HBVdb

Dataset for protein HBSP of genotype F

[Download (right click)]

1 sequence(s)

>gnl|hbvpro|AB365453_HBSP_P-F Product feature CHAIN AB365453_HBSP_P-F of FT:mat_peptide AB365453_HBSP_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL584). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFLKLLLLDHEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDPQPPARDNAKPAQLLLKEPLCFPPVAVQNPRT
ETAPVFPSHHLGLSENTYGSGPQPVSPGSVY
© 1998-2019