNLY
VSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGARSVHHLESLY
TAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFT
QCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHI
AELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLRLPFQ
PTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AM494689_Pol_P-E Product feature CHAIN AM494689_Pol_P-E of FT:mat_peptide AM494689_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR006). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYLHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIIDKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEPELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAIRKAAYPNHSTFERHSSSGHAMEFHNIPPSSAGSHSKSCWW
LQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDSCSRN
LYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLES
LYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLP
FQPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|AM494690_Pol_P-E Product feature CHAIN AM494690_Pol_P-E of FT:mat_peptide AM494690_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR008). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSNIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494691_Pol_P-E Product feature CHAIN AM494691_Pol_P-E of FT:mat_peptide AM494691_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR024). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESIHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTWRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKGPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRDLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494692_Pol_P-E Product feature CHAIN AM494692_Pol_P-E of FT:mat_peptide AM494692_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR026). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGISSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRHFGVEPSGSRHAKNIASRSASCLHQSAIRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHIVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494693_Pol_P-E Product feature CHAIN AM494693_Pol_P-E of FT:mat_peptide AM494693_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR039). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494694_Pol_P-E Product feature CHAIN AM494694_Pol_P-E of FT:mat_peptide AM494694_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR047). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPYFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGAHSPTRRPSGVESSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHTVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEXWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494695_Pol_P-E Product feature CHAIN AM494695_Pol_P-E of FT:mat_peptide AM494695_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR053). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDTEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSAFCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEYGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRINNHQYGTLPNLHDS
CSRNLYVSLMLLFKTYGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494696_Pol_P-E Product feature CHAIN AM494696_Pol_P-E of FT:mat_peptide AM494696_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR060). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPYFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGAHSPTRRPSGVESSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHTVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494697_Pol_P-E Product feature CHAIN AM494697_Pol_P-E of FT:mat_peptide AM494697_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR063). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAIRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494699_Pol_P-E Product feature CHAIN AM494699_Pol_P-E of FT:mat_peptide AM494699_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR082). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKAFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKITDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIHSKQAFIFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494700_Pol_P-E Product feature CHAIN AM494700_Pol_P-E of FT:mat_peptide AM494700_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR083). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPYFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGAHSPTRRPSGVESSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHTVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494701_Pol_P-E Product feature CHAIN AM494701_Pol_P-E of FT:mat_peptide AM494701_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR097). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPLGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494702_Pol_P-E Product feature CHAIN AM494702_Pol_P-E of FT:mat_peptide AM494702_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR106). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVESSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494703_Pol_P-E Product feature CHAIN AM494703_Pol_P-E of FT:mat_peptide AM494703_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR107). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLKEELPRLADEDLNRRVAEDLNLHLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLARSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAENIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRIKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494704_Pol_P-E Product feature CHAIN AM494704_Pol_P-E of FT:mat_peptide AM494704_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR112). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494705_Pol_P-E Product feature CHAIN AM494705_Pol_P-E of FT:mat_peptide AM494705_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR115). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SLRAGVHSPTWRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINNQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKECFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRTRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494706_Pol_P-E Product feature CHAIN AM494706_Pol_P-E of FT:mat_peptide AM494706_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR131). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAIRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGXHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494707_Pol_P-E Product feature CHAIN AM494707_Pol_P-E of FT:mat_peptide AM494707_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR137). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494708_Pol_P-E Product feature CHAIN AM494708_Pol_P-E of FT:mat_peptide AM494708_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494709_Pol_P-E Product feature CHAIN AM494709_Pol_P-E of FT:mat_peptide AM494709_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR143). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAIRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDHCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494710_Pol_P-E Product feature CHAIN AM494710_Pol_P-E of FT:mat_peptide AM494710_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR144). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQALHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRSFGVEPSGSRHAKNIASRSASCLHQSAIRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494713_Pol_P-E Product feature CHAIN AM494713_Pol_P-E of FT:mat_peptide AM494713_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR154). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAFRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494714_Pol_P-E Product feature CHAIN AM494714_Pol_P-E of FT:mat_peptide AM494714_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR165). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLHLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCFHQSAIRKAAYPNHSTFERHSSSGRAVEFQNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIKIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQ
HLESLYTAVTNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494715_Pol_P-E Product feature CHAIN AM494715_Pol_P-E of FT:mat_peptide AM494715_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR171). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYXPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM494717_Pol_P-E Product feature CHAIN AM494717_Pol_P-E of FT:mat_peptide AM494717_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR187). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY738144_Pol_P-E Product feature CHAIN AY738144_Pol_P-E of FT:mat_peptide AY738144_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPLLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSEHQKSRLGPQSQQRSLDSSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQGKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGQHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRITNHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY738145_Pol_C-E Product feature CHAIN AY738145_Pol_C-E of FT:mat_peptide AY738145_Pol_C-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPLLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSREHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSEHQKSRLGPQSQQRSLDSSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQGKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGQHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRITNHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY738146_Pol_P-E Product feature CHAIN AY738146_Pol_P-E of FT:mat_peptide AY738146_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPLLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWERELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSEHQKSRLGPQSQQRSLDSSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQGKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGQHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRITNHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY738147_Pol_P-E Product feature CHAIN AY738147_Pol_P-E of FT:mat_peptide AY738147_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 10/98). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPLLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSEHQKSRLGPQSQQRSLDGSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQGKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGQHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRITNHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY739674_Pol_P-E Product feature CHAIN AY739674_Pol_P-E of FT:mat_peptide AY739674_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHVTNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVELHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNPRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSIQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY739675_Pol_P-E Product feature CHAIN AY739675_Pol_P-E of FT:mat_peptide AY739675_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHVTNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVELHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNPRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSIQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY935700_Pol_P-E Product feature CHAIN AY935700_Pol_P-E of FT:mat_peptide AY935700_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate TH-HBV-012). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNLASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060822_Pol_P-E Product feature CHAIN DQ060822_Pol_P-E of FT:mat_peptide DQ060822_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8510-91). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSVQSKYQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060823_Pol_P-E Product feature CHAIN DQ060823_Pol_P-E of FT:mat_peptide DQ060823_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8504-91). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVISSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060824_Pol_P-E Product feature CHAIN DQ060824_Pol_P-E of FT:mat_peptide DQ060824_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0121-20). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDKSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGIQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGGYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060825_Pol_P-E Product feature CHAIN DQ060825_Pol_P-E of FT:mat_peptide DQ060825_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0262-09). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIWAWVHSPTRRPFGVEPSGSRHAKDIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGLQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060826_Pol_P-E Product feature CHAIN DQ060826_Pol_P-E of FT:mat_peptide DQ060826_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0433-20). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTLSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTLGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYTCIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060827_Pol_P-E Product feature CHAIN DQ060827_Pol_P-E of FT:mat_peptide DQ060827_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0317-04). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEHELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGMEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAVMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIAIQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060828_Pol_P-E Product feature CHAIN DQ060828_Pol_P-E of FT:mat_peptide DQ060828_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0443-03). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLENGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGLQRMRGTFGA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVSRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060829_Pol_P-E Product feature CHAIN DQ060829_Pol_P-E of FT:mat_peptide DQ060829_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0350-03). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLENGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGLQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVSRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ060830_Pol_P-E Product feature CHAIN DQ060830_Pol_P-E of FT:mat_peptide DQ060830_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 235-01). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADDDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSPGHAVEFHNIPPSSARSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU239217_Pol_P-E Product feature CHAIN EU239217_Pol_P-E of FT:mat_peptide EU239217_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate G2451). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSG
CIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHITLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU239218_Pol_P-E Product feature CHAIN EU239218_Pol_P-E of FT:mat_peptide EU239218_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHLQSSGILSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLQNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU239219_Pol_P-E Product feature CHAIN EU239219_Pol_P-E of FT:mat_peptide EU239219_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW3). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSTGSQSKRPVF
SCWWLQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSRQAFTFSPTYKAFLCNQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU239220_Pol_P-E Product feature CHAIN EU239220_Pol_P-E of FT:mat_peptide EU239220_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW5). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLTLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ESSRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHRKSSGIFSRPPVGSSIQSKHQKSRLGQQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKDIASRSASCLHQSAVRKAAYPNYSTFERHSSSGRSVEFHNIPPKSAGSQSKRPVF
SCWWLQFRDSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSHLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIIDHQYGTLPNLHDS
CSRNLYVSLMLLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLALGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLALGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU239221_Pol_P-E Product feature CHAIN EU239221_Pol_P-E of FT:mat_peptide EU239221_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRARVHSPTRRPFGVEPSGSRHAKNIANRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVP
HLESLYTSVTNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQNHIRRKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU239222_Pol_P-E Product feature CHAIN EU239222_Pol_P-E of FT:mat_peptide EU239222_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFP
DIHLHQDIINKCVQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFYGSPYSWEQELHHGAFLDGPSRMGEESFHLQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAESQSKRPVF
SCWWLQFRNSEPCSDHCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLQNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQYKQAFTFSPIYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU239223_Pol_P-E Product feature CHAIN EU239223_Pol_P-E of FT:mat_peptide EU239223_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW4). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIAGRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSTGSQSKRPVF
SCWWLQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSRQAFTFSPTYKAFLCNQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU239224_Pol_P-E Product feature CHAIN EU239224_Pol_P-E of FT:mat_peptide EU239224_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDGEAGPLEEELPRLADEELNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESVHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRTLDGSQQGRSG
SIRAGVHSPTRRPSGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHYIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKAFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPVDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU239226_Pol_P-E Product feature CHAIN EU239226_Pol_P-E of FT:mat_peptide EU239226_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW6). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSG
CIRAGVHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSIFERHSSSGHAVEFHNIPPSSTGSQSKRPVF
SCWWLQFRNSKPCSDYCLTHLANLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSATNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349226_Pol_P-E Product feature CHAIN FJ349226_Pol_P-E of FT:mat_peptide FJ349226_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate H6). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFP
DIHLHQDIINKCEQLVGPLTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLQDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYISLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349237_Pol_P-E Product feature CHAIN FJ349237_Pol_P-E of FT:mat_peptide FJ349237_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C27). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINRCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349238_Pol_P-E Product feature CHAIN FJ349238_Pol_P-E of FT:mat_peptide FJ349238_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C65). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349239_Pol_P-E Product feature CHAIN FJ349239_Pol_P-E of FT:mat_peptide FJ349239_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C74). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPIVTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHATNIASRSASCLHQSAIREAAYPNHSTFERHASSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349240_Pol_P-E Product feature CHAIN FJ349240_Pol_P-E of FT:mat_peptide FJ349240_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C89). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
EIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYQDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLVRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHHIPPSSAGSQSNSCWW
LQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDSCSRN
LYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVAPLPI
HTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLP
FQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545821_Pol_P-E Product feature CHAIN FN545821_Pol_P-E of FT:mat_peptide FN545821_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGLEPSGSGHAENIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRDLXVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLEALYTSVTNFLLSLGIHLNTNKTKRWGYSLNFMGYVIGSWGSLPQEHIXMKIKDCFRKLPINRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545822_Pol_P-E Product feature CHAIN FN545822_Pol_P-E of FT:mat_peptide FN545822_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQVRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLHHGAFLDGPSRMGEESFHHQSSGIFXRPPVGSSIQGKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPARRPFGVEPSGSGHAKNIASRSASCLHQSEVRKAAYPNHSTFERNSSSGHEVEFHNIPPSSAGSQNKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPXKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAXLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FN545823_Pol_P-E Product feature CHAIN FN545823_Pol_P-E of FT:mat_peptide FN545823_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRXLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRARVHSPTRRPFGXEPSGSRHANNVASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFYNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCXQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545827_Pol_P-E Product feature CHAIN FN545827_Pol_P-E of FT:mat_peptide FN545827_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGXQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHSIPPSSAGSQSKSCWW
LQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDSCSRN
LYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKXVQHLES
LYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLP
FQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN545841_Pol_P-E Product feature CHAIN FN545841_Pol_P-E of FT:mat_peptide FN545841_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHSIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FN545842_Pol_P-E Product feature CHAIN FN545842_Pol_P-E of FT:mat_peptide FN545842_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGTFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHTVEFHSIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIKLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594748_Pol_P-E Product feature CHAIN FN594748_Pol_P-E of FT:mat_peptide FN594748_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne6). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPAKFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYLXTLWKAGILYKR
ETTRSASFWGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSG
SIWAGXHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNPRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSFGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594749_Pol_P-E Product feature CHAIN FN594749_Pol_P-E of FT:mat_peptide FN594749_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne8). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFWGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHEVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLYSNSRIINHQYWPHQSLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSQQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFXA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594750_Pol_P-E Product feature CHAIN FN594750_Pol_P-E of FT:mat_peptide FN594750_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne12). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNERRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFWGSPYSWEQELXHGAFLDRPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSXFERHSSSGHAVEFQNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILQGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FN594751_Pol_P-E Product feature CHAIN FN594751_Pol_P-E of FT:mat_peptide FN594751_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne52H). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRSILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWEAGILYKR
ETTRSASFYGSPYSWEQELHHGAFLDGPSRMGEESFHHQSFGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANTIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHTVEFQNIPPSSAGSQSKRPSF
FRWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLAWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLLIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVFRPL
LRLPFRPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FN594752_Pol_P-E Product feature CHAIN FN594752_Pol_P-E of FT:mat_peptide FN594752_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne134). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFWGSPYSWEQGLHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGQQSQQRPLDRSQRGRSG
SFWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FN594756_Pol_P-E Product feature CHAIN FN594756_Pol_P-E of FT:mat_peptide FN594756_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne250). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGTFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQQSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHVTNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSNRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYRTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKQKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594758_Pol_P-E Product feature CHAIN FN594758_Pol_P-E of FT:mat_peptide FN594758_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne341). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSCQRFRRILLLDEEAGPLEEELPHLADADLNRRVAEDLNLQLPNVNIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFXDGPSPMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYASIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594759_Pol_P-E Product feature CHAIN FN594759_Pol_P-E of FT:mat_peptide FN594759_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne342). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSCQRFRRILLLDEEAGPLEEELPHLADADLNRRVAEDLNLQLPNVNIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSLMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQCGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594760_Pol_P-E Product feature CHAIN FN594760_Pol_P-E of FT:mat_peptide FN594760_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne362). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSCQRFRRILLLDEEAGPLEEELPHLADADLNRRVAEDLNLQLPNVNIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSFGIFSRPPVGSSIQSKHQQSRLGRQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFQNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGGSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLDGSSGLSRNVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNNTKRWGYPPNFMGNVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSRQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594761_Pol_P-E Product feature CHAIN FN594761_Pol_P-E of FT:mat_peptide FN594761_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne385). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSG
SIWAGAHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPKTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSEQ
HLESLYTAVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPXTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594762_Pol_P-E Product feature CHAIN FN594762_Pol_P-E of FT:mat_peptide FN594762_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne439). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSAIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLILPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYLHTLWEAGILYKR
ETTRSASFWGSPYSWEQELHHGSFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLEKSQQGRSG
SILAGAHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSHSRRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FN594763_Pol_P-E Product feature CHAIN FN594763_Pol_P-E of FT:mat_peptide FN594763_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne446). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRSILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWEAGILYKR
ETTRSASFYGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FN594765_Pol_P-E Product feature CHAIN FN594765_Pol_P-E of FT:mat_peptide FN594765_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne9447). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPDVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSXMGEESFHHQSFGIFSRPPVGSSIQSKHQXSRLGSQSQQRPLDRSQQGRSG
IIRAGVHSPTRRPFGVEXSGSRHAKNIASRSASCLHQSAVRKAAYPNHSSFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHIVNLLEDWGPCTEHGKHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSEQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQDHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLFKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFMA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FN594766_Pol_P-E Product feature CHAIN FN594766_Pol_P-E of FT:mat_peptide FN594766_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne9449). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPHLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFGGSPYSWEQELHHGAFLDGPSRMGEESFHHQSFGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSG
IIRAGVHSPTRRPFGVEXSGSRHAKNIASRSASCLHQSAVRKAAYPNHSSFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAYFHLPLHPAAMPHLLVGSSGLSRYLARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGNVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161755_Pol_P-E Product feature CHAIN GQ161755_Pol_P-E of FT:mat_peptide GQ161755_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1694). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTCSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHKSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPSRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARKRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161756_Pol_P-E Product feature CHAIN GQ161756_Pol_P-E of FT:mat_peptide GQ161756_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1684). Non-functional genomic sequence. [Hepadnaviridae] (length=833 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKYQKSRLGPQSQQRPLDGSQQGRSG
SIRAGAHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSATCWWLQFRN
SEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWPKFAVP
NLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINHQYGTLPNLHDSCSRNLYVSL
MLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTSV
TNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
YPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHTAEL
LAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLPFQPTT
GRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161757_Pol_P-E Product feature CHAIN GQ161757_Pol_P-E of FT:mat_peptide GQ161757_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1156). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIKIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDY
CSRNLYVSLMLLFKTFGRKLHLYSHPVIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPTHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161758_Pol_P-E Product feature CHAIN GQ161758_Pol_P-E of FT:mat_peptide GQ161758_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1506). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPIFNPNWKTPFFP
DIHLHQDIINRCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVELHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFLFSPTYKAFLCNQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161759_Pol_P-E Product feature CHAIN GQ161759_Pol_P-E of FT:mat_peptide GQ161759_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU934). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHATNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYISLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ161760_Pol_P-E Product feature CHAIN GQ161760_Pol_P-E of FT:mat_peptide GQ161760_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1374). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPTRMGKESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTWRPFGVEPSGSRHAKNIASKSASCLHHLAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPEF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYLARLSSNSRIINHQYGTMPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPTHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161761_Pol_P-E Product feature CHAIN GQ161761_Pol_P-E of FT:mat_peptide GQ161761_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1033). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKYQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSERPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHIAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161762_Pol_P-E Product feature CHAIN GQ161762_Pol_P-E of FT:mat_peptide GQ161762_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU716). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEELFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPARRPFGVEPSGSRHVTNIASRSPSCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIAGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161763_Pol_P-E Product feature CHAIN GQ161763_Pol_P-E of FT:mat_peptide GQ161763_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1013). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPICTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFVDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161764_Pol_P-E Product feature CHAIN GQ161764_Pol_P-E of FT:mat_peptide GQ161764_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1056). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161765_Pol_P-E Product feature CHAIN GQ161765_Pol_P-E of FT:mat_peptide GQ161765_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU952). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPSSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIQDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161766_Pol_P-E Product feature CHAIN GQ161766_Pol_P-E of FT:mat_peptide GQ161766_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1671). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPIFNPNWKTPFFP
DIHLHQDIINRCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVELHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFLFSPTYKAFLCNQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161768_Pol_P-E Product feature CHAIN GQ161768_Pol_P-E of FT:mat_peptide GQ161768_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU960). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGAHSPTRRPFGVEPSGSRHAKNIASRSTSCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQ
HLESIYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSWSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ161769_Pol_P-E Product feature CHAIN GQ161769_Pol_P-E of FT:mat_peptide GQ161769_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU865). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPFFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPSSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIQDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161770_Pol_P-E Product feature CHAIN GQ161770_Pol_P-E of FT:mat_peptide GQ161770_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU927). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFCRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161771_Pol_P-E Product feature CHAIN GQ161771_Pol_P-E of FT:mat_peptide GQ161771_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU896). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRTFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|GQ161772_Pol_P-E Product feature CHAIN GQ161772_Pol_P-E of FT:mat_peptide GQ161772_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU873). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFKPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLEGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161773_Pol_P-E Product feature CHAIN GQ161773_Pol_P-E of FT:mat_peptide GQ161773_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1406). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAMEFHNIPPNSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCSEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLFPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161774_Pol_P-E Product feature CHAIN GQ161774_Pol_P-E of FT:mat_peptide GQ161774_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1501). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPIFNPNWKTPFFP
DIHLHQDIINRCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVELHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFLFSPTYKAFLCNQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161775_Pol_P-E Product feature CHAIN GQ161775_Pol_P-E of FT:mat_peptide GQ161775_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU754). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPDVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPARRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPTSAESQSKRSGF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFXQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSXIINHQYGTLXNLHDS
CSRXLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPHKTKRWGYSLHFMGYXIGSWGSLPQXHIXXKIKBCFRKLPXNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCXANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161776_Pol_P-E Product feature CHAIN GQ161776_Pol_P-E of FT:mat_peptide GQ161776_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1178). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPARRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSTGSQSKRPVF
SCWWLQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161777_Pol_P-E Product feature CHAIN GQ161777_Pol_P-E of FT:mat_peptide GQ161777_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU807). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFVDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLXFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161778_Pol_P-E Product feature CHAIN GQ161778_Pol_P-E of FT:mat_peptide GQ161778_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1035). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKIIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPSTGRTSLYAVSPSVPTHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161779_Pol_P-E Product feature CHAIN GQ161779_Pol_P-E of FT:mat_peptide GQ161779_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU557). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPFFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPSSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPDLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIQDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161780_Pol_P-E Product feature CHAIN GQ161780_Pol_P-E of FT:mat_peptide GQ161780_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU50). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEDLPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPDLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161781_Pol_P-E Product feature CHAIN GQ161781_Pol_P-E of FT:mat_peptide GQ161781_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU200). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRLLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161782_Pol_P-E Product feature CHAIN GQ161782_Pol_P-E of FT:mat_peptide GQ161782_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1489). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
XXTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRHIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LCLPFHPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161783_Pol_P-E Product feature CHAIN GQ161783_Pol_P-E of FT:mat_peptide GQ161783_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU981). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAENLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSRIPSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASSSASCLHQSAVRKAAYPNHSTFERHSSSGHAMEFHNIPPSSAGSQSKRSVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHITMKIKDCFRNLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161784_Pol_P-E Product feature CHAIN GQ161784_Pol_P-E of FT:mat_peptide GQ161784_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU766). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPARRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSTGSQSKRPVF
SCWWLQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161785_Pol_P-E Product feature CHAIN GQ161785_Pol_P-E of FT:mat_peptide GQ161785_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU758). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSVHHQSSGIFSRPPVGSSIQSKHPKSRLGPQSQQRPLDGSQQGRSG
SIRDGVHSPTRRPFGVEPSGSRHATNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAMEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKTFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161786_Pol_P-E Product feature CHAIN GQ161786_Pol_P-E of FT:mat_peptide GQ161786_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1688). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEGLNRRVAEDLNLQLPNVSIPWTHKVGVHTGLYSSTIPVFNPNWKPPSFP
DIHLHQDIIYKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPGNVVNHYFQTRHYLHTLWQAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGMEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PQPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161787_Pol_P-E Product feature CHAIN GQ161787_Pol_P-E of FT:mat_peptide GQ161787_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU841). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161789_Pol_P-E Product feature CHAIN GQ161789_Pol_P-E of FT:mat_peptide GQ161789_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1169). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPARRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSTGSQSKRPVF
SCWWLQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161790_Pol_P-E Product feature CHAIN GQ161790_Pol_P-E of FT:mat_peptide GQ161790_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1408). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGLPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKYIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161791_Pol_P-E Product feature CHAIN GQ161791_Pol_P-E of FT:mat_peptide GQ161791_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU459). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161792_Pol_P-E Product feature CHAIN GQ161792_Pol_P-E of FT:mat_peptide GQ161792_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU605). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LCLPFHPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161793_Pol_P-E Product feature CHAIN GQ161793_Pol_P-E of FT:mat_peptide GQ161793_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU932). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPPEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPGRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161794_Pol_P-E Product feature CHAIN GQ161794_Pol_P-E of FT:mat_peptide GQ161794_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU846). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHPKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPLDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLYLYPVVRQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161795_Pol_P-E Product feature CHAIN GQ161795_Pol_P-E of FT:mat_peptide GQ161795_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1558). Non-functional genomic sequence. [Hepadnaviridae] (length=833 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKYQKSRLGPQSQQRPLDGSQQGRSG
SIRAGAHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSATCWWLQFRN
SEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWPKFAVP
NLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINHQYGTLPNLHDSCSRNLYVSL
MLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTSV
TNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
YPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHTAEL
LAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLPFQPTT
GRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161797_Pol_P-E Product feature CHAIN GQ161797_Pol_P-E of FT:mat_peptide GQ161797_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1660). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGSFSRPPVGSSIQSKHQKSRLGPQSQQRSLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAHPNHSTFERHSSSGHAVEFHNIPPSSAGSQNQRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161798_Pol_P-E Product feature CHAIN GQ161798_Pol_P-E of FT:mat_peptide GQ161798_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1222). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSTRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161799_Pol_P-E Product feature CHAIN GQ161799_Pol_P-E of FT:mat_peptide GQ161799_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU732). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGLPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKYIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161800_Pol_P-E Product feature CHAIN GQ161800_Pol_P-E of FT:mat_peptide GQ161800_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1039). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161801_Pol_P-E Product feature CHAIN GQ161801_Pol_P-E of FT:mat_peptide GQ161801_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU438). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIHVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161802_Pol_P-E Product feature CHAIN GQ161802_Pol_P-E of FT:mat_peptide GQ161802_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU921). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAMEFHNIPPNSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCSEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLFPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161803_Pol_P-E Product feature CHAIN GQ161803_Pol_P-E of FT:mat_peptide GQ161803_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1700). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRHVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWEAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPKSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGRAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKKAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|GQ161804_Pol_P-E Product feature CHAIN GQ161804_Pol_P-E of FT:mat_peptide GQ161804_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1428). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPPEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161805_Pol_P-E Product feature CHAIN GQ161805_Pol_P-E of FT:mat_peptide GQ161805_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1410). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGLPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKYIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161807_Pol_P-E Product feature CHAIN GQ161807_Pol_P-E of FT:mat_peptide GQ161807_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1168). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRPGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSERPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161808_Pol_P-E Product feature CHAIN GQ161808_Pol_P-E of FT:mat_peptide GQ161808_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1398). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKIIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPTHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161810_Pol_P-E Product feature CHAIN GQ161810_Pol_P-E of FT:mat_peptide GQ161810_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU852). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKIIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPSTGRTSLYAVSPSVPTHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161811_Pol_P-E Product feature CHAIN GQ161811_Pol_P-E of FT:mat_peptide GQ161811_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1361). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFP
DIHLHQDIIKKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNSASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161812_Pol_P-E Product feature CHAIN GQ161812_Pol_P-E of FT:mat_peptide GQ161812_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1577). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRRKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFHPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ161814_Pol_P-E Product feature CHAIN GQ161814_Pol_P-E of FT:mat_peptide GQ161814_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU625). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLANEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LCLPFHPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161815_Pol_P-E Product feature CHAIN GQ161815_Pol_P-E of FT:mat_peptide GQ161815_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1241). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFRHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASSSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161816_Pol_P-E Product feature CHAIN GQ161816_Pol_P-E of FT:mat_peptide GQ161816_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1214). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHVTNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161817_Pol_P-E Product feature CHAIN GQ161817_Pol_P-E of FT:mat_peptide GQ161817_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU630). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
NIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161818_Pol_P-E Product feature CHAIN GQ161818_Pol_P-E of FT:mat_peptide GQ161818_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1520). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGLPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKYIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161819_Pol_P-E Product feature CHAIN GQ161819_Pol_P-E of FT:mat_peptide GQ161819_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1062). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161820_Pol_P-E Product feature CHAIN GQ161820_Pol_P-E of FT:mat_peptide GQ161820_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1089). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPIXTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPXSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGXHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHXPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLXFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRXGLCQVFADATPTGWGLAIGHQRMRGTFVA
PXPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSXLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161821_Pol_P-E Product feature CHAIN GQ161821_Pol_P-E of FT:mat_peptide GQ161821_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1405). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGLPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKYIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFPPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161822_Pol_P-E Product feature CHAIN GQ161822_Pol_P-E of FT:mat_peptide GQ161822_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1086). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
SYQQLRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIH
LHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETT
RSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIR
AGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVSSCW
WLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDSCSR
NLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLE
SLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRL
PFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161824_Pol_P-E Product feature CHAIN GQ161824_Pol_P-E of FT:mat_peptide GQ161824_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU893). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAENLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSRIPSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASSSASCLHQSAVRKAAYPNHSTFERHSSSGHAMEFHNIPPSSAGSQSKRSVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHITMKIKDCFRNLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161825_Pol_P-E Product feature CHAIN GQ161825_Pol_P-E of FT:mat_peptide GQ161825_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1769). Complete genome. [Hepadnaviridae] (length=841 residues).
