HBVdb

Dataset for protein SHBs of genotype E

[Download (right click)] [Alignment] [Repertoires]

856 sequence(s)

>gnl|hbvpro|AB091255_SHBs_P-E Product feature CHAIN AB091255_SHBs_P-E of FT:mat_peptide AB091255_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-129). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091256_SHBs_P-E Product feature CHAIN AB091256_SHBs_P-E of FT:mat_peptide AB091256_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-212). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTITGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091257_SHBs_P-E Product feature CHAIN AB091257_SHBs_P-E of FT:mat_peptide AB091257_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-183). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091258_SHBs_P-E Product feature CHAIN AB091258_SHBs_P-E of FT:mat_peptide AB091258_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-239). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091259_SHBs_P-E Product feature CHAIN AB091259_SHBs_P-E of FT:mat_peptide AB091259_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-241). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091260_SHBs_P-E Product feature CHAIN AB091260_SHBs_P-E of FT:mat_peptide AB091260_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-259). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091261_SHBs_P-E Product feature CHAIN AB091261_SHBs_P-E of FT:mat_peptide AB091261_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-261). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091262_SHBs_P-E Product feature CHAIN AB091262_SHBs_P-E of FT:mat_peptide AB091262_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-302). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFVK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091263_SHBs_P-E Product feature CHAIN AB091263_SHBs_P-E of FT:mat_peptide AB091263_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-320). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091264_SHBs_P-E Product feature CHAIN AB091264_SHBs_P-E of FT:mat_peptide AB091264_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-331). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091265_SHBs_P-E Product feature CHAIN AB091265_SHBs_P-E of FT:mat_peptide AB091265_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-250). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB091266_SHBs_P-E Product feature CHAIN AB091266_SHBs_P-E of FT:mat_peptide AB091266_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-165). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLRPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLHTILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB106564_SHBs_C-E Product feature CHAIN AB106564_SHBs_C-E of FT:mat_peptide AB106564_SHBs_C-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA325). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPADGNCTCTPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194947_SHBs_P-E Product feature CHAIN AB194947_SHBs_P-E of FT:mat_peptide AB194947_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR954). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194948_SHBs_P-E Product feature CHAIN AB194948_SHBs_P-E of FT:mat_peptide AB194948_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR936). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPGLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194954_SHBs_P-E Product feature CHAIN AB194954_SHBs_P-E of FT:mat_peptide AB194954_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR943). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLSNILSPCIPLLPIFFCLWVYI
>gnl|hbvpro|AB194955_SHBs_P-E Product feature CHAIN AB194955_SHBs_P-E of FT:mat_peptide AB194955_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR927). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGXSMFPSCCCTKPLDGNCTCIPIPSSWAFGR
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB201287_SHBs_P-E Product feature CHAIN AB201287_SHBs_P-E of FT:mat_peptide AB201287_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin11). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB201288_SHBs_P-E Product feature CHAIN AB201288_SHBs_P-E of FT:mat_peptide AB201288_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin89). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB201289_SHBs_P-E Product feature CHAIN AB201289_SHBs_P-E of FT:mat_peptide AB201289_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin269). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB201290_SHBs_P-E Product feature CHAIN AB201290_SHBs_P-E of FT:mat_peptide AB201290_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin293). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205129_SHBs_P-E Product feature CHAIN AB205129_SHBs_P-E of FT:mat_peptide AB205129_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205188_SHBs_P-E Product feature CHAIN AB205188_SHBs_P-E of FT:mat_peptide AB205188_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA283). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205189_SHBs_P-E Product feature CHAIN AB205189_SHBs_P-E of FT:mat_peptide AB205189_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G138). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205190_SHBs_P-E Product feature CHAIN AB205190_SHBs_P-E of FT:mat_peptide AB205190_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G123). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGILPVCPLLPGSATTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFCCLWAYS
>gnl|hbvpro|AB205191_SHBs_P-E Product feature CHAIN AB205191_SHBs_P-E of FT:mat_peptide AB205191_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G166). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205192_SHBs_P-E Product feature CHAIN AB205192_SHBs_P-E of FT:mat_peptide AB205192_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205323_SHBs_P-E Product feature CHAIN AB205323_SHBs_P-E of FT:mat_peptide AB205323_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G46). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPRSSTTSTGPCRTCTIPVQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVLFVRWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|AB205324_SHBs_P-E Product feature CHAIN AB205324_SHBs_P-E of FT:mat_peptide AB205324_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G48). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWGSARFSWLSSLVPFVQWFAGLSPTVKLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205325_SHBs_P-E Product feature CHAIN AB205325_SHBs_P-E of FT:mat_peptide AB205325_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G50). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSWLIKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWALARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205326_SHBs_P-E Product feature CHAIN AB205326_SHBs_P-E of FT:mat_peptide AB205326_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G85). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205327_SHBs_P-E Product feature CHAIN AB205327_SHBs_P-E of FT:mat_peptide AB205327_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYLRMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDRNCTCIPIPSSWAFGN
FLWEWASVRFSWLSLLVPFVRWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205328_SHBs_P-E Product feature CHAIN AB205328_SHBs_P-E of FT:mat_peptide AB205328_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWLMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205329_SHBs_P-E Product feature CHAIN AB205329_SHBs_P-E of FT:mat_peptide AB205329_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G2001). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB219529_SHBs_P-E Product feature CHAIN AB219529_SHBs_P-E of FT:mat_peptide AB219529_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate UK1). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB219533_SHBs_P-E Product feature CHAIN AB219533_SHBs_P-E of FT:mat_peptide AB219533_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate UK5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILKPFIPLLLISFCLWVYI
>gnl|hbvpro|AB274969_SHBs_P-E Product feature CHAIN AB274969_SHBs_P-E of FT:mat_peptide AB274969_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274970_SHBs_P-E Product feature CHAIN AB274970_SHBs_P-E of FT:mat_peptide AB274970_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274971_SHBs_P-E Product feature CHAIN AB274971_SHBs_P-E of FT:mat_peptide AB274971_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274972_SHBs_P-E Product feature CHAIN AB274972_SHBs_P-E of FT:mat_peptide AB274972_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274973_SHBs_P-E Product feature CHAIN AB274973_SHBs_P-E of FT:mat_peptide AB274973_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSGGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLCNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274974_SHBs_P-E Product feature CHAIN AB274974_SHBs_P-E of FT:mat_peptide AB274974_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274975_SHBs_P-E Product feature CHAIN AB274975_SHBs_P-E of FT:mat_peptide AB274975_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274976_SHBs_P-E Product feature CHAIN AB274976_SHBs_P-E of FT:mat_peptide AB274976_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLNNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274977_SHBs_P-E Product feature CHAIN AB274977_SHBs_P-E of FT:mat_peptide AB274977_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274978_SHBs_P-E Product feature CHAIN AB274978_SHBs_P-E of FT:mat_peptide AB274978_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274979_SHBs_P-E Product feature CHAIN AB274979_SHBs_P-E of FT:mat_peptide AB274979_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274980_SHBs_P-E Product feature CHAIN AB274980_SHBs_P-E of FT:mat_peptide AB274980_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMFLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274981_SHBs_P-E Product feature CHAIN AB274981_SHBs_P-E of FT:mat_peptide AB274981_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274982_SHBs_P-E Product feature CHAIN AB274982_SHBs_P-E of FT:mat_peptide AB274982_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|AB274984_SHBs_P-E Product feature CHAIN AB274984_SHBs_P-E of FT:mat_peptide AB274984_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLRVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSNTSTGPCRTCTTLAQGTSMFPSCCCSKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB274985_SHBs_P-E Product feature CHAIN AB274985_SHBs_P-E of FT:mat_peptide AB274985_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB915175_SHBs_P-E Product feature CHAIN AB915175_SHBs_P-E of FT:mat_peptide AB915175_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB915176_SHBs_P-E Product feature CHAIN AB915176_SHBs_P-E of FT:mat_peptide AB915176_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB915177_SHBs_P-E Product feature CHAIN AB915177_SHBs_P-E of FT:mat_peptide AB915177_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB915178_SHBs_P-E Product feature CHAIN AB915178_SHBs_P-E of FT:mat_peptide AB915178_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA4). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMCPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB915180_SHBs_P-E Product feature CHAIN AB915180_SHBs_P-E of FT:mat_peptide AB915180_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA6). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRGLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF208871_SHBs_P-E Product feature CHAIN AF208871_SHBs_P-E of FT:mat_peptide AF208871_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate jt1836). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494689_SHBs_P-E Product feature CHAIN AM494689_SHBs_P-E of FT:mat_peptide AM494689_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR006). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494690_SHBs_P-E Product feature CHAIN AM494690_SHBs_P-E of FT:mat_peptide AM494690_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR008). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494691_SHBs_P-E Product feature CHAIN AM494691_SHBs_P-E of FT:mat_peptide AM494691_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR024). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494692_SHBs_P-E Product feature CHAIN AM494692_SHBs_P-E of FT:mat_peptide AM494692_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR026). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494693_SHBs_P-E Product feature CHAIN AM494693_SHBs_P-E of FT:mat_peptide AM494693_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR039). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494694_SHBs_P-E Product feature CHAIN AM494694_SHBs_P-E of FT:mat_peptide AM494694_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR047). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494695_SHBs_P-E Product feature CHAIN AM494695_SHBs_P-E of FT:mat_peptide AM494695_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR053). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494696_SHBs_P-E Product feature CHAIN AM494696_SHBs_P-E of FT:mat_peptide AM494696_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR060). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494697_SHBs_P-E Product feature CHAIN AM494697_SHBs_P-E of FT:mat_peptide AM494697_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR063). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPLICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494698_SHBs_P-E Product feature CHAIN AM494698_SHBs_P-E of FT:mat_peptide AM494698_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR066). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIAWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494699_SHBs_P-E Product feature CHAIN AM494699_SHBs_P-E of FT:mat_peptide AM494699_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR082). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494700_SHBs_P-E Product feature CHAIN AM494700_SHBs_P-E of FT:mat_peptide AM494700_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR083). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494701_SHBs_P-E Product feature CHAIN AM494701_SHBs_P-E of FT:mat_peptide AM494701_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR097). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494702_SHBs_P-E Product feature CHAIN AM494702_SHBs_P-E of FT:mat_peptide AM494702_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR106). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494703_SHBs_P-E Product feature CHAIN AM494703_SHBs_P-E of FT:mat_peptide AM494703_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR107). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494704_SHBs_P-E Product feature CHAIN AM494704_SHBs_P-E of FT:mat_peptide AM494704_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR112). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIAWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494705_SHBs_P-E Product feature CHAIN AM494705_SHBs_P-E of FT:mat_peptide AM494705_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR115). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494706_SHBs_P-E Product feature CHAIN AM494706_SHBs_P-E of FT:mat_peptide AM494706_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR131). Complete genome. [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494707_SHBs_P-E Product feature CHAIN AM494707_SHBs_P-E of FT:mat_peptide AM494707_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR137). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494708_SHBs_P-E Product feature CHAIN AM494708_SHBs_P-E of FT:mat_peptide AM494708_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494709_SHBs_P-E Product feature CHAIN AM494709_SHBs_P-E of FT:mat_peptide AM494709_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR143). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494710_SHBs_P-E Product feature CHAIN AM494710_SHBs_P-E of FT:mat_peptide AM494710_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR144). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494711_SHBs_P-E Product feature CHAIN AM494711_SHBs_P-E of FT:mat_peptide AM494711_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR146). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSSHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494712_SHBs_P-E Product feature CHAIN AM494712_SHBs_P-E of FT:mat_peptide AM494712_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR150). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSXFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSSHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFLCLWVYI
>gnl|hbvpro|AM494713_SHBs_P-E Product feature CHAIN AM494713_SHBs_P-E of FT:mat_peptide AM494713_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR154). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494714_SHBs_P-E Product feature CHAIN AM494714_SHBs_P-E of FT:mat_peptide AM494714_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR165). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFLCLWVYI
>gnl|hbvpro|AM494715_SHBs_P-E Product feature CHAIN AM494715_SHBs_P-E of FT:mat_peptide AM494715_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR171). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494717_SHBs_P-E Product feature CHAIN AM494717_SHBs_P-E of FT:mat_peptide AM494717_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR187). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494719_SHBs_P-E Product feature CHAIN AM494719_SHBs_P-E of FT:mat_peptide AM494719_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR001). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSXFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494720_SHBs_P-E Product feature CHAIN AM494720_SHBs_P-E of FT:mat_peptide AM494720_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR012). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYT
>gnl|hbvpro|AM494721_SHBs_P-E Product feature CHAIN AM494721_SHBs_P-E of FT:mat_peptide AM494721_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR016). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTVTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494722_SHBs_P-E Product feature CHAIN AM494722_SHBs_P-E of FT:mat_peptide AM494722_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR027). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCPIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494723_SHBs_P-E Product feature CHAIN AM494723_SHBs_P-E of FT:mat_peptide AM494723_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR032). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494724_SHBs_P-E Product feature CHAIN AM494724_SHBs_P-E of FT:mat_peptide AM494724_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR040). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSNTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCILIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|AM494725_SHBs_P-E Product feature CHAIN AM494725_SHBs_P-E of FT:mat_peptide AM494725_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR046). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494726_SHBs_P-E Product feature CHAIN AM494726_SHBs_P-E of FT:mat_peptide AM494726_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR049). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494727_SHBs_P-E Product feature CHAIN AM494727_SHBs_P-E of FT:mat_peptide AM494727_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR055). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYT
>gnl|hbvpro|AM494728_SHBs_P-E Product feature CHAIN AM494728_SHBs_P-E of FT:mat_peptide AM494728_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR065). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494729_SHBs_P-E Product feature CHAIN AM494729_SHBs_P-E of FT:mat_peptide AM494729_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR067). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494730_SHBs_P-E Product feature CHAIN AM494730_SHBs_P-E of FT:mat_peptide AM494730_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR069). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494731_SHBs_P-E Product feature CHAIN AM494731_SHBs_P-E of FT:mat_peptide AM494731_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR094). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494732_SHBs_P-E Product feature CHAIN AM494732_SHBs_P-E of FT:mat_peptide AM494732_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR113). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494733_SHBs_P-E Product feature CHAIN AM494733_SHBs_P-E of FT:mat_peptide AM494733_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSHTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494734_SHBs_P-E Product feature CHAIN AM494734_SHBs_P-E of FT:mat_peptide AM494734_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR123). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494735_SHBs_P-E Product feature CHAIN AM494735_SHBs_P-E of FT:mat_peptide AM494735_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR136). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNIWSPFILLLPIFFCLWAYI
>gnl|hbvpro|AM494736_SHBs_P-E Product feature CHAIN AM494736_SHBs_P-E of FT:mat_peptide AM494736_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR139). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494737_SHBs_P-E Product feature CHAIN AM494737_SHBs_P-E of FT:mat_peptide AM494737_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR141). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494738_SHBs_P-E Product feature CHAIN AM494738_SHBs_P-E of FT:mat_peptide AM494738_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR149). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMSPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494739_SHBs_P-E Product feature CHAIN AM494739_SHBs_P-E of FT:mat_peptide AM494739_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR187). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494740_SHBs_P-E Product feature CHAIN AM494740_SHBs_P-E of FT:mat_peptide AM494740_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR194). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494741_SHBs_P-E Product feature CHAIN AM494741_SHBs_P-E of FT:mat_peptide AM494741_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR198). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494743_SHBs_P-E Product feature CHAIN AM494743_SHBs_P-E of FT:mat_peptide AM494743_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR217). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFLCLWVYI
>gnl|hbvpro|AM494744_SHBs_P-E Product feature CHAIN AM494744_SHBs_P-E of FT:mat_peptide AM494744_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR233). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMLPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494745_SHBs_P-E Product feature CHAIN AM494745_SHBs_P-E of FT:mat_peptide AM494745_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR234). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTVTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494746_SHBs_P-E Product feature CHAIN AM494746_SHBs_P-E of FT:mat_peptide AM494746_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR177). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWTCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFLCLWVYI
>gnl|hbvpro|AM494747_SHBs_P-E Product feature CHAIN AM494747_SHBs_P-E of FT:mat_peptide AM494747_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR177). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGSCTCIPIPSSWAFGK
FLWERASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFLCLWVYV
>gnl|hbvpro|AM494748_SHBs_P-E Product feature CHAIN AM494748_SHBs_P-E of FT:mat_peptide AM494748_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR177). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFLCLWVYI
>gnl|hbvpro|AM494751_SHBs_P-E Product feature CHAIN AM494751_SHBs_P-E of FT:mat_peptide AM494751_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR194). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494752_SHBs_P-E Product feature CHAIN AM494752_SHBs_P-E of FT:mat_peptide AM494752_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR194). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494753_SHBs_P-E Product feature CHAIN AM494753_SHBs_P-E of FT:mat_peptide AM494753_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR194). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494832_SHBs_P-E Product feature CHAIN AM494832_SHBs_P-E of FT:mat_peptide AM494832_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR177-4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFLCLWVYI
>gnl|hbvpro|AY303878_SHBs_P-E Product feature CHAIN AY303878_SHBs_P-E of FT:mat_peptide AY303878_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate KM1149BTI). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLYQIFFCLWVYI
>gnl|hbvpro|AY303881_SHBs_P-E Product feature CHAIN AY303881_SHBs_P-E of FT:mat_peptide AY303881_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K1960). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTXPQSLDSWXTSLNFLGGAPVCLGQNXQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303882_SHBs_P-E Product feature CHAIN AY303882_SHBs_P-E of FT:mat_peptide AY303882_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K1962). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303883_SHBs_P-E Product feature CHAIN AY303883_SHBs_P-E of FT:mat_peptide AY303883_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K1965). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303884_SHBs_P-E Product feature CHAIN AY303884_SHBs_P-E of FT:mat_peptide AY303884_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K1967). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303885_SHBs_P-E Product feature CHAIN AY303885_SHBs_P-E of FT:mat_peptide AY303885_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K1969). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303886_SHBs_P-E Product feature CHAIN AY303886_SHBs_P-E of FT:mat_peptide AY303886_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K1971). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303887_SHBs_P-E Product feature CHAIN AY303887_SHBs_P-E of FT:mat_peptide AY303887_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K4501). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303888_SHBs_P-E Product feature CHAIN AY303888_SHBs_P-E of FT:mat_peptide AY303888_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K4502). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MESITSGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|AY303889_SHBs_P-E Product feature CHAIN AY303889_SHBs_P-E of FT:mat_peptide AY303889_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K4503). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCXRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNIWSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303890_SHBs_P-E Product feature CHAIN AY303890_SHBs_P-E of FT:mat_peptide AY303890_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K4601). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303891_SHBs_P-E Product feature CHAIN AY303891_SHBs_P-E of FT:mat_peptide AY303891_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K4607). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303892_SHBs_P-E Product feature CHAIN AY303892_SHBs_P-E of FT:mat_peptide AY303892_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K4619). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303893_SHBs_P-E Product feature CHAIN AY303893_SHBs_P-E of FT:mat_peptide AY303893_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K4633). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303894_SHBs_P-E Product feature CHAIN AY303894_SHBs_P-E of FT:mat_peptide AY303894_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HCC222). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303897_SHBs_P-E Product feature CHAIN AY303897_SHBs_P-E of FT:mat_peptide AY303897_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HCC276). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303898_SHBs_P-E Product feature CHAIN AY303898_SHBs_P-E of FT:mat_peptide AY303898_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HCC96). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303899_SHBs_P-E Product feature CHAIN AY303899_SHBs_P-E of FT:mat_peptide AY303899_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q174). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303901_SHBs_P-E Product feature CHAIN AY303901_SHBs_P-E of FT:mat_peptide AY303901_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q719). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTLAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWFDGLSPTVWLSVIWMMGYWGPSLYNILSPFIPLVPIFFWLWVYI
>gnl|hbvpro|AY303902_SHBs_P-E Product feature CHAIN AY303902_SHBs_P-E of FT:mat_peptide AY303902_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303903_SHBs_P-E Product feature CHAIN AY303903_SHBs_P-E of FT:mat_peptide AY303903_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q142). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|AY303904_SHBs_P-E Product feature CHAIN AY303904_SHBs_P-E of FT:mat_peptide AY303904_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q211). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303905_SHBs_P-E Product feature CHAIN AY303905_SHBs_P-E of FT:mat_peptide AY303905_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303906_SHBs_P-E Product feature CHAIN AY303906_SHBs_P-E of FT:mat_peptide AY303906_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303907_SHBs_P-E Product feature CHAIN AY303907_SHBs_P-E of FT:mat_peptide AY303907_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q641). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303908_SHBs_P-E Product feature CHAIN AY303908_SHBs_P-E of FT:mat_peptide AY303908_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q639). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303909_SHBs_P-E Product feature CHAIN AY303909_SHBs_P-E of FT:mat_peptide AY303909_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4102). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303910_SHBs_P-E Product feature CHAIN AY303910_SHBs_P-E of FT:mat_peptide AY303910_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4156). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTCSHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303911_SHBs_P-E Product feature CHAIN AY303911_SHBs_P-E of FT:mat_peptide AY303911_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4523). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303912_SHBs_P-E Product feature CHAIN AY303912_SHBs_P-E of FT:mat_peptide AY303912_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4530). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303913_SHBs_P-E Product feature CHAIN AY303913_SHBs_P-E of FT:mat_peptide AY303913_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4567). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLRPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPGLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303914_SHBs_P-E Product feature CHAIN AY303914_SHBs_P-E of FT:mat_peptide AY303914_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4572). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPXSLDSWXTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303915_SHBs_P-E Product feature CHAIN AY303915_SHBs_P-E of FT:mat_peptide AY303915_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4625). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303916_SHBs_P-E Product feature CHAIN AY303916_SHBs_P-E of FT:mat_peptide AY303916_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4640). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303917_SHBs_P-E Product feature CHAIN AY303917_SHBs_P-E of FT:mat_peptide AY303917_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4525). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303918_SHBs_P-E Product feature CHAIN AY303918_SHBs_P-E of FT:mat_peptide AY303918_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4531). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303919_SHBs_P-E Product feature CHAIN AY303919_SHBs_P-E of FT:mat_peptide AY303919_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4534). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303920_SHBs_P-E Product feature CHAIN AY303920_SHBs_P-E of FT:mat_peptide AY303920_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4535). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303921_SHBs_P-E Product feature CHAIN AY303921_SHBs_P-E of FT:mat_peptide AY303921_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1060). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303922_SHBs_P-E Product feature CHAIN AY303922_SHBs_P-E of FT:mat_peptide AY303922_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1477). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303923_SHBs_P-E Product feature CHAIN AY303923_SHBs_P-E of FT:mat_peptide AY303923_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1458). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303924_SHBs_P-E Product feature CHAIN AY303924_SHBs_P-E of FT:mat_peptide AY303924_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1428). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303925_SHBs_P-E Product feature CHAIN AY303925_SHBs_P-E of FT:mat_peptide AY303925_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1508). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303926_SHBs_P-E Product feature CHAIN AY303926_SHBs_P-E of FT:mat_peptide AY303926_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1643). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303927_SHBs_P-E Product feature CHAIN AY303927_SHBs_P-E of FT:mat_peptide AY303927_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1614). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303928_SHBs_P-E Product feature CHAIN AY303928_SHBs_P-E of FT:mat_peptide AY303928_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1647). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303929_SHBs_P-E Product feature CHAIN AY303929_SHBs_P-E of FT:mat_peptide AY303929_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1685). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303930_SHBs_P-E Product feature CHAIN AY303930_SHBs_P-E of FT:mat_peptide AY303930_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1698). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303931_SHBs_P-E Product feature CHAIN AY303931_SHBs_P-E of FT:mat_peptide AY303931_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1748). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
XIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|AY738144_SHBs_P-E Product feature CHAIN AY738144_SHBs_P-E of FT:mat_peptide AY738144_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=226 residues).
MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSRSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVRWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738145_SHBs_C-E Product feature CHAIN AY738145_SHBs_C-E of FT:mat_peptide AY738145_SHBs_C-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=226 residues).
MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVRWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738146_SHBs_P-E Product feature CHAIN AY738146_SHBs_P-E of FT:mat_peptide AY738146_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=226 residues).
MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738147_SHBs_P-E Product feature CHAIN AY738147_SHBs_P-E of FT:mat_peptide AY738147_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 10/98). Complete genome. [Hepadnaviridae] (length=226 residues).
MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
TIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738918_SHBs_P-E Product feature CHAIN AY738918_SHBs_P-E of FT:mat_peptide AY738918_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MKSITSGFLGPLLVLQAGFFLLQKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738919_SHBs_P-E Product feature CHAIN AY738919_SHBs_P-E of FT:mat_peptide AY738919_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWLCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTFWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738920_SHBs_P-E Product feature CHAIN AY738920_SHBs_P-E of FT:mat_peptide AY738920_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWDFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738921_SHBs_P-E Product feature CHAIN AY738921_SHBs_P-E of FT:mat_peptide AY738921_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLDPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738922_SHBs_P-E Product feature CHAIN AY738922_SHBs_P-E of FT:mat_peptide AY738922_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MGSITSGFLGPLRVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738923_SHBs_P-E Product feature CHAIN AY738923_SHBs_P-E of FT:mat_peptide AY738923_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFFLWAYI
>gnl|hbvpro|AY738924_SHBs_P-E Product feature CHAIN AY738924_SHBs_P-E of FT:mat_peptide AY738924_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|AY738925_SHBs_P-E Product feature CHAIN AY738925_SHBs_P-E of FT:mat_peptide AY738925_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY739674_SHBs_P-E Product feature CHAIN AY739674_SHBs_P-E of FT:mat_peptide AY739674_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY739675_SHBs_P-E Product feature CHAIN AY739675_SHBs_P-E of FT:mat_peptide AY739675_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY935700_SHBs_P-E Product feature CHAIN AY935700_SHBs_P-E of FT:mat_peptide AY935700_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate TH-HBV-012). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060822_SHBs_P-E Product feature CHAIN DQ060822_SHBs_P-E of FT:mat_peptide DQ060822_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8510-91). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060823_SHBs_P-E Product feature CHAIN DQ060823_SHBs_P-E of FT:mat_peptide DQ060823_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8504-91). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060824_SHBs_P-E Product feature CHAIN DQ060824_SHBs_P-E of FT:mat_peptide DQ060824_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0121-20). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060825_SHBs_P-E Product feature CHAIN DQ060825_SHBs_P-E of FT:mat_peptide DQ060825_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0262-09). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060826_SHBs_P-E Product feature CHAIN DQ060826_SHBs_P-E of FT:mat_peptide DQ060826_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0433-20). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060827_SHBs_P-E Product feature CHAIN DQ060827_SHBs_P-E of FT:mat_peptide DQ060827_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0317-04). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060828_SHBs_P-E Product feature CHAIN DQ060828_SHBs_P-E of FT:mat_peptide DQ060828_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0443-03). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060829_SHBs_P-E Product feature CHAIN DQ060829_SHBs_P-E of FT:mat_peptide DQ060829_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0350-03). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ060830_SHBs_P-E Product feature CHAIN DQ060830_SHBs_P-E of FT:mat_peptide DQ060830_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 235-01). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299402_SHBs_P-E Product feature CHAIN DQ299402_SHBs_P-E of FT:mat_peptide DQ299402_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate FS_2290). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTFCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299403_SHBs_P-E Product feature CHAIN DQ299403_SHBs_P-E of FT:mat_peptide DQ299403_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate FS_2290). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTFCPPICPGYRWMCLRRF
IIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299405_SHBs_P-E Product feature CHAIN DQ299405_SHBs_P-E of FT:mat_peptide DQ299405_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BTI_808). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299406_SHBs_P-E Product feature CHAIN DQ299406_SHBs_P-E of FT:mat_peptide DQ299406_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BTI_868). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299407_SHBs_P-E Product feature CHAIN DQ299407_SHBs_P-E of FT:mat_peptide DQ299407_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HCC_177). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299410_SHBs_P-E Product feature CHAIN DQ299410_SHBs_P-E of FT:mat_peptide DQ299410_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HCC_533). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIISGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299411_SHBs_P-E Product feature CHAIN DQ299411_SHBs_P-E of FT:mat_peptide DQ299411_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HCC_546). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299412_SHBs_P-E Product feature CHAIN DQ299412_SHBs_P-E of FT:mat_peptide DQ299412_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HCC_69). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299413_SHBs_P-E Product feature CHAIN DQ299413_SHBs_P-E of FT:mat_peptide DQ299413_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HCC_87). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299414_SHBs_P-E Product feature CHAIN DQ299414_SHBs_P-E of FT:mat_peptide DQ299414_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K1958). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299415_SHBs_P-E Product feature CHAIN DQ299415_SHBs_P-E of FT:mat_peptide DQ299415_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4537). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299416_SHBs_P-E Product feature CHAIN DQ299416_SHBs_P-E of FT:mat_peptide DQ299416_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4553). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299417_SHBs_P-E Product feature CHAIN DQ299417_SHBs_P-E of FT:mat_peptide DQ299417_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M4589). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299418_SHBs_P-E Product feature CHAIN DQ299418_SHBs_P-E of FT:mat_peptide DQ299418_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Q53). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|DQ299419_SHBs_P-E Product feature CHAIN DQ299419_SHBs_P-E of FT:mat_peptide DQ299419_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1718). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299420_SHBs_P-E Product feature CHAIN DQ299420_SHBs_P-E of FT:mat_peptide DQ299420_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1798). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412134_SHBs_P-E Product feature CHAIN DQ412134_SHBs_P-E of FT:mat_peptide DQ412134_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s02006859). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412135_SHBs_P-E Product feature CHAIN DQ412135_SHBs_P-E of FT:mat_peptide DQ412135_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S02009119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412136_SHBs_P-E Product feature CHAIN DQ412136_SHBs_P-E of FT:mat_peptide DQ412136_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s02011112). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTFSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNIWSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412137_SHBs_P-E Product feature CHAIN DQ412137_SHBs_P-E of FT:mat_peptide DQ412137_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S02019169). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412138_SHBs_P-E Product feature CHAIN DQ412138_SHBs_P-E of FT:mat_peptide DQ412138_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s02019170). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXXWXSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412139_SHBs_P-E Product feature CHAIN DQ412139_SHBs_P-E of FT:mat_peptide DQ412139_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S02019171). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MKSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412140_SHBs_P-E Product feature CHAIN DQ412140_SHBs_P-E of FT:mat_peptide DQ412140_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s02022145). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412141_SHBs_P-E Product feature CHAIN DQ412141_SHBs_P-E of FT:mat_peptide DQ412141_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s02022150). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412142_SHBs_P-E Product feature CHAIN DQ412142_SHBs_P-E of FT:mat_peptide DQ412142_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s02025809). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412143_SHBs_P-E Product feature CHAIN DQ412143_SHBs_P-E of FT:mat_peptide DQ412143_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s03001912). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEAITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFIXLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLXQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|DQ412144_SHBs_P-E Product feature CHAIN DQ412144_SHBs_P-E of FT:mat_peptide DQ412144_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s03003585). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCPGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWXSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412145_SHBs_P-E Product feature CHAIN DQ412145_SHBs_P-E of FT:mat_peptide DQ412145_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S03010012). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDRNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412146_SHBs_P-E Product feature CHAIN DQ412146_SHBs_P-E of FT:mat_peptide DQ412146_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s03010174). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|DQ412147_SHBs_P-E Product feature CHAIN DQ412147_SHBs_P-E of FT:mat_peptide DQ412147_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s03014731). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MEAITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWGTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412148_SHBs_P-E Product feature CHAIN DQ412148_SHBs_P-E of FT:mat_peptide DQ412148_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s03017507). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSFNFLGGAPVCRGQNSQSPISNHSPTSCPPTCPGYHWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412149_SHBs_P-E Product feature CHAIN DQ412149_SHBs_P-E of FT:mat_peptide DQ412149_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S03022819). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWAXARFSWLSLLVPFVQWFAGLSLTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412150_SHBs_P-E Product feature CHAIN DQ412150_SHBs_P-E of FT:mat_peptide DQ412150_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s03023232). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412151_SHBs_P-E Product feature CHAIN DQ412151_SHBs_P-E of FT:mat_peptide DQ412151_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s03024567). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILRPFIPLLPIFFCLWVYS
>gnl|hbvpro|DQ412152_SHBs_P-E Product feature CHAIN DQ412152_SHBs_P-E of FT:mat_peptide DQ412152_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04000578). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412153_SHBs_P-E Product feature CHAIN DQ412153_SHBs_P-E of FT:mat_peptide DQ412153_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04000910). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412155_SHBs_P-E Product feature CHAIN DQ412155_SHBs_P-E of FT:mat_peptide DQ412155_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04005169). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWXPXLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|DQ412157_SHBs_P-E Product feature CHAIN DQ412157_SHBs_P-E of FT:mat_peptide DQ412157_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04007144). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412158_SHBs_P-E Product feature CHAIN DQ412158_SHBs_P-E of FT:mat_peptide DQ412158_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04007149). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPGLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412159_SHBs_P-E Product feature CHAIN DQ412159_SHBs_P-E of FT:mat_peptide DQ412159_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04009364). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
METITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412160_SHBs_P-E Product feature CHAIN DQ412160_SHBs_P-E of FT:mat_peptide DQ412160_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04015283). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412162_SHBs_P-E Product feature CHAIN DQ412162_SHBs_P-E of FT:mat_peptide DQ412162_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04016388). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412163_SHBs_P-E Product feature CHAIN DQ412163_SHBs_P-E of FT:mat_peptide DQ412163_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04016392). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVXWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412164_SHBs_P-E Product feature CHAIN DQ412164_SHBs_P-E of FT:mat_peptide DQ412164_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04016393). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFFCLWAYI
>gnl|hbvpro|DQ412165_SHBs_P-E Product feature CHAIN DQ412165_SHBs_P-E of FT:mat_peptide DQ412165_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04016394). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVVQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGXSLFNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412166_SHBs_P-E Product feature CHAIN DQ412166_SHBs_P-E of FT:mat_peptide DQ412166_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04024339). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412167_SHBs_P-E Product feature CHAIN DQ412167_SHBs_P-E of FT:mat_peptide DQ412167_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04024457). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412168_SHBs_P-E Product feature CHAIN DQ412168_SHBs_P-E of FT:mat_peptide DQ412168_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s04025341). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412169_SHBs_P-E Product feature CHAIN DQ412169_SHBs_P-E of FT:mat_peptide DQ412169_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s05004338). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412170_SHBs_P-E Product feature CHAIN DQ412170_SHBs_P-E of FT:mat_peptide DQ412170_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s05006102). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412171_SHBs_P-E Product feature CHAIN DQ412171_SHBs_P-E of FT:mat_peptide DQ412171_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s05008972). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLSXIFFCLWVYI
>gnl|hbvpro|DQ412172_SHBs_P-E Product feature CHAIN DQ412172_SHBs_P-E of FT:mat_peptide DQ412172_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s05014482). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLXKILTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412173_SHBs_P-E Product feature CHAIN DQ412173_SHBs_P-E of FT:mat_peptide DQ412173_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s05017205). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412174_SHBs_P-E Product feature CHAIN DQ412174_SHBs_P-E of FT:mat_peptide DQ412174_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate s05025257). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547857_SHBs_P-E Product feature CHAIN EF547857_SHBs_P-E of FT:mat_peptide EF547857_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate FD123-0). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPTLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU159673_SHBs_P-E Product feature CHAIN EU159673_SHBs_P-E of FT:mat_peptide EU159673_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Irish-16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239217_SHBs_P-E Product feature CHAIN EU239217_SHBs_P-E of FT:mat_peptide EU239217_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate G2451). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239218_SHBs_P-E Product feature CHAIN EU239218_SHBs_P-E of FT:mat_peptide EU239218_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239219_SHBs_P-E Product feature CHAIN EU239219_SHBs_P-E of FT:mat_peptide EU239219_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239220_SHBs_P-E Product feature CHAIN EU239220_SHBs_P-E of FT:mat_peptide EU239220_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCTPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLLIFFWLWAYI
>gnl|hbvpro|EU239221_SHBs_P-E Product feature CHAIN EU239221_SHBs_P-E of FT:mat_peptide EU239221_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW1). Complete genome. [Hepadnaviridae] (length=226 residues).
MAGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPSVRWFAGLSPTVWLSVIWMMWYWGPSLYHILSPFIPLLPIFLCLWAYI
>gnl|hbvpro|EU239222_SHBs_P-E Product feature CHAIN EU239222_SHBs_P-E of FT:mat_peptide EU239222_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVYLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239223_SHBs_P-E Product feature CHAIN EU239223_SHBs_P-E of FT:mat_peptide EU239223_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW4). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239224_SHBs_P-E Product feature CHAIN EU239224_SHBs_P-E of FT:mat_peptide EU239224_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARSSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU239226_SHBs_P-E Product feature CHAIN EU239226_SHBs_P-E of FT:mat_peptide EU239226_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349226_SHBs_P-E Product feature CHAIN FJ349226_SHBs_P-E of FT:mat_peptide FJ349226_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate H6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349237_SHBs_P-E Product feature CHAIN FJ349237_SHBs_P-E of FT:mat_peptide FJ349237_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C27). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349238_SHBs_P-E Product feature CHAIN FJ349238_SHBs_P-E of FT:mat_peptide FJ349238_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C65). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349239_SHBs_P-E Product feature CHAIN FJ349239_SHBs_P-E of FT:mat_peptide FJ349239_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C74). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349240_SHBs_P-E Product feature CHAIN FJ349240_SHBs_P-E of FT:mat_peptide FJ349240_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C89). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692540_SHBs_P-E Product feature CHAIN FJ692540_SHBs_P-E of FT:mat_peptide FJ692540_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_48051). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILXIPQXLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPXCPGYRXMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLSNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692542_SHBs_P-E Product feature CHAIN FJ692542_SHBs_P-E of FT:mat_peptide FJ692542_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_48107). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYXILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FJ692543_SHBs_P-E Product feature CHAIN FJ692543_SHBs_P-E of FT:mat_peptide FJ692543_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_48122). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLNYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPXSWAFGK
FLWEWVSARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692544_SHBs_P-E Product feature CHAIN FJ692544_SHBs_P-E of FT:mat_peptide FJ692544_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_48139). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692545_SHBs_P-E Product feature CHAIN FJ692545_SHBs_P-E of FT:mat_peptide FJ692545_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_50040). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692546_SHBs_P-E Product feature CHAIN FJ692546_SHBs_P-E of FT:mat_peptide FJ692546_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_50046). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692547_SHBs_P-E Product feature CHAIN FJ692547_SHBs_P-E of FT:mat_peptide FJ692547_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_50063). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692548_SHBs_P-E Product feature CHAIN FJ692548_SHBs_P-E of FT:mat_peptide FJ692548_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_50065). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692550_SHBs_P-E Product feature CHAIN FJ692550_SHBs_P-E of FT:mat_peptide FJ692550_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_50080). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692551_SHBs_P-E Product feature CHAIN FJ692551_SHBs_P-E of FT:mat_peptide FJ692551_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_50114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692552_SHBs_P-E Product feature CHAIN FJ692552_SHBs_P-E of FT:mat_peptide FJ692552_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_50047). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILKPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692553_SHBs_P-E Product feature CHAIN FJ692553_SHBs_P-E of FT:mat_peptide FJ692553_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_50048). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295507_SHBs_P-E Product feature CHAIN FN295507_SHBs_P-E of FT:mat_peptide FN295507_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295509_SHBs_P-E Product feature CHAIN FN295509_SHBs_P-E of FT:mat_peptide FN295509_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMIPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295510_SHBs_P-E Product feature CHAIN FN295510_SHBs_P-E of FT:mat_peptide FN295510_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMLPSCCCSKPSXGNCTCIPIPSSWAFGK
FLWEWASARFSWFSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295520_SHBs_P-E Product feature CHAIN FN295520_SHBs_P-E of FT:mat_peptide FN295520_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate M28). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGQGLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FN295550_SHBs_P-E Product feature CHAIN FN295550_SHBs_P-E of FT:mat_peptide FN295550_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E2_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295551_SHBs_P-E Product feature CHAIN FN295551_SHBs_P-E of FT:mat_peptide FN295551_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C4_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295552_SHBs_P-E Product feature CHAIN FN295552_SHBs_P-E of FT:mat_peptide FN295552_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E5_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295553_SHBs_P-E Product feature CHAIN FN295553_SHBs_P-E of FT:mat_peptide FN295553_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E6_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295554_SHBs_P-E Product feature CHAIN FN295554_SHBs_P-E of FT:mat_peptide FN295554_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate AR2C_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295555_SHBs_P-E Product feature CHAIN FN295555_SHBs_P-E of FT:mat_peptide FN295555_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate AR7C_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545821_SHBs_P-E Product feature CHAIN FN545821_SHBs_P-E of FT:mat_peptide FN545821_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSXFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLLIFFCLWVYI
>gnl|hbvpro|FN545822_SHBs_P-E Product feature CHAIN FN545822_SHBs_P-E of FT:mat_peptide FN545822_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545823_SHBs_P-E Product feature CHAIN FN545823_SHBs_P-E of FT:mat_peptide FN545823_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545827_SHBs_P-E Product feature CHAIN FN545827_SHBs_P-E of FT:mat_peptide FN545827_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSXHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGXXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545841_SHBs_P-E Product feature CHAIN FN545841_SHBs_P-E of FT:mat_peptide FN545841_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545842_SHBs_P-E Product feature CHAIN FN545842_SHBs_P-E of FT:mat_peptide FN545842_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547154_SHBs_P-E Product feature CHAIN FN547154_SHBs_P-E of FT:mat_peptide FN547154_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547155_SHBs_P-E Product feature CHAIN FN547155_SHBs_P-E of FT:mat_peptide FN547155_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVXLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAXGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547156_SHBs_P-E Product feature CHAIN FN547156_SHBs_P-E of FT:mat_peptide FN547156_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547158_SHBs_P-E Product feature CHAIN FN547158_SHBs_P-E of FT:mat_peptide FN547158_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547159_SHBs_P-E Product feature CHAIN FN547159_SHBs_P-E of FT:mat_peptide FN547159_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547160_SHBs_P-E Product feature CHAIN FN547160_SHBs_P-E of FT:mat_peptide FN547160_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547161_SHBs_P-E Product feature CHAIN FN547161_SHBs_P-E of FT:mat_peptide FN547161_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547162_SHBs_P-E Product feature CHAIN FN547162_SHBs_P-E of FT:mat_peptide FN547162_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547163_SHBs_P-E Product feature CHAIN FN547163_SHBs_P-E of FT:mat_peptide FN547163_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547164_SHBs_P-E Product feature CHAIN FN547164_SHBs_P-E of FT:mat_peptide FN547164_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547165_SHBs_P-E Product feature CHAIN FN547165_SHBs_P-E of FT:mat_peptide FN547165_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGRNSQSPISNHSPTSCPPICPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547167_SHBs_P-E Product feature CHAIN FN547167_SHBs_P-E of FT:mat_peptide FN547167_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|FN547168_SHBs_P-E Product feature CHAIN FN547168_SHBs_P-E of FT:mat_peptide FN547168_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGEAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547170_SHBs_P-E Product feature CHAIN FN547170_SHBs_P-E of FT:mat_peptide FN547170_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547171_SHBs_P-E Product feature CHAIN FN547171_SHBs_P-E of FT:mat_peptide FN547171_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547172_SHBs_P-E Product feature CHAIN FN547172_SHBs_P-E of FT:mat_peptide FN547172_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547173_SHBs_P-E Product feature CHAIN FN547173_SHBs_P-E of FT:mat_peptide FN547173_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547174_SHBs_P-E Product feature CHAIN FN547174_SHBs_P-E of FT:mat_peptide FN547174_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547175_SHBs_P-E Product feature CHAIN FN547175_SHBs_P-E of FT:mat_peptide FN547175_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMLPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNIWSPFIPLLPIFFXLWVYI
>gnl|hbvpro|FN547176_SHBs_P-E Product feature CHAIN FN547176_SHBs_P-E of FT:mat_peptide FN547176_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547177_SHBs_P-E Product feature CHAIN FN547177_SHBs_P-E of FT:mat_peptide FN547177_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547178_SHBs_P-E Product feature CHAIN FN547178_SHBs_P-E of FT:mat_peptide FN547178_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICTGYRWMCLRRF
ITFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547179_SHBs_P-E Product feature CHAIN FN547179_SHBs_P-E of FT:mat_peptide FN547179_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSXGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWXWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547180_SHBs_P-E Product feature CHAIN FN547180_SHBs_P-E of FT:mat_peptide FN547180_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547181_SHBs_P-E Product feature CHAIN FN547181_SHBs_P-E of FT:mat_peptide FN547181_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547182_SHBs_P-E Product feature CHAIN FN547182_SHBs_P-E of FT:mat_peptide FN547182_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFIQLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547183_SHBs_P-E Product feature CHAIN FN547183_SHBs_P-E of FT:mat_peptide FN547183_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547184_SHBs_P-E Product feature CHAIN FN547184_SHBs_P-E of FT:mat_peptide FN547184_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLXNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547185_SHBs_P-E Product feature CHAIN FN547185_SHBs_P-E of FT:mat_peptide FN547185_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547186_SHBs_P-E Product feature CHAIN FN547186_SHBs_P-E of FT:mat_peptide FN547186_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAXGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547187_SHBs_P-E Product feature CHAIN FN547187_SHBs_P-E of FT:mat_peptide FN547187_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547188_SHBs_P-E Product feature CHAIN FN547188_SHBs_P-E of FT:mat_peptide FN547188_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXLXNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547189_SHBs_P-E Product feature CHAIN FN547189_SHBs_P-E of FT:mat_peptide FN547189_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547190_SHBs_P-E Product feature CHAIN FN547190_SHBs_P-E of FT:mat_peptide FN547190_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLLILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547191_SHBs_P-E Product feature CHAIN FN547191_SHBs_P-E of FT:mat_peptide FN547191_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSXGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547192_SHBs_P-E Product feature CHAIN FN547192_SHBs_P-E of FT:mat_peptide FN547192_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547193_SHBs_P-E Product feature CHAIN FN547193_SHBs_P-E of FT:mat_peptide FN547193_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547194_SHBs_P-E Product feature CHAIN FN547194_SHBs_P-E of FT:mat_peptide FN547194_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547195_SHBs_P-E Product feature CHAIN FN547195_SHBs_P-E of FT:mat_peptide FN547195_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547196_SHBs_P-E Product feature CHAIN FN547196_SHBs_P-E of FT:mat_peptide FN547196_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547197_SHBs_P-E Product feature CHAIN FN547197_SHBs_P-E of FT:mat_peptide FN547197_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547198_SHBs_P-E Product feature CHAIN FN547198_SHBs_P-E of FT:mat_peptide FN547198_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPKNLDSWWTSLNFLGEAPVCRGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547199_SHBs_P-E Product feature CHAIN FN547199_SHBs_P-E of FT:mat_peptide FN547199_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547200_SHBs_P-E Product feature CHAIN FN547200_SHBs_P-E of FT:mat_peptide FN547200_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVSI
>gnl|hbvpro|FN547201_SHBs_P-E Product feature CHAIN FN547201_SHBs_P-E of FT:mat_peptide FN547201_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIXLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQNTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547202_SHBs_P-E Product feature CHAIN FN547202_SHBs_P-E of FT:mat_peptide FN547202_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547203_SHBs_P-E Product feature CHAIN FN547203_SHBs_P-E of FT:mat_peptide FN547203_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547204_SHBs_P-E Product feature CHAIN FN547204_SHBs_P-E of FT:mat_peptide FN547204_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547205_SHBs_P-E Product feature CHAIN FN547205_SHBs_P-E of FT:mat_peptide FN547205_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547206_SHBs_P-E Product feature CHAIN FN547206_SHBs_P-E of FT:mat_peptide FN547206_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFTLLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGN
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547207_SHBs_P-E Product feature CHAIN FN547207_SHBs_P-E of FT:mat_peptide FN547207_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547209_SHBs_P-E Product feature CHAIN FN547209_SHBs_P-E of FT:mat_peptide FN547209_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547210_SHBs_P-E Product feature CHAIN FN547210_SHBs_P-E of FT:mat_peptide FN547210_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547211_SHBs_P-E Product feature CHAIN FN547211_SHBs_P-E of FT:mat_peptide FN547211_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPVCLGQNSQXPTSSHSPTSCPPICPGYRXMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQXFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547212_SHBs_P-E Product feature CHAIN FN547212_SHBs_P-E of FT:mat_peptide FN547212_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLXQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547213_SHBs_P-E Product feature CHAIN FN547213_SHBs_P-E of FT:mat_peptide FN547213_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547214_SHBs_P-E Product feature CHAIN FN547214_SHBs_P-E of FT:mat_peptide FN547214_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547215_SHBs_P-E Product feature CHAIN FN547215_SHBs_P-E of FT:mat_peptide FN547215_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547217_SHBs_P-E Product feature CHAIN FN547217_SHBs_P-E of FT:mat_peptide FN547217_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547218_SHBs_P-E Product feature CHAIN FN547218_SHBs_P-E of FT:mat_peptide FN547218_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547219_SHBs_P-E Product feature CHAIN FN547219_SHBs_P-E of FT:mat_peptide FN547219_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLFNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FN547220_SHBs_P-E Product feature CHAIN FN547220_SHBs_P-E of FT:mat_peptide FN547220_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSXFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLLIFFCLWVYI
>gnl|hbvpro|FN547221_SHBs_P-E Product feature CHAIN FN547221_SHBs_P-E of FT:mat_peptide FN547221_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547222_SHBs_P-E Product feature CHAIN FN547222_SHBs_P-E of FT:mat_peptide FN547222_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXLYNILRPFIPLXPIFFCLWVYI
>gnl|hbvpro|FN547223_SHBs_P-E Product feature CHAIN FN547223_SHBs_P-E of FT:mat_peptide FN547223_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGVPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547224_SHBs_P-E Product feature CHAIN FN547224_SHBs_P-E of FT:mat_peptide FN547224_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGVPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547225_SHBs_P-E Product feature CHAIN FN547225_SHBs_P-E of FT:mat_peptide FN547225_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547226_SHBs_P-E Product feature CHAIN FN547226_SHBs_P-E of FT:mat_peptide FN547226_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547227_SHBs_P-E Product feature CHAIN FN547227_SHBs_P-E of FT:mat_peptide FN547227_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547229_SHBs_P-E Product feature CHAIN FN547229_SHBs_P-E of FT:mat_peptide FN547229_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547230_SHBs_P-E Product feature CHAIN FN547230_SHBs_P-E of FT:mat_peptide FN547230_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547231_SHBs_P-E Product feature CHAIN FN547231_SHBs_P-E of FT:mat_peptide FN547231_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547233_SHBs_P-E Product feature CHAIN FN547233_SHBs_P-E of FT:mat_peptide FN547233_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLXIFXCLWVYI
>gnl|hbvpro|FN547234_SHBs_P-E Product feature CHAIN FN547234_SHBs_P-E of FT:mat_peptide FN547234_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547236_SHBs_P-E Product feature CHAIN FN547236_SHBs_P-E of FT:mat_peptide FN547236_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547237_SHBs_P-E Product feature CHAIN FN547237_SHBs_P-E of FT:mat_peptide FN547237_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547239_SHBs_P-E Product feature CHAIN FN547239_SHBs_P-E of FT:mat_peptide FN547239_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|FN547240_SHBs_P-E Product feature CHAIN FN547240_SHBs_P-E of FT:mat_peptide FN547240_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547246_SHBs_P-E Product feature CHAIN FN547246_SHBs_P-E of FT:mat_peptide FN547246_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFVK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547248_SHBs_P-E Product feature CHAIN FN547248_SHBs_P-E of FT:mat_peptide FN547248_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGAPVCLGQNSQSPTSNHSPTSCPXTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547251_SHBs_P-E Product feature CHAIN FN547251_SHBs_P-E of FT:mat_peptide FN547251_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547252_SHBs_P-E Product feature CHAIN FN547252_SHBs_P-E of FT:mat_peptide FN547252_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547253_SHBs_P-E Product feature CHAIN FN547253_SHBs_P-E of FT:mat_peptide FN547253_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547254_SHBs_P-E Product feature CHAIN FN547254_SHBs_P-E of FT:mat_peptide FN547254_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCPGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFWLALLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547255_SHBs_P-E Product feature CHAIN FN547255_SHBs_P-E of FT:mat_peptide FN547255_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FN547256_SHBs_P-E Product feature CHAIN FN547256_SHBs_P-E of FT:mat_peptide FN547256_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547257_SHBs_P-E Product feature CHAIN FN547257_SHBs_P-E of FT:mat_peptide FN547257_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547258_SHBs_P-E Product feature CHAIN FN547258_SHBs_P-E of FT:mat_peptide FN547258_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547259_SHBs_P-E Product feature CHAIN FN547259_SHBs_P-E of FT:mat_peptide FN547259_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547260_SHBs_P-E Product feature CHAIN FN547260_SHBs_P-E of FT:mat_peptide FN547260_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMFPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547261_SHBs_P-E Product feature CHAIN FN547261_SHBs_P-E of FT:mat_peptide FN547261_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547262_SHBs_P-E Product feature CHAIN FN547262_SHBs_P-E of FT:mat_peptide FN547262_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPRLYHILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547263_SHBs_P-E Product feature CHAIN FN547263_SHBs_P-E of FT:mat_peptide FN547263_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547264_SHBs_P-E Product feature CHAIN FN547264_SHBs_P-E of FT:mat_peptide FN547264_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547265_SHBs_P-E Product feature CHAIN FN547265_SHBs_P-E of FT:mat_peptide FN547265_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547266_SHBs_P-E Product feature CHAIN FN547266_SHBs_P-E of FT:mat_peptide FN547266_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547267_SHBs_P-E Product feature CHAIN FN547267_SHBs_P-E of FT:mat_peptide FN547267_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547268_SHBs_P-E Product feature CHAIN FN547268_SHBs_P-E of FT:mat_peptide FN547268_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLXNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547269_SHBs_P-E Product feature CHAIN FN547269_SHBs_P-E of FT:mat_peptide FN547269_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547270_SHBs_P-E Product feature CHAIN FN547270_SHBs_P-E of FT:mat_peptide FN547270_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547271_SHBs_P-E Product feature CHAIN FN547271_SHBs_P-E of FT:mat_peptide FN547271_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547272_SHBs_P-E Product feature CHAIN FN547272_SHBs_P-E of FT:mat_peptide FN547272_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547274_SHBs_P-E Product feature CHAIN FN547274_SHBs_P-E of FT:mat_peptide FN547274_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSXTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547275_SHBs_P-E Product feature CHAIN FN547275_SHBs_P-E of FT:mat_peptide FN547275_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547276_SHBs_P-E Product feature CHAIN FN547276_SHBs_P-E of FT:mat_peptide FN547276_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGFRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547277_SHBs_P-E Product feature CHAIN FN547277_SHBs_P-E of FT:mat_peptide FN547277_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCXGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547278_SHBs_P-E Product feature CHAIN FN547278_SHBs_P-E of FT:mat_peptide FN547278_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLXCLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547279_SHBs_P-E Product feature CHAIN FN547279_SHBs_P-E of FT:mat_peptide FN547279_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547281_SHBs_P-E Product feature CHAIN FN547281_SHBs_P-E of FT:mat_peptide FN547281_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMFPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
XLWEWASARFSWLXLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547282_SHBs_P-E Product feature CHAIN FN547282_SHBs_P-E of FT:mat_peptide FN547282_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547283_SHBs_P-E Product feature CHAIN FN547283_SHBs_P-E of FT:mat_peptide FN547283_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547284_SHBs_P-E Product feature CHAIN FN547284_SHBs_P-E of FT:mat_peptide FN547284_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547285_SHBs_P-E Product feature CHAIN FN547285_SHBs_P-E of FT:mat_peptide FN547285_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547286_SHBs_P-E Product feature CHAIN FN547286_SHBs_P-E of FT:mat_peptide FN547286_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547287_SHBs_P-E Product feature CHAIN FN547287_SHBs_P-E of FT:mat_peptide FN547287_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547288_SHBs_P-E Product feature CHAIN FN547288_SHBs_P-E of FT:mat_peptide FN547288_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547289_SHBs_P-E Product feature CHAIN FN547289_SHBs_P-E of FT:mat_peptide FN547289_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSSLAPFVQWFAGHSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547290_SHBs_P-E Product feature CHAIN FN547290_SHBs_P-E of FT:mat_peptide FN547290_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547293_SHBs_P-E Product feature CHAIN FN547293_SHBs_P-E of FT:mat_peptide FN547293_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547295_SHBs_P-E Product feature CHAIN FN547295_SHBs_P-E of FT:mat_peptide FN547295_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMXPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPKLFNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547297_SHBs_P-E Product feature CHAIN FN547297_SHBs_P-E of FT:mat_peptide FN547297_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547299_SHBs_P-E Product feature CHAIN FN547299_SHBs_P-E of FT:mat_peptide FN547299_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILKPFIPLLLIFFCLWVYI
>gnl|hbvpro|FN547300_SHBs_P-E Product feature CHAIN FN547300_SHBs_P-E of FT:mat_peptide FN547300_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESSTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGSPVCLGQNSQSPTSNHSPTSCPPICPGFRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSEGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFCCLWVYS
>gnl|hbvpro|FN547303_SHBs_P-E Product feature CHAIN FN547303_SHBs_P-E of FT:mat_peptide FN547303_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNIWSPFFPLLPIFFCLWVYI
>gnl|hbvpro|FN547304_SHBs_P-E Product feature CHAIN FN547304_SHBs_P-E of FT:mat_peptide FN547304_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547310_SHBs_P-E Product feature CHAIN FN547310_SHBs_P-E of FT:mat_peptide FN547310_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547311_SHBs_P-E Product feature CHAIN FN547311_SHBs_P-E of FT:mat_peptide FN547311_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILXPFIXLXPIFFCLWVYI
>gnl|hbvpro|FN547318_SHBs_P-E Product feature CHAIN FN547318_SHBs_P-E of FT:mat_peptide FN547318_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSMGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547319_SHBs_P-E Product feature CHAIN FN547319_SHBs_P-E of FT:mat_peptide FN547319_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSSHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547333_SHBs_P-E Product feature CHAIN FN547333_SHBs_P-E of FT:mat_peptide FN547333_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547339_SHBs_P-E Product feature CHAIN FN547339_SHBs_P-E of FT:mat_peptide FN547339_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547347_SHBs_P-E Product feature CHAIN FN547347_SHBs_P-E of FT:mat_peptide FN547347_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547356_SHBs_P-E Product feature CHAIN FN547356_SHBs_P-E of FT:mat_peptide FN547356_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547358_SHBs_P-E Product feature CHAIN FN547358_SHBs_P-E of FT:mat_peptide FN547358_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547359_SHBs_P-E Product feature CHAIN FN547359_SHBs_P-E of FT:mat_peptide FN547359_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNXQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547362_SHBs_P-E Product feature CHAIN FN547362_SHBs_P-E of FT:mat_peptide FN547362_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLRPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594748_SHBs_P-E Product feature CHAIN FN594748_SHBs_P-E of FT:mat_peptide FN594748_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594749_SHBs_P-E Product feature CHAIN FN594749_SHBs_P-E of FT:mat_peptide FN594749_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCTLIPGSSTTSTGLTRACTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594750_SHBs_P-E Product feature CHAIN FN594750_SHBs_P-E of FT:mat_peptide FN594750_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne12). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPISNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594751_SHBs_P-E Product feature CHAIN FN594751_SHBs_P-E of FT:mat_peptide FN594751_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne52H). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPIWPGYRWMCLRRF
IIFLFILLLCLIFWWDLQDYQGMLRECPQTPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594752_SHBs_P-E Product feature CHAIN FN594752_SHBs_P-E of FT:mat_peptide FN594752_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne134). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594756_SHBs_P-E Product feature CHAIN FN594756_SHBs_P-E of FT:mat_peptide FN594756_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne250). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594758_SHBs_P-E Product feature CHAIN FN594758_SHBs_P-E of FT:mat_peptide FN594758_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne341). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594759_SHBs_P-E Product feature CHAIN FN594759_SHBs_P-E of FT:mat_peptide FN594759_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne342). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLXPIFFCLWVYI
>gnl|hbvpro|FN594760_SHBs_P-E Product feature CHAIN FN594760_SHBs_P-E of FT:mat_peptide FN594760_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne362). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLMVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVXLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594761_SHBs_P-E Product feature CHAIN FN594761_SHBs_P-E of FT:mat_peptide FN594761_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne385). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFEK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLNNILSPFIPLXPIFCCLWVYI
>gnl|hbvpro|FN594762_SHBs_P-E Product feature CHAIN FN594762_SHBs_P-E of FT:mat_peptide FN594762_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne439). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSLTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594763_SHBs_P-E Product feature CHAIN FN594763_SHBs_P-E of FT:mat_peptide FN594763_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne446). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594765_SHBs_P-E Product feature CHAIN FN594765_SHBs_P-E of FT:mat_peptide FN594765_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne9447). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPACPLTPGSSTTSTGPCRTCTTLAQGTSMCPSCCCSKPSDGNCTCIPIPSSWAXGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLNNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN594766_SHBs_P-E Product feature CHAIN FN594766_SHBs_P-E of FT:mat_peptide FN594766_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne9449). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLHVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRI
FIFLFILLLCLIFLLDLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GQ161755_SHBs_P-E Product feature CHAIN GQ161755_SHBs_P-E of FT:mat_peptide GQ161755_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1694). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161756_SHBs_P-E Product feature CHAIN GQ161756_SHBs_P-E of FT:mat_peptide GQ161756_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1684). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161757_SHBs_P-E Product feature CHAIN GQ161757_SHBs_P-E of FT:mat_peptide GQ161757_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1156). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161758_SHBs_P-E Product feature CHAIN GQ161758_SHBs_P-E of FT:mat_peptide GQ161758_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1506). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161759_SHBs_P-E Product feature CHAIN GQ161759_SHBs_P-E of FT:mat_peptide GQ161759_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU934). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161760_SHBs_P-E Product feature CHAIN GQ161760_SHBs_P-E of FT:mat_peptide GQ161760_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1374). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSLTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPLCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161761_SHBs_P-E Product feature CHAIN GQ161761_SHBs_P-E of FT:mat_peptide GQ161761_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1033). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161762_SHBs_P-E Product feature CHAIN GQ161762_SHBs_P-E of FT:mat_peptide GQ161762_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU716). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161763_SHBs_P-E Product feature CHAIN GQ161763_SHBs_P-E of FT:mat_peptide GQ161763_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1013). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161764_SHBs_P-E Product feature CHAIN GQ161764_SHBs_P-E of FT:mat_peptide GQ161764_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1056). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161765_SHBs_P-E Product feature CHAIN GQ161765_SHBs_P-E of FT:mat_peptide GQ161765_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU952). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161766_SHBs_P-E Product feature CHAIN GQ161766_SHBs_P-E of FT:mat_peptide GQ161766_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1671). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161768_SHBs_P-E Product feature CHAIN GQ161768_SHBs_P-E of FT:mat_peptide GQ161768_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU960). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161769_SHBs_P-E Product feature CHAIN GQ161769_SHBs_P-E of FT:mat_peptide GQ161769_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU865). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161770_SHBs_P-E Product feature CHAIN GQ161770_SHBs_P-E of FT:mat_peptide GQ161770_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU927). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFVGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161771_SHBs_P-E Product feature CHAIN GQ161771_SHBs_P-E of FT:mat_peptide GQ161771_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU896). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161772_SHBs_P-E Product feature CHAIN GQ161772_SHBs_P-E of FT:mat_peptide GQ161772_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU873). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161773_SHBs_P-E Product feature CHAIN GQ161773_SHBs_P-E of FT:mat_peptide GQ161773_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1406). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161774_SHBs_P-E Product feature CHAIN GQ161774_SHBs_P-E of FT:mat_peptide GQ161774_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1501). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161775_SHBs_P-E Product feature CHAIN GQ161775_SHBs_P-E of FT:mat_peptide GQ161775_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU754). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPXSSTTSTGPCRTCTTXAQGXSMFPSCCCSKPSDGNCTCIPIPSSWAFXK
FLWEWASXRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161776_SHBs_P-E Product feature CHAIN GQ161776_SHBs_P-E of FT:mat_peptide GQ161776_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1178). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161777_SHBs_P-E Product feature CHAIN GQ161777_SHBs_P-E of FT:mat_peptide GQ161777_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU807). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161778_SHBs_P-E Product feature CHAIN GQ161778_SHBs_P-E of FT:mat_peptide GQ161778_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1035). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161779_SHBs_P-E Product feature CHAIN GQ161779_SHBs_P-E of FT:mat_peptide GQ161779_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU557). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161780_SHBs_P-E Product feature CHAIN GQ161780_SHBs_P-E of FT:mat_peptide GQ161780_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU50). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161781_SHBs_P-E Product feature CHAIN GQ161781_SHBs_P-E of FT:mat_peptide GQ161781_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU200). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161782_SHBs_P-E Product feature CHAIN GQ161782_SHBs_P-E of FT:mat_peptide GQ161782_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1489). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161783_SHBs_P-E Product feature CHAIN GQ161783_SHBs_P-E of FT:mat_peptide GQ161783_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU981). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161784_SHBs_P-E Product feature CHAIN GQ161784_SHBs_P-E of FT:mat_peptide GQ161784_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU766). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161785_SHBs_P-E Product feature CHAIN GQ161785_SHBs_P-E of FT:mat_peptide GQ161785_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU758). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161786_SHBs_P-E Product feature CHAIN GQ161786_SHBs_P-E of FT:mat_peptide GQ161786_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1688). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161787_SHBs_P-E Product feature CHAIN GQ161787_SHBs_P-E of FT:mat_peptide GQ161787_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU841). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161789_SHBs_P-E Product feature CHAIN GQ161789_SHBs_P-E of FT:mat_peptide GQ161789_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1169). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161790_SHBs_P-E Product feature CHAIN GQ161790_SHBs_P-E of FT:mat_peptide GQ161790_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1408). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161791_SHBs_P-E Product feature CHAIN GQ161791_SHBs_P-E of FT:mat_peptide GQ161791_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU459). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161792_SHBs_P-E Product feature CHAIN GQ161792_SHBs_P-E of FT:mat_peptide GQ161792_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU605). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161793_SHBs_P-E Product feature CHAIN GQ161793_SHBs_P-E of FT:mat_peptide GQ161793_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU932). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161794_SHBs_P-E Product feature CHAIN GQ161794_SHBs_P-E of FT:mat_peptide GQ161794_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU846). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161795_SHBs_P-E Product feature CHAIN GQ161795_SHBs_P-E of FT:mat_peptide GQ161795_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1558). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161796_SHBs_P-E Product feature CHAIN GQ161796_SHBs_P-E of FT:mat_peptide GQ161796_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1146). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161797_SHBs_P-E Product feature CHAIN GQ161797_SHBs_P-E of FT:mat_peptide GQ161797_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1660). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161798_SHBs_P-E Product feature CHAIN GQ161798_SHBs_P-E of FT:mat_peptide GQ161798_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1222). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFVK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161799_SHBs_P-E Product feature CHAIN GQ161799_SHBs_P-E of FT:mat_peptide GQ161799_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU732). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161800_SHBs_P-E Product feature CHAIN GQ161800_SHBs_P-E of FT:mat_peptide GQ161800_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1039). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161801_SHBs_P-E Product feature CHAIN GQ161801_SHBs_P-E of FT:mat_peptide GQ161801_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU438). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GQ161802_SHBs_P-E Product feature CHAIN GQ161802_SHBs_P-E of FT:mat_peptide GQ161802_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU921). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161803_SHBs_P-E Product feature CHAIN GQ161803_SHBs_P-E of FT:mat_peptide GQ161803_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1700). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161804_SHBs_P-E Product feature CHAIN GQ161804_SHBs_P-E of FT:mat_peptide GQ161804_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1428). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161805_SHBs_P-E Product feature CHAIN GQ161805_SHBs_P-E of FT:mat_peptide GQ161805_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1410). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161807_SHBs_P-E Product feature CHAIN GQ161807_SHBs_P-E of FT:mat_peptide GQ161807_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1168). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161808_SHBs_P-E Product feature CHAIN GQ161808_SHBs_P-E of FT:mat_peptide GQ161808_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1398). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161810_SHBs_P-E Product feature CHAIN GQ161810_SHBs_P-E of FT:mat_peptide GQ161810_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU852). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161811_SHBs_P-E Product feature CHAIN GQ161811_SHBs_P-E of FT:mat_peptide GQ161811_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1361). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161812_SHBs_P-E Product feature CHAIN GQ161812_SHBs_P-E of FT:mat_peptide GQ161812_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1577). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161814_SHBs_P-E Product feature CHAIN GQ161814_SHBs_P-E of FT:mat_peptide GQ161814_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU625). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161815_SHBs_P-E Product feature CHAIN GQ161815_SHBs_P-E of FT:mat_peptide GQ161815_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1241). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161816_SHBs_P-E Product feature CHAIN GQ161816_SHBs_P-E of FT:mat_peptide GQ161816_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1214). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161817_SHBs_P-E Product feature CHAIN GQ161817_SHBs_P-E of FT:mat_peptide GQ161817_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU630). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161818_SHBs_P-E Product feature CHAIN GQ161818_SHBs_P-E of FT:mat_peptide GQ161818_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1520). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161819_SHBs_P-E Product feature CHAIN GQ161819_SHBs_P-E of FT:mat_peptide GQ161819_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1062). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161820_SHBs_P-E Product feature CHAIN GQ161820_SHBs_P-E of FT:mat_peptide GQ161820_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1089). Complete genome. [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLXYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLXPIFFCLWVYI
>gnl|hbvpro|GQ161821_SHBs_P-E Product feature CHAIN GQ161821_SHBs_P-E of FT:mat_peptide GQ161821_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1405). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161822_SHBs_P-E Product feature CHAIN GQ161822_SHBs_P-E of FT:mat_peptide GQ161822_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1086). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161824_SHBs_P-E Product feature CHAIN GQ161824_SHBs_P-E of FT:mat_peptide GQ161824_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU893). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161825_SHBs_P-E Product feature CHAIN GQ161825_SHBs_P-E of FT:mat_peptide GQ161825_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1769). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILKIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPTDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161826_SHBs_P-E Product feature CHAIN GQ161826_SHBs_P-E of FT:mat_peptide GQ161826_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU607). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLHVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTRTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161827_SHBs_P-E Product feature CHAIN GQ161827_SHBs_P-E of FT:mat_peptide GQ161827_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU180). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161828_SHBs_P-E Product feature CHAIN GQ161828_SHBs_P-E of FT:mat_peptide GQ161828_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1399). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161829_SHBs_P-E Product feature CHAIN GQ161829_SHBs_P-E of FT:mat_peptide GQ161829_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU719). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161830_SHBs_P-E Product feature CHAIN GQ161830_SHBs_P-E of FT:mat_peptide GQ161830_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1365). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161831_SHBs_P-E Product feature CHAIN GQ161831_SHBs_P-E of FT:mat_peptide GQ161831_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU779). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGNRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNIWSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161832_SHBs_P-E Product feature CHAIN GQ161832_SHBs_P-E of FT:mat_peptide GQ161832_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1091). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161833_SHBs_P-E Product feature CHAIN GQ161833_SHBs_P-E of FT:mat_peptide GQ161833_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU489). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161834_SHBs_P-E Product feature CHAIN GQ161834_SHBs_P-E of FT:mat_peptide GQ161834_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1128). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161835_SHBs_P-E Product feature CHAIN GQ161835_SHBs_P-E of FT:mat_peptide GQ161835_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU925). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ161836_SHBs_P-E Product feature CHAIN GQ161836_SHBs_P-E of FT:mat_peptide GQ161836_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1051). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486079_SHBs_P-E Product feature CHAIN GQ486079_SHBs_P-E of FT:mat_peptide GQ486079_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS44). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYXILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486093_SHBs_P-E Product feature CHAIN GQ486093_SHBs_P-E of FT:mat_peptide GQ486093_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS58). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQXFAGLSXXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486116_SHBs_P-E Product feature CHAIN GQ486116_SHBs_P-E of FT:mat_peptide GQ486116_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS81). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGXXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486131_SHBs_P-E Product feature CHAIN GQ486131_SHBs_P-E of FT:mat_peptide GQ486131_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS96). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486240_SHBs_P-E Product feature CHAIN GQ486240_SHBs_P-E of FT:mat_peptide GQ486240_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS205). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486258_SHBs_P-E Product feature CHAIN GQ486258_SHBs_P-E of FT:mat_peptide GQ486258_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS223). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLXVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPXCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486295_SHBs_P-E Product feature CHAIN GQ486295_SHBs_P-E of FT:mat_peptide GQ486295_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS260). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCXGQNSQXPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486411_SHBs_P-E Product feature CHAIN GQ486411_SHBs_P-E of FT:mat_peptide GQ486411_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS376). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486451_SHBs_P-E Product feature CHAIN GQ486451_SHBs_P-E of FT:mat_peptide GQ486451_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS416). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXLYNIWSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486548_SHBs_P-E Product feature CHAIN GQ486548_SHBs_P-E of FT:mat_peptide GQ486548_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS513). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486579_SHBs_P-E Product feature CHAIN GQ486579_SHBs_P-E of FT:mat_peptide GQ486579_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS544). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486656_SHBs_P-E Product feature CHAIN GQ486656_SHBs_P-E of FT:mat_peptide GQ486656_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS621). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486664_SHBs_P-E Product feature CHAIN GQ486664_SHBs_P-E of FT:mat_peptide GQ486664_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS629). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486665_SHBs_P-E Product feature CHAIN GQ486665_SHBs_P-E of FT:mat_peptide GQ486665_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS630). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQXFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GQ486692_SHBs_P-E Product feature CHAIN GQ486692_SHBs_P-E of FT:mat_peptide GQ486692_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS657). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486701_SHBs_P-E Product feature CHAIN GQ486701_SHBs_P-E of FT:mat_peptide GQ486701_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS666). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486707_SHBs_P-E Product feature CHAIN GQ486707_SHBs_P-E of FT:mat_peptide GQ486707_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS672). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGXXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486728_SHBs_P-E Product feature CHAIN GQ486728_SHBs_P-E of FT:mat_peptide GQ486728_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS693). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GQ486756_SHBs_P-E Product feature CHAIN GQ486756_SHBs_P-E of FT:mat_peptide GQ486756_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS721). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486765_SHBs_P-E Product feature CHAIN GQ486765_SHBs_P-E of FT:mat_peptide GQ486765_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS730). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTXLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIXMMWYWGPSLYNILSPFIPLXPIFFCLWAYI
>gnl|hbvpro|GQ486778_SHBs_P-E Product feature CHAIN GQ486778_SHBs_P-E of FT:mat_peptide GQ486778_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GS743). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWFSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLLIFFCLWVYI
>gnl|hbvpro|GQ491107_SHBs_P-E Product feature CHAIN GQ491107_SHBs_P-E of FT:mat_peptide GQ491107_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8804335). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLTVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363565_SHBs_P-E Product feature CHAIN HM363565_SHBs_P-E of FT:mat_peptide HM363565_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A186). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSAGNCTCTPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363566_SHBs_P-E Product feature CHAIN HM363566_SHBs_P-E of FT:mat_peptide HM363566_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1082). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLNNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363567_SHBs_P-E Product feature CHAIN HM363567_SHBs_P-E of FT:mat_peptide HM363567_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C16). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363568_SHBs_P-E Product feature CHAIN HM363568_SHBs_P-E of FT:mat_peptide HM363568_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C98). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363569_SHBs_P-E Product feature CHAIN HM363569_SHBs_P-E of FT:mat_peptide HM363569_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A51). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363570_SHBs_P-E Product feature CHAIN HM363570_SHBs_P-E of FT:mat_peptide HM363570_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A85). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363571_SHBs_P-E Product feature CHAIN HM363571_SHBs_P-E of FT:mat_peptide HM363571_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V16). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363572_SHBs_P-E Product feature CHAIN HM363572_SHBs_P-E of FT:mat_peptide HM363572_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLVLQAGFFSLTKTLTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPISCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363573_SHBs_P-E Product feature CHAIN HM363573_SHBs_P-E of FT:mat_peptide HM363573_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNILGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363574_SHBs_P-E Product feature CHAIN HM363574_SHBs_P-E of FT:mat_peptide HM363574_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V70). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363575_SHBs_P-E Product feature CHAIN HM363575_SHBs_P-E of FT:mat_peptide HM363575_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V30). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363576_SHBs_P-E Product feature CHAIN HM363576_SHBs_P-E of FT:mat_peptide HM363576_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V43). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363577_SHBs_P-E Product feature CHAIN HM363577_SHBs_P-E of FT:mat_peptide HM363577_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C19). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSSPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363578_SHBs_P-E Product feature CHAIN HM363578_SHBs_P-E of FT:mat_peptide HM363578_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL802). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363579_SHBs_P-E Product feature CHAIN HM363579_SHBs_P-E of FT:mat_peptide HM363579_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A32). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363580_SHBs_P-E Product feature CHAIN HM363580_SHBs_P-E of FT:mat_peptide HM363580_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A79). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363581_SHBs_P-E Product feature CHAIN HM363581_SHBs_P-E of FT:mat_peptide HM363581_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A84). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363582_SHBs_P-E Product feature CHAIN HM363582_SHBs_P-E of FT:mat_peptide HM363582_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL314). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363583_SHBs_P-E Product feature CHAIN HM363583_SHBs_P-E of FT:mat_peptide HM363583_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V137). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363584_SHBs_P-E Product feature CHAIN HM363584_SHBs_P-E of FT:mat_peptide HM363584_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V129). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363585_SHBs_P-E Product feature CHAIN HM363585_SHBs_P-E of FT:mat_peptide HM363585_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1455). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM363586_SHBs_P-E Product feature CHAIN HM363586_SHBs_P-E of FT:mat_peptide HM363586_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A227). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM363587_SHBs_P-E Product feature CHAIN HM363587_SHBs_P-E of FT:mat_peptide HM363587_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V195). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363588_SHBs_P-E Product feature CHAIN HM363588_SHBs_P-E of FT:mat_peptide HM363588_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A100). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363589_SHBs_P-E Product feature CHAIN HM363589_SHBs_P-E of FT:mat_peptide HM363589_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A178). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363590_SHBs_P-E Product feature CHAIN HM363590_SHBs_P-E of FT:mat_peptide HM363590_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V119). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363591_SHBs_P-E Product feature CHAIN HM363591_SHBs_P-E of FT:mat_peptide HM363591_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A114). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363592_SHBs_P-E Product feature CHAIN HM363592_SHBs_P-E of FT:mat_peptide HM363592_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A153). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDINCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363593_SHBs_P-E Product feature CHAIN HM363593_SHBs_P-E of FT:mat_peptide HM363593_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1577). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363594_SHBs_P-E Product feature CHAIN HM363594_SHBs_P-E of FT:mat_peptide HM363594_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V157). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363595_SHBs_P-E Product feature CHAIN HM363595_SHBs_P-E of FT:mat_peptide HM363595_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1219). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPGCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363596_SHBs_P-E Product feature CHAIN HM363596_SHBs_P-E of FT:mat_peptide HM363596_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V87). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQETSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363597_SHBs_P-E Product feature CHAIN HM363597_SHBs_P-E of FT:mat_peptide HM363597_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A112). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363598_SHBs_P-E Product feature CHAIN HM363598_SHBs_P-E of FT:mat_peptide HM363598_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V15). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHLPTSCPPICPGYRWMCQRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQRTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363599_SHBs_P-E Product feature CHAIN HM363599_SHBs_P-E of FT:mat_peptide HM363599_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V144). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGLSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363600_SHBs_P-E Product feature CHAIN HM363600_SHBs_P-E of FT:mat_peptide HM363600_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C8). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363601_SHBs_P-E Product feature CHAIN HM363601_SHBs_P-E of FT:mat_peptide HM363601_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL911). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363602_SHBs_P-E Product feature CHAIN HM363602_SHBs_P-E of FT:mat_peptide HM363602_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A231). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFSLIKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM363603_SHBs_P-E Product feature CHAIN HM363603_SHBs_P-E of FT:mat_peptide HM363603_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1274). Complete genome. [Hepadnaviridae] (length=226 residues).
METITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWSWGRGLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363604_SHBs_P-E Product feature CHAIN HM363604_SHBs_P-E of FT:mat_peptide HM363604_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A28). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363605_SHBs_P-E Product feature CHAIN HM363605_SHBs_P-E of FT:mat_peptide HM363605_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C58). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363606_SHBs_P-E Product feature CHAIN HM363606_SHBs_P-E of FT:mat_peptide HM363606_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V64). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363607_SHBs_P-E Product feature CHAIN HM363607_SHBs_P-E of FT:mat_peptide HM363607_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C78). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363608_SHBs_P-E Product feature CHAIN HM363608_SHBs_P-E of FT:mat_peptide HM363608_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A212). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTNRTGPCRTCTTLAQGTSMIPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVRFAQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363609_SHBs_P-E Product feature CHAIN HM363609_SHBs_P-E of FT:mat_peptide HM363609_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A58). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM363610_SHBs_P-E Product feature CHAIN HM363610_SHBs_P-E of FT:mat_peptide HM363610_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C113). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363611_SHBs_P-E Product feature CHAIN HM363611_SHBs_P-E of FT:mat_peptide HM363611_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A67). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700550_SHBs_P-E Product feature CHAIN HQ700550_SHBs_P-E of FT:mat_peptide HQ700550_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_A032a). Complete genome. [Hepadnaviridae] (length=226 residues).
IEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700551_SHBs_P-E Product feature CHAIN HQ700551_SHBs_P-E of FT:mat_peptide HQ700551_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_F017A). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSLTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HQ700552_SHBs_P-E Product feature CHAIN HQ700552_SHBs_P-E of FT:mat_peptide HQ700552_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_030). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN226074_SHBs_P-E Product feature CHAIN JN226074_SHBs_P-E of FT:mat_peptide JN226074_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PTV777_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFPGPLLVLQAGFSSLTKILTIPRXXDSWWTSLNFLGGTPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGXSTTSTGPCRTCTTVAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFFCLWAYI
>gnl|hbvpro|JN604166_SHBs_P-E Product feature CHAIN JN604166_SHBs_P-E of FT:mat_peptide JN604166_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 477-9536-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604168_SHBs_P-E Product feature CHAIN JN604168_SHBs_P-E of FT:mat_peptide JN604168_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 477-9824-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604192_SHBs_P-E Product feature CHAIN JN604192_SHBs_P-E of FT:mat_peptide JN604192_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 479-6870-8). Partial genome (Contains: HBe, HBc, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MKSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWXTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604235_SHBs_P-E Product feature CHAIN JN604235_SHBs_P-E of FT:mat_peptide JN604235_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 478-2158-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ000002_SHBs_P-E Product feature CHAIN JQ000002_SHBs_P-E of FT:mat_peptide JQ000002_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ000003_SHBs_P-E Product feature CHAIN JQ000003_SHBs_P-E of FT:mat_peptide JQ000003_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ000004_SHBs_P-E Product feature CHAIN JQ000004_SHBs_P-E of FT:mat_peptide JQ000004_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ000005_SHBs_P-E Product feature CHAIN JQ000005_SHBs_P-E of FT:mat_peptide JQ000005_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ000006_SHBs_P-E Product feature CHAIN JQ000006_SHBs_P-E of FT:mat_peptide JQ000006_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ000008_SHBs_P-E Product feature CHAIN JQ000008_SHBs_P-E of FT:mat_peptide JQ000008_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSXGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ000009_SHBs_P-E Product feature CHAIN JQ000009_SHBs_P-E of FT:mat_peptide JQ000009_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S2). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ972812_SHBs_P-E Product feature CHAIN JQ972812_SHBs_P-E of FT:mat_peptide JQ972812_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972813_SHBs_P-E Product feature CHAIN JQ972813_SHBs_P-E of FT:mat_peptide JQ972813_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972814_SHBs_P-E Product feature CHAIN JQ972814_SHBs_P-E of FT:mat_peptide JQ972814_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972815_SHBs_P-E Product feature CHAIN JQ972815_SHBs_P-E of FT:mat_peptide JQ972815_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCLGQNSXSXTSXHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLXLLXXFVQWFAGLSPTVWLSVIWMMWYWGPSLXNILXPFIPLXPIFFCLWVYI
>gnl|hbvpro|JQ972816_SHBs_P-E Product feature CHAIN JQ972816_SHBs_P-E of FT:mat_peptide JQ972816_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972817_SHBs_P-E Product feature CHAIN JQ972817_SHBs_P-E of FT:mat_peptide JQ972817_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972818_SHBs_P-E Product feature CHAIN JQ972818_SHBs_P-E of FT:mat_peptide JQ972818_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSILPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972819_SHBs_P-E Product feature CHAIN JQ972819_SHBs_P-E of FT:mat_peptide JQ972819_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972820_SHBs_P-E Product feature CHAIN JQ972820_SHBs_P-E of FT:mat_peptide JQ972820_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMXPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWXWASARFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972821_SHBs_P-E Product feature CHAIN JQ972821_SHBs_P-E of FT:mat_peptide JQ972821_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972822_SHBs_P-E Product feature CHAIN JQ972822_SHBs_P-E of FT:mat_peptide JQ972822_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972823_SHBs_P-E Product feature CHAIN JQ972823_SHBs_P-E of FT:mat_peptide JQ972823_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972824_SHBs_P-E Product feature CHAIN JQ972824_SHBs_P-E of FT:mat_peptide JQ972824_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972825_SHBs_P-E Product feature CHAIN JQ972825_SHBs_P-E of FT:mat_peptide JQ972825_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972826_SHBs_P-E Product feature CHAIN JQ972826_SHBs_P-E of FT:mat_peptide JQ972826_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNIXSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972828_SHBs_P-E Product feature CHAIN JQ972828_SHBs_P-E of FT:mat_peptide JQ972828_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ972829_SHBs_P-E Product feature CHAIN JQ972829_SHBs_P-E of FT:mat_peptide JQ972829_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849596_SHBs_P-E Product feature CHAIN JX849596_SHBs_P-E of FT:mat_peptide JX849596_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PTV777_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFPGPLLVLQAGFSSLTKILTIPRXXDSWWTSLNFLGGTPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGXSTTSTGPCRTCTTVAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFFCLWAYI
>gnl|hbvpro|JX849617_SHBs_P-E Product feature CHAIN JX849617_SHBs_P-E of FT:mat_peptide JX849617_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES001_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849618_SHBs_P-E Product feature CHAIN JX849618_SHBs_P-E of FT:mat_peptide JX849618_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES002_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849619_SHBs_P-E Product feature CHAIN JX849619_SHBs_P-E of FT:mat_peptide JX849619_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES003_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXLYNIWSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849620_SHBs_P-E Product feature CHAIN JX849620_SHBs_P-E of FT:mat_peptide JX849620_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES004_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849621_SHBs_P-E Product feature CHAIN JX849621_SHBs_P-E of FT:mat_peptide JX849621_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES005_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCXGQNSQXPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849622_SHBs_P-E Product feature CHAIN JX849622_SHBs_P-E of FT:mat_peptide JX849622_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES006_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849623_SHBs_P-E Product feature CHAIN JX849623_SHBs_P-E of FT:mat_peptide JX849623_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES007_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849624_SHBs_P-E Product feature CHAIN JX849624_SHBs_P-E of FT:mat_peptide JX849624_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES008_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGXXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849625_SHBs_P-E Product feature CHAIN JX849625_SHBs_P-E of FT:mat_peptide JX849625_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES009_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQXFAGLSXXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849626_SHBs_P-E Product feature CHAIN JX849626_SHBs_P-E of FT:mat_peptide JX849626_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BES010_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYXILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849629_SHBs_P-E Product feature CHAIN JX849629_SHBs_P-E of FT:mat_peptide JX849629_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PTV088_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849630_SHBs_P-E Product feature CHAIN JX849630_SHBs_P-E of FT:mat_peptide JX849630_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 120). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGXAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849631_SHBs_P-E Product feature CHAIN JX849631_SHBs_P-E of FT:mat_peptide JX849631_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 151). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPGLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC885607_SHBs_P-E Product feature CHAIN KC885607_SHBs_P-E of FT:mat_peptide KC885607_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero26-08). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170741_SHBs_P-E Product feature CHAIN KF170741_SHBs_P-E of FT:mat_peptide KF170741_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_047). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNIFSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170742_SHBs_P-E Product feature CHAIN KF170742_SHBs_P-E of FT:mat_peptide KF170742_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_125). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSXLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170750_SHBs_P-E Product feature CHAIN KF170750_SHBs_P-E of FT:mat_peptide KF170750_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_004). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFTLLLPIFFCLWVYI
>gnl|hbvpro|KF170751_SHBs_P-E Product feature CHAIN KF170751_SHBs_P-E of FT:mat_peptide KF170751_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_022). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170752_SHBs_P-E Product feature CHAIN KF170752_SHBs_P-E of FT:mat_peptide KF170752_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_088). Partial genome (Contains: SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTYPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRVYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170779_SHBs_P-E Product feature CHAIN KF170779_SHBs_P-E of FT:mat_peptide KF170779_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_058). Partial genome (Contains: SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDTWWTSLNFLGGAPGCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAKGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGE
YLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170780_SHBs_P-E Product feature CHAIN KF170780_SHBs_P-E of FT:mat_peptide KF170780_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_059). Partial genome (Contains: SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170781_SHBs_P-E Product feature CHAIN KF170781_SHBs_P-E of FT:mat_peptide KF170781_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_095). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSSHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLLIFFCLWVYI
>gnl|hbvpro|KF170782_SHBs_P-E Product feature CHAIN KF170782_SHBs_P-E of FT:mat_peptide KF170782_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_002). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|KF170783_SHBs_P-E Product feature CHAIN KF170783_SHBs_P-E of FT:mat_peptide KF170783_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170784_SHBs_P-E Product feature CHAIN KF170784_SHBs_P-E of FT:mat_peptide KF170784_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_066). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170785_SHBs_P-E Product feature CHAIN KF170785_SHBs_P-E of FT:mat_peptide KF170785_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_084). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170786_SHBs_P-E Product feature CHAIN KF170786_SHBs_P-E of FT:mat_peptide KF170786_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_086). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170787_SHBs_P-E Product feature CHAIN KF170787_SHBs_P-E of FT:mat_peptide KF170787_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_110). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQEGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIYLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170788_SHBs_P-E Product feature CHAIN KF170788_SHBs_P-E of FT:mat_peptide KF170788_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170789_SHBs_P-E Product feature CHAIN KF170789_SHBs_P-E of FT:mat_peptide KF170789_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF170790_SHBs_P-E Product feature CHAIN KF170790_SHBs_P-E of FT:mat_peptide KF170790_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_121). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLSNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF771921_SHBs_P-E Product feature CHAIN KF771921_SHBs_P-E of FT:mat_peptide KF771921_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ARC1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF771926_SHBs_P-E Product feature CHAIN KF771926_SHBs_P-E of FT:mat_peptide KF771926_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ARC42). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTPLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF771927_SHBs_P-E Product feature CHAIN KF771927_SHBs_P-E of FT:mat_peptide KF771927_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ARC41). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFXLXLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF771930_SHBs_P-E Product feature CHAIN KF771930_SHBs_P-E of FT:mat_peptide KF771930_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ARC40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPRSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KF771944_SHBs_P-E Product feature CHAIN KF771944_SHBs_P-E of FT:mat_peptide KF771944_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ARC19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849713_SHBs_P-E Product feature CHAIN KF849713_SHBs_P-E of FT:mat_peptide KF849713_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA277). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849714_SHBs_P-E Product feature CHAIN KF849714_SHBs_P-E of FT:mat_peptide KF849714_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA439). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849715_SHBs_P-E Product feature CHAIN KF849715_SHBs_P-E of FT:mat_peptide KF849715_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA445). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849716_SHBs_P-E Product feature CHAIN KF849716_SHBs_P-E of FT:mat_peptide KF849716_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA278). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849717_SHBs_P-E Product feature CHAIN KF849717_SHBs_P-E of FT:mat_peptide KF849717_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA504). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849718_SHBs_P-E Product feature CHAIN KF849718_SHBs_P-E of FT:mat_peptide KF849718_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA72). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849719_SHBs_P-E Product feature CHAIN KF849719_SHBs_P-E of FT:mat_peptide KF849719_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA154). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849720_SHBs_P-E Product feature CHAIN KF849720_SHBs_P-E of FT:mat_peptide KF849720_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA265). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFLWFSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849721_SHBs_P-E Product feature CHAIN KF849721_SHBs_P-E of FT:mat_peptide KF849721_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA379). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849722_SHBs_P-E Product feature CHAIN KF849722_SHBs_P-E of FT:mat_peptide KF849722_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA386). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849723_SHBs_P-E Product feature CHAIN KF849723_SHBs_P-E of FT:mat_peptide KF849723_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA173). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPISNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849724_SHBs_P-E Product feature CHAIN KF849724_SHBs_P-E of FT:mat_peptide KF849724_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA274). Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849726_SHBs_P-E Product feature CHAIN KF849726_SHBs_P-E of FT:mat_peptide KF849726_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA417). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849727_SHBs_P-E Product feature CHAIN KF849727_SHBs_P-E of FT:mat_peptide KF849727_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA405). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF849728_SHBs_P-E Product feature CHAIN KF849728_SHBs_P-E of FT:mat_peptide KF849728_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA423). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922438_SHBs_P-E Product feature CHAIN KF922438_SHBs_P-E of FT:mat_peptide KF922438_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PO04v1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF922439_SHBs_P-E Product feature CHAIN KF922439_SHBs_P-E of FT:mat_peptide KF922439_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PO04v2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM108590_SHBs_P-E Product feature CHAIN KM108590_SHBs_P-E of FT:mat_peptide KM108590_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH120overtDE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNISKPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM108610_SHBs_P-E Product feature CHAIN KM108610_SHBs_P-E of FT:mat_peptide KM108610_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH020overtE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KM108622_SHBs_P-E Product feature CHAIN KM108622_SHBs_P-E of FT:mat_peptide KM108622_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH116overtE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISSHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM108623_SHBs_P-E Product feature CHAIN KM108623_SHBs_P-E of FT:mat_peptide KM108623_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH152OBIE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGPSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVRWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM108624_SHBs_P-E Product feature CHAIN KM108624_SHBs_P-E of FT:mat_peptide KM108624_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH174OBIE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLISLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|KM108625_SHBs_P-E Product feature CHAIN KM108625_SHBs_P-E of FT:mat_peptide KM108625_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH188overtE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|KM108626_SHBs_P-E Product feature CHAIN KM108626_SHBs_P-E of FT:mat_peptide KM108626_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDH193overtE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGLCRTCTTLAQGTSMFPSCCCSKSSDRNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KM983581_SHBs_P-E Product feature CHAIN KM983581_SHBs_P-E of FT:mat_peptide KM983581_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab2219). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|KM983582_SHBs_P-E Product feature CHAIN KM983582_SHBs_P-E of FT:mat_peptide KM983582_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab2709117). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEAPVCRGQNSQSPTSNHSPISCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNTLRLFTPLLLTFFCLWVYI
>gnl|hbvpro|KM983583_SHBs_P-E Product feature CHAIN KM983583_SHBs_P-E of FT:mat_peptide KM983583_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab1213). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLLIFFYLWVYI
>gnl|hbvpro|KM983584_SHBs_P-E Product feature CHAIN KM983584_SHBs_P-E of FT:mat_peptide KM983584_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab745). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLIKILTIPQSLGSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMSPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM983585_SHBs_P-E Product feature CHAIN KM983585_SHBs_P-E of FT:mat_peptide KM983585_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab98). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM983586_SHBs_P-E Product feature CHAIN KM983586_SHBs_P-E of FT:mat_peptide KM983586_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab2370). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLNSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM983587_SHBs_P-E Product feature CHAIN KM983587_SHBs_P-E of FT:mat_peptide KM983587_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab2333). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM983588_SHBs_P-E Product feature CHAIN KM983588_SHBs_P-E of FT:mat_peptide KM983588_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab2249). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICLGYRWMCLRRF
IIFLFIQLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM983589_SHBs_P-E Product feature CHAIN KM983589_SHBs_P-E of FT:mat_peptide KM983589_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab92BMB). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM983590_SHBs_P-E Product feature CHAIN KM983590_SHBs_P-E of FT:mat_peptide KM983590_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gab1213BMB). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLLIFFYLWVYI
>gnl|hbvpro|KP997699_SHBs_P-E Product feature CHAIN KP997699_SHBs_P-E of FT:mat_peptide KP997699_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 337). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLISLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMXPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KR139749_SHBs_P-E Product feature CHAIN KR139749_SHBs_P-E of FT:mat_peptide KR139749_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA45). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFEK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT192626_SHBs_P-E Product feature CHAIN KT192626_SHBs_P-E of FT:mat_peptide KT192626_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711608_SHBs_P-E Product feature CHAIN KU711608_SHBs_P-E of FT:mat_peptide KU711608_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 019N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEHPVCRGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711609_SHBs_P-E Product feature CHAIN KU711609_SHBs_P-E of FT:mat_peptide KU711609_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 162E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711610_SHBs_P-E Product feature CHAIN KU711610_SHBs_P-E of FT:mat_peptide KU711610_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 078N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711611_SHBs_P-E Product feature CHAIN KU711611_SHBs_P-E of FT:mat_peptide KU711611_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 157N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711612_SHBs_P-E Product feature CHAIN KU711612_SHBs_P-E of FT:mat_peptide KU711612_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 063N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILTPFIPLLPIFFYLWASI
>gnl|hbvpro|KU711617_SHBs_P-E Product feature CHAIN KU711617_SHBs_P-E of FT:mat_peptide KU711617_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 057N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711628_SHBs_P-E Product feature CHAIN KU711628_SHBs_P-E of FT:mat_peptide KU711628_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 064N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFTLLLCLIFLLVLLDYRGMLPVCPLIPGSATTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGN
FLWGWASARFSWLSSLAPSVRWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|KU711629_SHBs_P-E Product feature CHAIN KU711629_SHBs_P-E of FT:mat_peptide KU711629_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 127E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSEGNCTCIPIPSSWAFGR
FLWVWASARFSWLSSQVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711630_SHBs_P-E Product feature CHAIN KU711630_SHBs_P-E of FT:mat_peptide KU711630_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 091E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSSLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|KU711631_SHBs_P-E Product feature CHAIN KU711631_SHBs_P-E of FT:mat_peptide KU711631_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 201E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGYFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLICLLVLLDSRGMLPVCPLIPGSSTTSMGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGS
FLWGWASARFSWLSLLVQFVRWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711632_SHBs_P-E Product feature CHAIN KU711632_SHBs_P-E of FT:mat_peptide KU711632_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 224E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCRGQNSRSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711633_SHBs_P-E Product feature CHAIN KU711633_SHBs_P-E of FT:mat_peptide KU711633_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 079N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQISQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711634_SHBs_P-E Product feature CHAIN KU711634_SHBs_P-E of FT:mat_peptide KU711634_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 190E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPYVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711635_SHBs_P-E Product feature CHAIN KU711635_SHBs_P-E of FT:mat_peptide KU711635_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 109E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|KU711636_SHBs_P-E Product feature CHAIN KU711636_SHBs_P-E of FT:mat_peptide KU711636_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 139E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWDWASARFSWLNLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711638_SHBs_P-E Product feature CHAIN KU711638_SHBs_P-E of FT:mat_peptide KU711638_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 095E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MERITSGFLGPLLALQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPMDGNCTCIPIPPSWAFGK
FLWEWALARFSWLNSLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|KU711639_SHBs_P-E Product feature CHAIN KU711639_SHBs_P-E of FT:mat_peptide KU711639_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 159N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711640_SHBs_P-E Product feature CHAIN KU711640_SHBs_P-E of FT:mat_peptide KU711640_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 039N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711641_SHBs_P-E Product feature CHAIN KU711641_SHBs_P-E of FT:mat_peptide KU711641_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 061N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSLIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711643_SHBs_P-E Product feature CHAIN KU711643_SHBs_P-E of FT:mat_peptide KU711643_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 029N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711647_SHBs_P-E Product feature CHAIN KU711647_SHBs_P-E of FT:mat_peptide KU711647_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 051N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711648_SHBs_P-E Product feature CHAIN KU711648_SHBs_P-E of FT:mat_peptide KU711648_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 208E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711651_SHBs_P-E Product feature CHAIN KU711651_SHBs_P-E of FT:mat_peptide KU711651_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 054N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSAGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711652_SHBs_P-E Product feature CHAIN KU711652_SHBs_P-E of FT:mat_peptide KU711652_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 083N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711653_SHBs_P-E Product feature CHAIN KU711653_SHBs_P-E of FT:mat_peptide KU711653_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 086N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711654_SHBs_P-E Product feature CHAIN KU711654_SHBs_P-E of FT:mat_peptide KU711654_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 236E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGMLRVCPLIPGSSTTSTGPCRTCTIPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFWCLWVYI
>gnl|hbvpro|KU711655_SHBs_P-E Product feature CHAIN KU711655_SHBs_P-E of FT:mat_peptide KU711655_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 071N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711656_SHBs_P-E Product feature CHAIN KU711656_SHBs_P-E of FT:mat_peptide KU711656_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 059N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711657_SHBs_P-E Product feature CHAIN KU711657_SHBs_P-E of FT:mat_peptide KU711657_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 069N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGPNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGPSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711658_SHBs_P-E Product feature CHAIN KU711658_SHBs_P-E of FT:mat_peptide KU711658_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 027N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|KU711659_SHBs_P-E Product feature CHAIN KU711659_SHBs_P-E of FT:mat_peptide KU711659_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 233E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCFGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGN
FLWVWASARFSWLSLLVPFVRWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711661_SHBs_P-E Product feature CHAIN KU711661_SHBs_P-E of FT:mat_peptide KU711661_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 200E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPTCPGFRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSMGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYS
>gnl|hbvpro|KU711662_SHBs_P-E Product feature CHAIN KU711662_SHBs_P-E of FT:mat_peptide KU711662_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 068E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711663_SHBs_P-E Product feature CHAIN KU711663_SHBs_P-E of FT:mat_peptide KU711663_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 035N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFSLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711664_SHBs_P-E Product feature CHAIN KU711664_SHBs_P-E of FT:mat_peptide KU711664_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 065N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU711665_SHBs_P-E Product feature CHAIN KU711665_SHBs_P-E of FT:mat_peptide KU711665_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 172E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIISGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736891_SHBs_P-E Product feature CHAIN KU736891_SHBs_P-E of FT:mat_peptide KU736891_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736892_SHBs_P-E Product feature CHAIN KU736892_SHBs_P-E of FT:mat_peptide KU736892_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736893_SHBs_P-E Product feature CHAIN KU736893_SHBs_P-E of FT:mat_peptide KU736893_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Ethiopia_3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736894_SHBs_P-E Product feature CHAIN KU736894_SHBs_P-E of FT:mat_peptide KU736894_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736895_SHBs_P-E Product feature CHAIN KU736895_SHBs_P-E of FT:mat_peptide KU736895_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736896_SHBs_P-E Product feature CHAIN KU736896_SHBs_P-E of FT:mat_peptide KU736896_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736897_SHBs_P-E Product feature CHAIN KU736897_SHBs_P-E of FT:mat_peptide KU736897_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_4). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736898_SHBs_P-E Product feature CHAIN KU736898_SHBs_P-E of FT:mat_peptide KU736898_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736899_SHBs_P-E Product feature CHAIN KU736899_SHBs_P-E of FT:mat_peptide KU736899_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736900_SHBs_P-E Product feature CHAIN KU736900_SHBs_P-E of FT:mat_peptide KU736900_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Somalia_2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736901_SHBs_P-E Product feature CHAIN KU736901_SHBs_P-E of FT:mat_peptide KU736901_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736902_SHBs_P-E Product feature CHAIN KU736902_SHBs_P-E of FT:mat_peptide KU736902_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_12). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736903_SHBs_P-E Product feature CHAIN KU736903_SHBs_P-E of FT:mat_peptide KU736903_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_13). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736904_SHBs_P-E Product feature CHAIN KU736904_SHBs_P-E of FT:mat_peptide KU736904_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_16). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736905_SHBs_P-E Product feature CHAIN KU736905_SHBs_P-E of FT:mat_peptide KU736905_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_17). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736906_SHBs_P-E Product feature CHAIN KU736906_SHBs_P-E of FT:mat_peptide KU736906_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736907_SHBs_P-E Product feature CHAIN KU736907_SHBs_P-E of FT:mat_peptide KU736907_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736908_SHBs_P-E Product feature CHAIN KU736908_SHBs_P-E of FT:mat_peptide KU736908_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736909_SHBs_P-E Product feature CHAIN KU736909_SHBs_P-E of FT:mat_peptide KU736909_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736910_SHBs_P-E Product feature CHAIN KU736910_SHBs_P-E of FT:mat_peptide KU736910_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_8). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736911_SHBs_P-E Product feature CHAIN KU736911_SHBs_P-E of FT:mat_peptide KU736911_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_9). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736912_SHBs_P-E Product feature CHAIN KU736912_SHBs_P-E of FT:mat_peptide KU736912_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_4). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KU736913_SHBs_P-E Product feature CHAIN KU736913_SHBs_P-E of FT:mat_peptide KU736913_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_7). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWAXARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLHNTLSPFILLLPIFFCLWVYI