MPLSYQHFRRLLLLDQAGPIEEELPHLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSSIPVFNPNWKTPSFPD
IHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRE
TTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRSLDRSQQGRSGS
IRAGVHSTTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVFS
CWWLQFRNSEPCSDYCITHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPQNTAESRLVVDFSQFSRGSSRV
SWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDSC
SRNLYVSLMLLFKTYGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQH
LESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLGF
AAPFTQCGYPALMPLYSCIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAP
LPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLL
RLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161827_Pol_P-E Product feature CHAIN GQ161827_Pol_P-E of FT:mat_peptide GQ161827_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU180). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPPEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRAGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161828_Pol_P-E Product feature CHAIN GQ161828_Pol_P-E of FT:mat_peptide GQ161828_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1399). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPARRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSTGSQSKRPVF
SCWWLQFRNSEPCSDYCLSHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161829_Pol_P-E Product feature CHAIN GQ161829_Pol_P-E of FT:mat_peptide GQ161829_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU719). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161830_Pol_P-E Product feature CHAIN GQ161830_Pol_P-E of FT:mat_peptide GQ161830_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1365). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKYQKSRLGPQSQQRPLDGSQQGRSG
SIRTGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161832_Pol_P-E Product feature CHAIN GQ161832_Pol_P-E of FT:mat_peptide GQ161832_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1091). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIIIKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
MSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161833_Pol_P-E Product feature CHAIN GQ161833_Pol_P-E of FT:mat_peptide GQ161833_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU489). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQQLRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLDLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161834_Pol_P-E Product feature CHAIN GQ161834_Pol_P-E of FT:mat_peptide GQ161834_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1128). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQLFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKPPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSGMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSHQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSPAHAVEFHNIPPSSSGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PMPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161835_Pol_P-E Product feature CHAIN GQ161835_Pol_P-E of FT:mat_peptide GQ161835_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU925). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHKSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPSRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ161836_Pol_P-E Product feature CHAIN GQ161836_Pol_P-E of FT:mat_peptide GQ161836_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1051). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPIATKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLDDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363565_Pol_P-E Product feature CHAIN HM363565_Pol_P-E of FT:mat_peptide HM363565_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A186). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPIVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYPWEQELHHGAFLDGPSRMGEESIHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLRQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGPQSKGPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNSEESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYRNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363566_Pol_P-E Product feature CHAIN HM363566_Pol_P-E of FT:mat_peptide HM363566_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1082). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYPHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
DIHLHQDIIDKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETARSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIHSEHQKSRLGPQSQQRPLDRSQPGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIINHQYGTMPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSEQ
HLESLYTSVTNFLLSLGIHLNPDKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363567_Pol_P-E Product feature CHAIN HM363567_Pol_P-E of FT:mat_peptide HM363567_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C16). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPGF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLQFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKSTSFPWLLGCAANWLLPGTSLVYVQSALNPADDPSRGRLGINHPL
LRLPFRPTTRRTSLYAVSQSVPSHPPDREHFASPSHVAWRPP
>gnl|hbvpro|HM363568_Pol_P-E Product feature CHAIN HM363568_Pol_P-E of FT:mat_peptide HM363568_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C98). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLQFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSWGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363569_Pol_P-E Product feature CHAIN HM363569_Pol_P-E of FT:mat_peptide HM363569_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A51). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFRRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKNCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGHLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363570_Pol_P-E Product feature CHAIN HM363570_Pol_P-E of FT:mat_peptide HM363570_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A85). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKNCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGHLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363571_Pol_P-E Product feature CHAIN HM363571_Pol_P-E of FT:mat_peptide HM363571_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V16). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363572_Pol_P-E Product feature CHAIN HM363572_Pol_P-E of FT:mat_peptide HM363572_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V5). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTNYLPLDKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLVRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHVKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKMPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIKIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363573_Pol_P-E Product feature CHAIN HM363573_Pol_P-E of FT:mat_peptide HM363573_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V3). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQYSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVSRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363574_Pol_P-E Product feature CHAIN HM363574_Pol_P-E of FT:mat_peptide HM363574_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V70). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYPHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHTPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRSVF
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFRRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIQDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363575_Pol_P-E Product feature CHAIN HM363575_Pol_P-E of FT:mat_peptide HM363575_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V30). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQVPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVYSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNANKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363576_Pol_P-E Product feature CHAIN HM363576_Pol_P-E of FT:mat_peptide HM363576_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V43). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQVPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVYSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNANKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363578_Pol_P-E Product feature CHAIN HM363578_Pol_P-E of FT:mat_peptide HM363578_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL802). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPTVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERYSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNANKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPS
>gnl|hbvpro|HM363579_Pol_P-E Product feature CHAIN HM363579_Pol_P-E of FT:mat_peptide HM363579_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A32). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRARVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
PCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYASIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363580_Pol_P-E Product feature CHAIN HM363580_Pol_P-E of FT:mat_peptide HM363580_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A79). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRARVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
PCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363581_Pol_P-E Product feature CHAIN HM363581_Pol_P-E of FT:mat_peptide HM363581_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A84). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRARVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
PCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363582_Pol_P-E Product feature CHAIN HM363582_Pol_P-E of FT:mat_peptide HM363582_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL314). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLSNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSHKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPIYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLPIGHQRMPGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363583_Pol_P-E Product feature CHAIN HM363583_Pol_P-E of FT:mat_peptide HM363583_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V137). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAHNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPIYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363584_Pol_P-E Product feature CHAIN HM363584_Pol_P-E of FT:mat_peptide HM363584_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V129). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKPPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAHNIASRSASCLHQSAVRKAAYPNHSTFERHASSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGATSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPIYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSGASHLPDRVHFPSPLHVAWRPP
>gnl|hbvpro|HM363585_Pol_P-E Product feature CHAIN HM363585_Pol_P-E of FT:mat_peptide HM363585_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1455). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPIYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363586_Pol_P-E Product feature CHAIN HM363586_Pol_P-E of FT:mat_peptide HM363586_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A227). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHYQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDKSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHKIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLQFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPPTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363587_Pol_P-E Product feature CHAIN HM363587_Pol_P-E of FT:mat_peptide HM363587_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V195). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGTPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGQQSQQRPLDRSQQGRSG
SIRAGVHSPTWRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSDKTKRWGYSLQFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363588_Pol_P-E Product feature CHAIN HM363588_Pol_P-E of FT:mat_peptide HM363588_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A100). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHVRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPHLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363589_Pol_P-E Product feature CHAIN HM363589_Pol_P-E of FT:mat_peptide HM363589_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A178). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAMEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHVRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPHLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVASHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363590_Pol_P-E Product feature CHAIN HM363590_Pol_P-E of FT:mat_peptide HM363590_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V119). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363591_Pol_P-E Product feature CHAIN HM363591_Pol_P-E of FT:mat_peptide HM363591_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A114). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHKSSGIFSRSSVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNSAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363592_Pol_P-E Product feature CHAIN HM363592_Pol_P-E of FT:mat_peptide HM363592_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A153). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPIF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDT
CSRNLYVSLMLLFKTFGHKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLQFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALLPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HM363593_Pol_P-E Product feature CHAIN HM363593_Pol_P-E of FT:mat_peptide HM363593_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1577). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHASSGHAVEFQNIPPSSTGPQSKRPVS
SCWWLSFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGMYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|HM363594_Pol_P-E Product feature CHAIN HM363594_Pol_P-E of FT:mat_peptide HM363594_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V157). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIIKKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQDLHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGPSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGIHSPTRRPFGVEPSGSRHAKNIASRSPSCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNISPSSAGSQSKRPVF
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363595_Pol_P-E Product feature CHAIN HM363595_Pol_P-E of FT:mat_peptide HM363595_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1219). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDEVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGIHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHATFERHSSSGHAVEFHNISPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRTKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363596_Pol_P-E Product feature CHAIN HM363596_Pol_P-E of FT:mat_peptide HM363596_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V87). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFAVSRSGAKLIGTDNSVVLSRKYTSFPWLLGWAANWILGGTSFVYVPSALNRADDPSRGRLGVSRPL
LRLAFRPTTGRTSLYPGSPSGASHLADRVDFASPLDVTWRPR
>gnl|hbvpro|HM363597_Pol_P-E Product feature CHAIN HM363597_Pol_P-E of FT:mat_peptide HM363597_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A112). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHKSSGIFSRSSVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSEVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNSAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSTKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWVLGCAANWILGGTSFVYVPSALNPGDDPSRGRLGIYRPL
LRLPFRATTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPS
>gnl|hbvpro|HM363598_Pol_P-E Product feature CHAIN HM363598_Pol_P-E of FT:mat_peptide HM363598_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V15). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDCPSRMGEESFHHQSSGIFSRPSVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGMEPSGSRHAKNIASRSASCLHQSDVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSKNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILGGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVDFASPLHVAWRPS
>gnl|hbvpro|HM363599_Pol_P-E Product feature CHAIN HM363599_Pol_P-E of FT:mat_peptide HM363599_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V144). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKYQKSRLGPQSQQRPLDRSQQGRSG
SIRAGIHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTIERHSSSGHAVEFHNISPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGILPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSHKTKRWGYSLNFMGYVIGSWGSLPQEHIRTKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSVVNPGDDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|HM363600_Pol_P-E Product feature CHAIN HM363600_Pol_P-E of FT:mat_peptide HM363600_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C8). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRHVAEDLNLQLPDVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHPPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYTNHSTFERHSSSGHAVEFNNIPPNSAESQSNRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNMHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLHFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPIYACIHSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWVLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPSTGRTSLYPVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HM363601_Pol_P-E Product feature CHAIN HM363601_Pol_P-E of FT:mat_peptide HM363601_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL911). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYSNHSTFERHSSSGYAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHVRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPHLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLLIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363602_Pol_P-E Product feature CHAIN HM363602_Pol_P-E of FT:mat_peptide HM363602_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A231). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEDAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHYQSSGVFTRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPSGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLQFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPYHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363603_Pol_P-E Product feature CHAIN HM363603_Pol_P-E of FT:mat_peptide HM363603_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1274). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPTVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIAIRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSTRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGNHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGARSVH
HLESLYTAVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRVKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVT
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|HM363604_Pol_P-E Product feature CHAIN HM363604_Pol_P-E of FT:mat_peptide HM363604_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A28). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYPHFRRMLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHPSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKEAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRSVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVVQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKSTSFPWLLGCAANWLLPGTSLVYVQSALNPADDPSRGRLGINHPL
LRLPFRPTTRRTSLYAVSQSVPSHPPDREHFASPSHVAWRPP
>gnl|hbvpro|HM363605_Pol_P-E Product feature CHAIN HM363605_Pol_P-E of FT:mat_peptide HM363605_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C58). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQVPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQDLHHGAFLDGPSRMGEESFHHQSSGIFSRSPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHASSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPFVPYHPTDRVHFASPFHVAWKPP
>gnl|hbvpro|HM363606_Pol_P-E Product feature CHAIN HM363606_Pol_P-E of FT:mat_peptide HM363606_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V64). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHLQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPARRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWLLRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPYHPPVRVHFASPLHVAWRPQ
>gnl|hbvpro|HM363607_Pol_P-E Product feature CHAIN HM363607_Pol_P-E of FT:mat_peptide HM363607_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C78). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADADLNRRVAEDLNLHLPTVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVYSPTRRPFGVEPSGSRHVKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHTVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCITHIVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNANKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGNQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWVLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPSTGRTSLYPVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HM363608_Pol_P-E Product feature CHAIN HM363608_Pol_P-E of FT:mat_peptide HM363608_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A212). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPSGVEPSGSRHAKNIANRSASCLHQAAVRKAAYPNHSTFERHSSSGHAVEFQNISPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHYIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINKQNGTLPNLHDS
CSRNLYDSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRSKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363609_Pol_P-E Product feature CHAIN HM363609_Pol_P-E of FT:mat_peptide HM363609_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A58). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNLNLKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYSPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHLQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
NIRAGVHSPTRRPFGVEPSGSRNAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHIAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPHRVHFASPLHVAWRPP
>gnl|hbvpro|HM363610_Pol_P-E Product feature CHAIN HM363610_Pol_P-E of FT:mat_peptide HM363610_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C113). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLIMPARFYPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESVHHQSSGIFSRPPVGSSIQSKHPKSRLGSQSHQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHASSGHAVEFHNIPQSSAGSQSKRPVS
SCWWLQFRKSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGNQRMRGTFVA
PLPTQTAKLLAACLARSRSGAKFIGTQNSVVLSRKNTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM363611_Pol_P-E Product feature CHAIN HM363611_Pol_P-E of FT:mat_peptide HM363611_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A67). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLHLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWQTPSFP
DIHLHQDIVNKCEQFVGPLTVNEKRRLNLVMPARFFPNSTKYLPLDKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDSPSRMGEESVYHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPAGSRHAKNIASRSASCLHQSAVRKAAYPDHSTFERHASSGHAVEFQNIPPSSTGPQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGNFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPP
LRLPFQPTTGRTSLYAVSPSVASHLPVRGDFPSPLHVSWRPP
>gnl|hbvpro|HQ700550_Pol_P-E Product feature CHAIN HQ700550_Pol_P-E of FT:mat_peptide HQ700550_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_A032a). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADDDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNQKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKEGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHPKNIASRSASCLHQSAVRTAAYPNHSTFERHSSPGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHRRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPARVHFASPLHVAWRPP
>gnl|hbvpro|HQ700551_Pol_P-E Product feature CHAIN HQ700551_Pol_P-E of FT:mat_peptide HQ700551_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_F017A). Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPTFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSFQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSSSCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSSCWWL
QFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNSRVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDSCSRNL
YVSLMLLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
YTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLRLPF
QPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700552_Pol_P-E Product feature CHAIN HQ700552_Pol_P-E of FT:mat_peptide HQ700552_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_030). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADDDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHPKNIASRSASCLHQSAVRTAAYPNHSTFERHSSPGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPARVHFASPLHVAWRPP
>gnl|hbvpro|JQ000008_Pol_P-E Product feature CHAIN JQ000008_Pol_P-E of FT:mat_peptide JQ000008_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTSSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHDKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRSKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYTCIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGIQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ000009_Pol_P-E Product feature CHAIN JQ000009_Pol_P-E of FT:mat_peptide JQ000009_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWPHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHDKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGTKSVQ
HLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRSKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYTCIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF170741_Pol_P-E Product feature CHAIN KF170741_Pol_P-E of FT:mat_peptide KF170741_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_047). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNPNPPPWSIPSTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLQSLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF170742_Pol_P-E Product feature CHAIN KF170742_Pol_P-E of FT:mat_peptide KF170742_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_125). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLHNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPNSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLXAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|KF849713_Pol_P-E Product feature CHAIN KF849713_Pol_P-E of FT:mat_peptide KF849713_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA277). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF849714_Pol_P-E Product feature CHAIN KF849714_Pol_P-E of FT:mat_peptide KF849714_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA439). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|KF849715_Pol_P-E Product feature CHAIN KF849715_Pol_P-E of FT:mat_peptide KF849715_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA445). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGKKPYYPDNVXNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAXVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLLNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF849717_Pol_P-E Product feature CHAIN KF849717_Pol_P-E of FT:mat_peptide KF849717_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA504). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAENIASRSASCLHQSAVRKAAYPNHSTFERHSSSGNAVEFHNIPPNSAGSQSKRPVF
SCWWLQFRDSKPCSDYCLTHLVNLLEDWGPCTENGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|KF849718_Pol_P-E Product feature CHAIN KF849718_Pol_P-E of FT:mat_peptide KF849718_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA72). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRSVLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGXLYKR
ETTRSASFCGSPYSWEXELHHGAFLXGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRFVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVSRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF849719_Pol_P-E Product feature CHAIN KF849719_Pol_P-E of FT:mat_peptide KF849719_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA154). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF849721_Pol_P-E Product feature CHAIN KF849721_Pol_P-E of FT:mat_peptide KF849721_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA379). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHTTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|KF849722_Pol_P-E Product feature CHAIN KF849722_Pol_P-E of FT:mat_peptide KF849722_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA386). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF849723_Pol_P-E Product feature CHAIN KF849723_Pol_P-E of FT:mat_peptide KF849723_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA173). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAWGHSPTRRPFGVEPSGSRHTKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHYIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF849724_Pol_P-E Product feature CHAIN KF849724_Pol_P-E of FT:mat_peptide KF849724_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA274). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEGAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPSVGSSIQSKHQKSRLGSQSQQRPLDRSKQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKECFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLRNQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF849725_Pol_P-E Product feature CHAIN KF849725_Pol_P-E of FT:mat_peptide KF849725_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA399). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSSIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPCGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF849726_Pol_P-E Product feature CHAIN KF849726_Pol_P-E of FT:mat_peptide KF849726_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA417). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYHHFRSVLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCNQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|KF922438_Pol_P-E Product feature CHAIN KF922438_Pol_P-E of FT:mat_peptide KF922438_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PO04v1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF922439_Pol_P-E Product feature CHAIN KF922439_Pol_P-E of FT:mat_peptide KF922439_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PO04v2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPHVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KM606738_Pol_P-E Product feature CHAIN KM606738_Pol_P-E of FT:mat_peptide KM606738_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Cuba27a). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SFRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCFHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPEF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHYIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHINPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KM606739_Pol_P-E Product feature CHAIN KM606739_Pol_P-E of FT:mat_peptide KM606739_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Cuba32a). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPIEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNRLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPSTGRTSLYAVSPSVPTHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KT192626_Pol_P-E Product feature CHAIN KT192626_Pol_P-E of FT:mat_peptide KT192626_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPHVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KT749841_Pol_P-E Product feature CHAIN KT749841_Pol_P-E of FT:mat_peptide KT749841_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate FL11). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQQSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSAYCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSEYCLSHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736891_Pol_P-E Product feature CHAIN KU736891_Pol_P-E of FT:mat_peptide KU736891_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYWPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNISPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLSNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRXRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736892_Pol_P-E Product feature CHAIN KU736892_Pol_P-E of FT:mat_peptide KU736892_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYWPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNISPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLSNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|KU736893_Pol_P-E Product feature CHAIN KU736893_Pol_P-E of FT:mat_peptide KU736893_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Ethiopia_3). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADXDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIIDKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHADNIASKSASCFHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLSNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736894_Pol_P-E Product feature CHAIN KU736894_Pol_P-E of FT:mat_peptide KU736894_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYISLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVSRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736895_Pol_P-E Product feature CHAIN KU736895_Pol_P-E of FT:mat_peptide KU736895_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPHWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736896_Pol_P-E Product feature CHAIN KU736896_Pol_P-E of FT:mat_peptide KU736896_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_3). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPHWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSIQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736897_Pol_P-E Product feature CHAIN KU736897_Pol_P-E of FT:mat_peptide KU736897_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_4). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAENIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPNSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVFVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736898_Pol_P-E Product feature CHAIN KU736898_Pol_P-E of FT:mat_peptide KU736898_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_5). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAENIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPNSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVFVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736899_Pol_P-E Product feature CHAIN KU736899_Pol_P-E of FT:mat_peptide KU736899_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_6). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASKSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736900_Pol_P-E Product feature CHAIN KU736900_Pol_P-E of FT:mat_peptide KU736900_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Somalia_2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736901_Pol_P-E Product feature CHAIN KU736901_Pol_P-E of FT:mat_peptide KU736901_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDSPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VPWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDT
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRLRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736902_Pol_P-E Product feature CHAIN KU736902_Pol_P-E of FT:mat_peptide KU736902_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_12). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736903_Pol_P-E Product feature CHAIN KU736903_Pol_P-E of FT:mat_peptide KU736903_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_13). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNYSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRLVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736904_Pol_P-E Product feature CHAIN KU736904_Pol_P-E of FT:mat_peptide KU736904_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_16). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEELNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPSGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIXRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWXPP
>gnl|hbvpro|KU736905_Pol_P-E Product feature CHAIN KU736905_Pol_P-E of FT:mat_peptide KU736905_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_17). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736906_Pol_P-E Product feature CHAIN KU736906_Pol_P-E of FT:mat_peptide KU736906_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_2). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSXVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736907_Pol_P-E Product feature CHAIN KU736907_Pol_P-E of FT:mat_peptide KU736907_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_3). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736908_Pol_P-E Product feature CHAIN KU736908_Pol_P-E of FT:mat_peptide KU736908_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_5). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736909_Pol_P-E Product feature CHAIN KU736909_Pol_P-E of FT:mat_peptide KU736909_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_6). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736910_Pol_P-E Product feature CHAIN KU736910_Pol_P-E of FT:mat_peptide KU736910_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_8). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFVDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736911_Pol_P-E Product feature CHAIN KU736911_Pol_P-E of FT:mat_peptide KU736911_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_9). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFVDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVKKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736912_Pol_P-E Product feature CHAIN KU736912_Pol_P-E of FT:mat_peptide KU736912_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_4). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KU736913_Pol_P-E Product feature CHAIN KU736913_Pol_P-E of FT:mat_peptide KU736913_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_7). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPXVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGPFLDGPSRMGEESFHHQSSGIFSRPXVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSXTRRPFGVESSGSRHAKNIASRSASCLHQSAVRKAAYPNHATFERHSSSGHAVEFHNIPPSSAGSQSKRPVY
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSAQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KX186584_Pol_P-E Product feature CHAIN KX186584_Pol_P-E of FT:mat_peptide KX186584_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Eafr). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|LT623842_Pol_P-E Product feature CHAIN LT623842_Pol_P-E of FT:mat_peptide LT623842_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQXFRRXLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPXXKGIKPYYPDNVVNHYFQTRHYLHTLWZAGILYKR
ETTRSASFCGTPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSXVRXAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVXLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLEALYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFXPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|LT623843_Pol_P-E Product feature CHAIN LT623843_Pol_P-E of FT:mat_peptide LT623843_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHXDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKXGILYKR
ETTRSASFCGSPYXWEQELHHGAFLDGPSRMGEESFHXQSAGXFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHSPTRRPFGVEPSGSRHAKNIASXSASCLHQSAVRKAAYPNHSTFERHSSSGHAXEFHNIPPSSAGSQSKXPXS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDX
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGVXRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|LT623844_Pol_P-E Product feature CHAIN LT623844_Pol_P-E of FT:mat_peptide LT623844_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLBRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQALHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWXHSPTRRPFGVEPSGSRHATNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPQSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKXVQ
HLESLYTSVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLRXQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLLFQPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWXPP
>gnl|hbvpro|LT623845_Pol_P-E Product feature CHAIN LT623845_Pol_P-E of FT:mat_peptide LT623845_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVHEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHANNIASKSASCLHQSAVRKAAXPNHSTFERHSSSGHAXEFHNIPPSSAGSQSKRPVL
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSBLSWLSLDVSAAFYHLPLHPAXMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|LT623846_Pol_P-E Product feature CHAIN LT623846_Pol_P-E of FT:mat_peptide LT623846_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGHLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLVRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFVFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVFRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|LT623847_Pol_P-E Product feature CHAIN LT623847_Pol_P-E of FT:mat_peptide LT623847_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
EIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYRR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEKSFHHQSSGILSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHXSAVRKAAYPNHSTFERHSSSGHAXEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHXIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHXPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRLRGAFVT
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|LT623848_Pol_P-E Product feature CHAIN LT623848_Pol_P-E of FT:mat_peptide LT623848_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVADDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|LT623849_Pol_P-E Product feature CHAIN LT623849_Pol_P-E of FT:mat_peptide LT623849_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRXLLLDEEAGPLEEELPXLXDEDLNRRVXEDLNLXLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
XIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSG
CIRAGVHSPTRRPFGVEPSGSRHAKNXASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHITLKIKDCFRNLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|LT623850_Pol_P-E Product feature CHAIN LT623850_Pol_P-E of FT:mat_peptide LT623850_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPHWKPPSFP
DIHLHQDLINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQNKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLXKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRIRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFXYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|LT623851_Pol_P-E Product feature CHAIN LT623851_Pol_P-E of FT:mat_peptide LT623851_Pol_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDXEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGIYSSTIPTFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLXXPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWEAGILYKR
ETTRSASFXGSPYSWEQELHHGAFLDGPSRMGEESXHHQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAXNIASRSASCLHQSAVRKAAYPNHSTFERHSSSXHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHIVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIXGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGARSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLXKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPXTGRTSLYAVSPSVPSHLPDRVHFASPLYVAWRPP
>gnl|hbvpro|MF772354_Pol_P-E Product feature CHAIN MF772354_Pol_P-E of FT:mat_peptide MF772354_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1067). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIWAGVHTPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MF772355_Pol_P-E Product feature CHAIN MF772355_Pol_P-E of FT:mat_peptide MF772355_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 488). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSSIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYSWEHEIHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSQHQKSRLGPQSQQRSLDRSQQGRSG
SIWAGVHSTTRRPFGVEPSGSRHAKNLASRSASCLHQSAVRKAAHPNHATFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEXCSDYCLTHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLEALYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGFPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHLRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MF772356_Pol_P-E Product feature CHAIN MF772356_Pol_P-E of FT:mat_peptide MF772356_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1834). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLHLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHYQSFGSFSRPPVGSSIQSKHQQSRLGSQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHVKNIASRSAACLHQSAVRKAAYPNHSTFERHSSSGHEMECHNIPPSSAGSQSKSCWW
LQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWP
KFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSKYLARLSSNSRILNHQYGTLPNLHDSCSRN
LYVXLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFMAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLRLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MF772357_Pol_P-E Product feature CHAIN MF772357_Pol_P-E of FT:mat_peptide MF772357_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 222). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYPHFRKLLLLDEESGPLEEELPRLADEDLNRRVAEDLNLQLPDVSIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPSSTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGTFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLYQSAVKKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCIEHGKHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSAQ
HLESIYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYQDLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MF772358_Pol_P-E Product feature CHAIN MF772358_Pol_P-E of FT:mat_peptide MF772358_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSFGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWAHSPTRRSFGVEPSGSRHVKNIASRSASCLHQSAVRKAAYPNHATFERHPSSGHAVEFHNIPPSSAGSQSKSCWW
LQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIINHQYGTLPNLHDSCSRN
LYVSLMLLFKTFGRKLHLYSHPVIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGARSVQHLEA
LYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGAFVAPLPI
HTAELLAACFARSXSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLP
FQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MF772360_Pol_P-E Product feature CHAIN MF772360_Pol_P-E of FT:mat_peptide MF772360_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 666). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVS
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGISR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPSTGRTSLYAVSPSVPTHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MF772362_Pol_P-E Product feature CHAIN MF772362_Pol_P-E of FT:mat_peptide MF772362_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 960). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSFGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHVKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILDHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH464855_Pol_P-E Product feature CHAIN MH464855_Pol_P-E of FT:mat_peptide MH464855_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA133). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=845 residues).
MPLSYQHFRRILLLDEEXXAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPS
FPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEHELHHGAFLDGPSRMXGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQG
RSGSIWAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKR
PVFSCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGRHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRG
SSRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNL
HDSCSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVC
RPLLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH464856_Pol_P-E Product feature CHAIN MH464856_Pol_P-E of FT:mat_peptide MH464856_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA134). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRRILLLDEEXXAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPS
FPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEHELHHGAFVDGPSRMXGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQG
RSGSIWAGVHSPTRRPFGVEPSGSRHAKNLASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKR
PVFSCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
SSRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNM
HDSCSRNLFVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
SVQHLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVY
RPLLRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580617_Pol_P-E Product feature CHAIN MH580617_Pol_P-E of FT:mat_peptide MH580617_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 193). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNSASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|MH580621_Pol_P-E Product feature CHAIN MH580621_Pol_P-E of FT:mat_peptide MH580621_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 209). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSLQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNNSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRLVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRQGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580622_Pol_P-E Product feature CHAIN MH580622_Pol_P-E of FT:mat_peptide MH580622_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 210). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSLQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRLVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRQGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580624_Pol_P-E Product feature CHAIN MH580624_Pol_P-E of FT:mat_peptide MH580624_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 226). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTTPIFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPPRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580625_Pol_P-E Product feature CHAIN MH580625_Pol_P-E of FT:mat_peptide MH580625_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 239). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSLQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNNSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRLVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRQGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580626_Pol_P-E Product feature CHAIN MH580626_Pol_P-E of FT:mat_peptide MH580626_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 240). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEHSGSRHANNIASRSASCLHQSAVRKAAYPNHSTFERHPSSGHAVEFHNIPPSSAGSQSKSCWW
LQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGSSRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDSCSRN
LYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSFGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLP
FQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|MH580628_Pol_P-E Product feature CHAIN MH580628_Pol_P-E of FT:mat_peptide MH580628_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 304). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNSASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|MH580629_Pol_P-E Product feature CHAIN MH580629_Pol_P-E of FT:mat_peptide MH580629_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 306). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPPRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDFCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580630_Pol_P-E Product feature CHAIN MH580630_Pol_P-E of FT:mat_peptide MH580630_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 310). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPNSARSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYTCIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580631_Pol_P-E Product feature CHAIN MH580631_Pol_P-E of FT:mat_peptide MH580631_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 333). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEELFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|MH580632_Pol_P-E Product feature CHAIN MH580632_Pol_P-E of FT:mat_peptide MH580632_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 334). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEELFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|MH580634_Pol_P-E Product feature CHAIN MH580634_Pol_P-E of FT:mat_peptide MH580634_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 400). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYTCIQYKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580635_Pol_P-E Product feature CHAIN MH580635_Pol_P-E of FT:mat_peptide MH580635_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 401). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYTCIQYKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580636_Pol_P-E Product feature CHAIN MH580636_Pol_P-E of FT:mat_peptide MH580636_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 402). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYTCIQYKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRVRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580637_Pol_P-E Product feature CHAIN MH580637_Pol_P-E of FT:mat_peptide MH580637_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 408). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSLQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRLVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRQGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580638_Pol_P-E Product feature CHAIN MH580638_Pol_P-E of FT:mat_peptide MH580638_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 416). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIIHKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIPSKHPKSRLGPQSQQRPLDRSQQGRSG
SIRAGVYSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHNS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIQLNANKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYQYLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580640_Pol_P-E Product feature CHAIN MH580640_Pol_P-E of FT:mat_peptide MH580640_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 438). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFYHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHASSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580641_Pol_P-E Product feature CHAIN MH580641_Pol_P-E of FT:mat_peptide MH580641_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 439). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFYHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHASSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580644_Pol_P-E Product feature CHAIN MH580644_Pol_P-E of FT:mat_peptide MH580644_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 458). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNSASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|MH580645_Pol_P-E Product feature CHAIN MH580645_Pol_P-E of FT:mat_peptide MH580645_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 472). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDQEAGPLEEELPRLADEDLNRRVAEDLNLQLPDVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKPRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSPNSKIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVCRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|MH580646_Pol_P-E Product feature CHAIN MH580646_Pol_P-E of FT:mat_peptide MH580646_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 476). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPPRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580647_Pol_P-E Product feature CHAIN MH580647_Pol_P-E of FT:mat_peptide MH580647_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 490). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGTFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580648_Pol_P-E Product feature CHAIN MH580648_Pol_P-E of FT:mat_peptide MH580648_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 522). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEDLNRRVADDLNLHLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLKLVLPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGTFLDGSSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDTGQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSSSCLHQSAVRKAAYPNHSTFERHSSSGRAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYRNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580649_Pol_P-E Product feature CHAIN MH580649_Pol_P-E of FT:mat_peptide MH580649_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 523). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPPRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIKMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580650_Pol_P-E Product feature CHAIN MH580650_Pol_P-E of FT:mat_peptide MH580650_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 619). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAIRKAAYPNHSTFERHSSSGHAVEFPNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRLKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSTLNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|MH580652_Pol_P-E Product feature CHAIN MH580652_Pol_P-E of FT:mat_peptide MH580652_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 668). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELHHGAFLDGPSRMGEELFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAGVHSPTRRPFGVEPSGSRHAKNVASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNSNKTKRWGYSLHFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|MK321264_Pol_P-E Product feature CHAIN MK321264_Pol_P-E of FT:mat_peptide MK321264_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1332). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPFFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIRMKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPXARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALXPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|X75657_Pol_P-E Product feature CHAIN X75657_Pol_P-E of FT:mat_peptide X75657_Pol_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Bas). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
DIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAFLDGPSRMGEEYFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSG
SIRAWVHSPTRRPFGVEPSGSRHAKNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKRPVF
SCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSSR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNLHDS
CSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGIQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
© 1998-2019