>gnl|hbvpro|KX186584_SHBs_P-E Product feature CHAIN KX186584_SHBs_P-E of FT:mat_peptide KX186584_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Eafr). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX372216_SHBs_P-E Product feature CHAIN KX372216_SHBs_P-E of FT:mat_peptide KX372216_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate B130_2012_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLXVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX372217_SHBs_P-E Product feature CHAIN KX372217_SHBs_P-E of FT:mat_peptide KX372217_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate B154_2013_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY271380_SHBs_P-E Product feature CHAIN KY271380_SHBs_P-E of FT:mat_peptide KY271380_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S33634). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY271381_SHBs_P-E Product feature CHAIN KY271381_SHBs_P-E of FT:mat_peptide KY271381_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S34678). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSRPSDKNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY271383_SHBs_P-E Product feature CHAIN KY271383_SHBs_P-E of FT:mat_peptide KY271383_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S34058). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSRPSDKNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY271386_SHBs_P-E Product feature CHAIN KY271386_SHBs_P-E of FT:mat_peptide KY271386_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S34803). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILAIPPGLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLIGSWGSLPLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSNGNCTCIPIPSSWAFGN
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|KY493921_SHBs_P-E Product feature CHAIN KY493921_SHBs_P-E of FT:mat_peptide KY493921_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate D1761). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MXSITSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISLCLWVYI
>gnl|hbvpro|KY494018_SHBs_P-E Product feature CHAIN KY494018_SHBs_P-E of FT:mat_peptide KY494018_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K3620). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGACRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY494038_SHBs_P-E Product feature CHAIN KY494038_SHBs_P-E of FT:mat_peptide KY494038_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate K719). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSXLVPFVQWFAGLSPTVWLSVIWMMWYWGLSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY494047_SHBs_P-E Product feature CHAIN KY494047_SHBs_P-E of FT:mat_peptide KY494047_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate N1205). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSXLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGSSTTSTGPCRTCTTXAQGTSIFPSCCCSKPSEXNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFXQWFAXLSPTVWLSVIWXMWYXGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY494096_SHBs_P-E Product feature CHAIN KY494096_SHBs_P-E of FT:mat_peptide KY494096_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S4105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGXLGPLLXLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGTCRTCTTPAQGTSMFPSCCCSKPSDXNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVXWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY494098_SHBs_P-E Product feature CHAIN KY494098_SHBs_P-E of FT:mat_peptide KY494098_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S4205). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY498770_SHBs_P-E Product feature CHAIN KY498770_SHBs_P-E of FT:mat_peptide KY498770_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate P94). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY697839_SHBs_P-E Product feature CHAIN KY697839_SHBs_P-E of FT:mat_peptide KY697839_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV_Mrs_E_034447_26-4-2011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY697849_SHBs_P-E Product feature CHAIN KY697849_SHBs_P-E of FT:mat_peptide KY697849_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV_Mrs_E_319385_9-8-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLTVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|L24071_SHBs_P-E Product feature CHAIN L24071_SHBs_P-E of FT:mat_peptide L24071_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSEPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|L29017_SHBs_P-E Product feature CHAIN L29017_SHBs_P-E of FT:mat_peptide L29017_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623843_SHBs_P-E Product feature CHAIN LT623843_SHBs_P-E of FT:mat_peptide LT623843_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQEGFFXLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPISNHSPTSCPXICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|LT623844_SHBs_P-E Product feature CHAIN LT623844_SHBs_P-E of FT:mat_peptide LT623844_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPXLYNILSPFIPLXPIFFCLWVYI
>gnl|hbvpro|LT623845_SHBs_P-E Product feature CHAIN LT623845_SHBs_P-E of FT:mat_peptide LT623845_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLXCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623846_SHBs_P-E Product feature CHAIN LT623846_SHBs_P-E of FT:mat_peptide LT623846_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623847_SHBs_P-E Product feature CHAIN LT623847_SHBs_P-E of FT:mat_peptide LT623847_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623848_SHBs_P-E Product feature CHAIN LT623848_SHBs_P-E of FT:mat_peptide LT623848_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623849_SHBs_P-E Product feature CHAIN LT623849_SHBs_P-E of FT:mat_peptide LT623849_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPXVWLSVIWMMWYWGPSLYNXLSPFIPLXPIFFCLWVYI
>gnl|hbvpro|LT623850_SHBs_P-E Product feature CHAIN LT623850_SHBs_P-E of FT:mat_peptide LT623850_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623851_SHBs_P-E Product feature CHAIN LT623851_SHBs_P-E of FT:mat_peptide LT623851_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLSFLGEAPVCLGQNSQSPTSNHSPTSCPPTCPGFRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVLFVQWFAGLSPTVWLSVIWMMWYWAPGLCNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623852_SHBs_P-E Product feature CHAIN LT623852_SHBs_P-E of FT:mat_peptide LT623852_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPXCPGXRXMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLXNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|LT623853_SHBs_P-E Product feature CHAIN LT623853_SHBs_P-E of FT:mat_peptide LT623853_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MXSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623854_SHBs_P-E Product feature CHAIN LT623854_SHBs_P-E of FT:mat_peptide LT623854_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESISSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPGLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623855_SHBs_P-E Product feature CHAIN LT623855_SHBs_P-E of FT:mat_peptide LT623855_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVXLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYXTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623856_SHBs_P-E Product feature CHAIN LT623856_SHBs_P-E of FT:mat_peptide LT623856_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPKLYNILNPFILLFPIFFCLWAFI
>gnl|hbvpro|LT623857_SHBs_P-E Product feature CHAIN LT623857_SHBs_P-E of FT:mat_peptide LT623857_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623858_SHBs_P-E Product feature CHAIN LT623858_SHBs_P-E of FT:mat_peptide LT623858_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623859_SHBs_P-E Product feature CHAIN LT623859_SHBs_P-E of FT:mat_peptide LT623859_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWXWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNIWSPFIPLLXIFFCLWVYI
>gnl|hbvpro|LT623860_SHBs_P-E Product feature CHAIN LT623860_SHBs_P-E of FT:mat_peptide LT623860_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623861_SHBs_P-E Product feature CHAIN LT623861_SHBs_P-E of FT:mat_peptide LT623861_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623862_SHBs_P-E Product feature CHAIN LT623862_SHBs_P-E of FT:mat_peptide LT623862_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MEGITSGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAXGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSXLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLXNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623863_SHBs_P-E Product feature CHAIN LT623863_SHBs_P-E of FT:mat_peptide LT623863_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623864_SHBs_P-E Product feature CHAIN LT623864_SHBs_P-E of FT:mat_peptide LT623864_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLXNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623865_SHBs_P-E Product feature CHAIN LT623865_SHBs_P-E of FT:mat_peptide LT623865_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623868_SHBs_P-E Product feature CHAIN LT623868_SHBs_P-E of FT:mat_peptide LT623868_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623869_SHBs_P-E Product feature CHAIN LT623869_SHBs_P-E of FT:mat_peptide LT623869_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623870_SHBs_P-E Product feature CHAIN LT623870_SHBs_P-E of FT:mat_peptide LT623870_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSXXVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623871_SHBs_P-E Product feature CHAIN LT623871_SHBs_P-E of FT:mat_peptide LT623871_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLXPIFFCLWVYI
>gnl|hbvpro|LT623872_SHBs_P-E Product feature CHAIN LT623872_SHBs_P-E of FT:mat_peptide LT623872_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWYWGXSLYNILSPFIPLXPIFFYLWVYI
>gnl|hbvpro|LT623873_SHBs_P-E Product feature CHAIN LT623873_SHBs_P-E of FT:mat_peptide LT623873_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQXFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623874_SHBs_P-E Product feature CHAIN LT623874_SHBs_P-E of FT:mat_peptide LT623874_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCXRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSXLVPFVQWFAGLSPTVWLSVIWMXWYWGPXLYNIXSPFIPLLPIFFXLWVYI
>gnl|hbvpro|LT623876_SHBs_P-E Product feature CHAIN LT623876_SHBs_P-E of FT:mat_peptide LT623876_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWXWGPXLYNXLRPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623877_SHBs_P-E Product feature CHAIN LT623877_SHBs_P-E of FT:mat_peptide LT623877_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWXWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623878_SHBs_P-E Product feature CHAIN LT623878_SHBs_P-E of FT:mat_peptide LT623878_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623879_SHBs_P-E Product feature CHAIN LT623879_SHBs_P-E of FT:mat_peptide LT623879_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQXGFFSLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623881_SHBs_P-E Product feature CHAIN LT623881_SHBs_P-E of FT:mat_peptide LT623881_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623882_SHBs_P-E Product feature CHAIN LT623882_SHBs_P-E of FT:mat_peptide LT623882_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTKILTIPRSLDSWWTSLSFLGGVPVCPGQNSQSPTSNHSPXSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPGLYNILSXFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623883_SHBs_P-E Product feature CHAIN LT623883_SHBs_P-E of FT:mat_peptide LT623883_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623885_SHBs_P-E Product feature CHAIN LT623885_SHBs_P-E of FT:mat_peptide LT623885_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRS
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|LT623886_SHBs_P-E Product feature CHAIN LT623886_SHBs_P-E of FT:mat_peptide LT623886_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRS
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772354_SHBs_P-E Product feature CHAIN MF772354_SHBs_P-E of FT:mat_peptide MF772354_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1067). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772355_SHBs_P-E Product feature CHAIN MF772355_SHBs_P-E of FT:mat_peptide MF772355_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 488). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQNLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772357_SHBs_P-E Product feature CHAIN MF772357_SHBs_P-E of FT:mat_peptide MF772357_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 222). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQSLRNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772358_SHBs_P-E Product feature CHAIN MF772358_SHBs_P-E of FT:mat_peptide MF772358_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPGLFNILKPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772359_SHBs_P-E Product feature CHAIN MF772359_SHBs_P-E of FT:mat_peptide MF772359_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 335). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYTILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772360_SHBs_P-E Product feature CHAIN MF772360_SHBs_P-E of FT:mat_peptide MF772360_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 666). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772361_SHBs_P-E Product feature CHAIN MF772361_SHBs_P-E of FT:mat_peptide MF772361_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 801). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MF772362_SHBs_P-E Product feature CHAIN MF772362_SHBs_P-E of FT:mat_peptide MF772362_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 960). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MG383615_SHBs_P-E Product feature CHAIN MG383615_SHBs_P-E of FT:mat_peptide MG383615_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NL13_2015_E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLXVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH165306_SHBs_P-E Product feature CHAIN MH165306_SHBs_P-E of FT:mat_peptide MH165306_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MANET_125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464855_SHBs_P-E Product feature CHAIN MH464855_SHBs_P-E of FT:mat_peptide MH464855_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA133). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH464856_SHBs_P-E Product feature CHAIN MH464856_SHBs_P-E of FT:mat_peptide MH464856_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA134). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|MH580614_SHBs_P-E Product feature CHAIN MH580614_SHBs_P-E of FT:mat_peptide MH580614_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 177). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580615_SHBs_P-E Product feature CHAIN MH580615_SHBs_P-E of FT:mat_peptide MH580615_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 188). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580616_SHBs_P-E Product feature CHAIN MH580616_SHBs_P-E of FT:mat_peptide MH580616_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 190). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580617_SHBs_P-E Product feature CHAIN MH580617_SHBs_P-E of FT:mat_peptide MH580617_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 193). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580618_SHBs_P-E Product feature CHAIN MH580618_SHBs_P-E of FT:mat_peptide MH580618_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 199). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580619_SHBs_P-E Product feature CHAIN MH580619_SHBs_P-E of FT:mat_peptide MH580619_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 200). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580620_SHBs_P-E Product feature CHAIN MH580620_SHBs_P-E of FT:mat_peptide MH580620_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 201). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580621_SHBs_P-E Product feature CHAIN MH580621_SHBs_P-E of FT:mat_peptide MH580621_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 209). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580622_SHBs_P-E Product feature CHAIN MH580622_SHBs_P-E of FT:mat_peptide MH580622_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 210). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580623_SHBs_P-E Product feature CHAIN MH580623_SHBs_P-E of FT:mat_peptide MH580623_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 232). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580624_SHBs_P-E Product feature CHAIN MH580624_SHBs_P-E of FT:mat_peptide MH580624_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 226). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580625_SHBs_P-E Product feature CHAIN MH580625_SHBs_P-E of FT:mat_peptide MH580625_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 239). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580626_SHBs_P-E Product feature CHAIN MH580626_SHBs_P-E of FT:mat_peptide MH580626_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 240). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580628_SHBs_P-E Product feature CHAIN MH580628_SHBs_P-E of FT:mat_peptide MH580628_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 304). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580629_SHBs_P-E Product feature CHAIN MH580629_SHBs_P-E of FT:mat_peptide MH580629_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 306). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580630_SHBs_P-E Product feature CHAIN MH580630_SHBs_P-E of FT:mat_peptide MH580630_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 310). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580631_SHBs_P-E Product feature CHAIN MH580631_SHBs_P-E of FT:mat_peptide MH580631_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 333). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580632_SHBs_P-E Product feature CHAIN MH580632_SHBs_P-E of FT:mat_peptide MH580632_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 334). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580633_SHBs_P-E Product feature CHAIN MH580633_SHBs_P-E of FT:mat_peptide MH580633_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 398). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580634_SHBs_P-E Product feature CHAIN MH580634_SHBs_P-E of FT:mat_peptide MH580634_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 400). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580635_SHBs_P-E Product feature CHAIN MH580635_SHBs_P-E of FT:mat_peptide MH580635_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 401). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580636_SHBs_P-E Product feature CHAIN MH580636_SHBs_P-E of FT:mat_peptide MH580636_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 402). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580637_SHBs_P-E Product feature CHAIN MH580637_SHBs_P-E of FT:mat_peptide MH580637_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 408). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580638_SHBs_P-E Product feature CHAIN MH580638_SHBs_P-E of FT:mat_peptide MH580638_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 416). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|MH580640_SHBs_P-E Product feature CHAIN MH580640_SHBs_P-E of FT:mat_peptide MH580640_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 438). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580641_SHBs_P-E Product feature CHAIN MH580641_SHBs_P-E of FT:mat_peptide MH580641_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 439). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580644_SHBs_P-E Product feature CHAIN MH580644_SHBs_P-E of FT:mat_peptide MH580644_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 458). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580645_SHBs_P-E Product feature CHAIN MH580645_SHBs_P-E of FT:mat_peptide MH580645_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 472). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTCNHSPTSCPPTCPGFRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPRSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580646_SHBs_P-E Product feature CHAIN MH580646_SHBs_P-E of FT:mat_peptide MH580646_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 476). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580647_SHBs_P-E Product feature CHAIN MH580647_SHBs_P-E of FT:mat_peptide MH580647_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 490). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580648_SHBs_P-E Product feature CHAIN MH580648_SHBs_P-E of FT:mat_peptide MH580648_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 522). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580649_SHBs_P-E Product feature CHAIN MH580649_SHBs_P-E of FT:mat_peptide MH580649_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 523). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580650_SHBs_P-E Product feature CHAIN MH580650_SHBs_P-E of FT:mat_peptide MH580650_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 619). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580651_SHBs_P-E Product feature CHAIN MH580651_SHBs_P-E of FT:mat_peptide MH580651_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 623). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MH580652_SHBs_P-E Product feature CHAIN MH580652_SHBs_P-E of FT:mat_peptide MH580652_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 668). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|MK321264_SHBs_P-E Product feature CHAIN MK321264_SHBs_P-E of FT:mat_peptide MK321264_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1332). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|X75657_SHBs_P-E Product feature CHAIN X75657_SHBs_P-E of FT:mat_peptide X75657_SHBs_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Bas). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
© 1998-2019