HBVdb

Dataset for protein HBc of genotype F

[Download (right click)] [Alignment] [Repertoires]

277 sequence(s)

>gnl|hbvpro|AB036905_HBc_P-F Product feature CHAIN AB036905_HBc_P-F of FT:mat_peptide AB036905_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8248-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036906_HBc_P-F Product feature CHAIN AB036906_HBc_P-F of FT:mat_peptide AB036906_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8248-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036907_HBc_P-F Product feature CHAIN AB036907_HBc_P-F of FT:mat_peptide AB036907_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8339-2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036908_HBc_P-F Product feature CHAIN AB036908_HBc_P-F of FT:mat_peptide AB036908_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8337). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|AB036909_HBc_P-F Product feature CHAIN AB036909_HBc_P-F of FT:mat_peptide AB036909_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8339-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036910_HBc_P-F Product feature CHAIN AB036910_HBc_P-F of FT:mat_peptide AB036910_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8251). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036911_HBc_P-F Product feature CHAIN AB036911_HBc_P-F of FT:mat_peptide AB036911_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8255). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036912_HBc_P-F Product feature CHAIN AB036912_HBc_P-F of FT:mat_peptide AB036912_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8323). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036913_HBc_P-F Product feature CHAIN AB036913_HBc_P-F of FT:mat_peptide AB036913_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8346). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036914_HBc_P-F Product feature CHAIN AB036914_HBc_P-F of FT:mat_peptide AB036914_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8349). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036915_HBc_P-F Product feature CHAIN AB036915_HBc_P-F of FT:mat_peptide AB036915_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8351). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036916_HBc_P-F Product feature CHAIN AB036916_HBc_P-F of FT:mat_peptide AB036916_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8371). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036917_HBc_P-F Product feature CHAIN AB036917_HBc_P-F of FT:mat_peptide AB036917_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8375-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036919_HBc_P-F Product feature CHAIN AB036919_HBc_P-F of FT:mat_peptide AB036919_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8381). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB036920_HBc_P-F Product feature CHAIN AB036920_HBc_P-F of FT:mat_peptide AB036920_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8624). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB064316_HBc_P-F Product feature CHAIN AB064316_HBc_P-F of FT:mat_peptide AB064316_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB086397_HBc_P-F Product feature CHAIN AB086397_HBc_P-F of FT:mat_peptide AB086397_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate JPF1130). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPLDFFPSARDLLDTASALYREALESPEHCTAHHTALRQAILCWGELTTLATWVGNNLDDPA
ARDLVVNYVNTHMGLKTRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSPSSQC
>gnl|hbvpro|AB116549_HBc_P-F Product feature CHAIN AB116549_HBc_P-F of FT:mat_peptide AB116549_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB116550_HBc_P-F Product feature CHAIN AB116550_HBc_P-F of FT:mat_peptide AB116550_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPFKEFGASEELLSFLPLDFFPNVRDLLDTASALYRDALESSEHCTPHHTALRQAILCWGELMIFAAWVGNNLEDPA
ARDLVVNYVNTNMGLKIRRLLWFHISCLTFGRQVVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB116551_HBc_P-F Product feature CHAIN AB116551_HBc_P-F of FT:mat_peptide AB116551_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB116552_HBc_P-F Product feature CHAIN AB116552_HBc_P-F of FT:mat_peptide AB116552_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB116654_HBc_P-F Product feature CHAIN AB116654_HBc_P-F of FT:mat_peptide AB116654_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTAHHTAIRQIVLCWGELMTLASWVGNNLDDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|AB166850_HBc_P-F Product feature CHAIN AB166850_HBc_P-F of FT:mat_peptide AB166850_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV-BL592). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB214516_HBc_P-F Product feature CHAIN AB214516_HBc_P-F of FT:mat_peptide AB214516_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV-BL597). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB365446_HBc_P-F Product feature CHAIN AB365446_HBc_P-F of FT:mat_peptide AB365446_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLXFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASHC
>gnl|hbvpro|AB365449_HBc_P-F Product feature CHAIN AB365449_HBc_P-F of FT:mat_peptide AB365449_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL93). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLQDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB365450_HBc_P-F Product feature CHAIN AB365450_HBc_P-F of FT:mat_peptide AB365450_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL102). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPXDXXPSVRDLLDTASALYRDALESPEHXTPHHXALRQAILCWGELMTLASWVGNNLDDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSXGVWIRTPPXYRPPNAPILSTLPETTVXRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB365453_HBc_P-F Product feature CHAIN AB365453_HBc_P-F of FT:mat_peptide AB365453_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL584). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTATALYRDDLESPEHCTAHHTALRQAIVCWGEVMTLASWVGNNLDDPG
ARDLVVNYVNTHMGLKIRQLLWFHISCLMFGRQTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRPRGRTPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AF223962_HBc_P-F Product feature CHAIN AF223962_HBc_P-F of FT:mat_peptide AF223962_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AF223963_HBc_P-F Product feature CHAIN AF223963_HBc_P-F of FT:mat_peptide AF223963_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AF223964_HBc_P-F Product feature CHAIN AF223964_HBc_P-F of FT:mat_peptide AF223964_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AF223965_HBc_P-F Product feature CHAIN AF223965_HBc_P-F of FT:mat_peptide AF223965_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AF324143_HBc_P-F Product feature CHAIN AF324143_HBc_P-F of FT:mat_peptide AF324143_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate I98). Partial genome (Contains: HBe, HBc, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMIFASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY090455_HBc_P-F Product feature CHAIN AY090455_HBc_P-F of FT:mat_peptide AY090455_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|AY090458_HBc_C-F Product feature CHAIN AY090458_HBc_C-F of FT:mat_peptide AY090458_HBc_C-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY090459_HBc_P-F Product feature CHAIN AY090459_HBc_P-F of FT:mat_peptide AY090459_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
DRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASPC
>gnl|hbvpro|AY090461_HBc_P-F Product feature CHAIN AY090461_HBc_P-F of FT:mat_peptide AY090461_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY179735_HBc_P-F Product feature CHAIN AY179735_HBc_P-F of FT:mat_peptide AY179735_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY254498_HBc_P-F Product feature CHAIN AY254498_HBc_P-F of FT:mat_peptide AY254498_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 14). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY311369_HBc_P-F Product feature CHAIN AY311369_HBc_P-F of FT:mat_peptide AY311369_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD4139). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY311370_HBc_P-F Product feature CHAIN AY311370_HBc_P-F of FT:mat_peptide AY311370_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD14999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSRRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ776247_HBc_P-F Product feature CHAIN DQ776247_HBc_P-F of FT:mat_peptide DQ776247_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823086_HBc_P-F Product feature CHAIN DQ823086_HBc_P-F of FT:mat_peptide DQ823086_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823087_HBc_P-F Product feature CHAIN DQ823087_HBc_P-F of FT:mat_peptide DQ823087_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|DQ823088_HBc_P-F Product feature CHAIN DQ823088_HBc_P-F of FT:mat_peptide DQ823088_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823089_HBc_P-F Product feature CHAIN DQ823089_HBc_P-F of FT:mat_peptide DQ823089_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823090_HBc_P-F Product feature CHAIN DQ823090_HBc_P-F of FT:mat_peptide DQ823090_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823091_HBc_P-F Product feature CHAIN DQ823091_HBc_P-F of FT:mat_peptide DQ823091_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823092_HBc_P-F Product feature CHAIN DQ823092_HBc_P-F of FT:mat_peptide DQ823092_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823093_HBc_P-F Product feature CHAIN DQ823093_HBc_P-F of FT:mat_peptide DQ823093_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823094_HBc_P-F Product feature CHAIN DQ823094_HBc_P-F of FT:mat_peptide DQ823094_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ823095_HBc_P-F Product feature CHAIN DQ823095_HBc_P-F of FT:mat_peptide DQ823095_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ899142_HBc_P-F Product feature CHAIN DQ899142_HBc_P-F of FT:mat_peptide DQ899142_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Warao152). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ899143_HBc_P-F Product feature CHAIN DQ899143_HBc_P-F of FT:mat_peptide DQ899143_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Warao189). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ899144_HBc_P-F Product feature CHAIN DQ899144_HBc_P-F of FT:mat_peptide DQ899144_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira75). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ899145_HBc_P-F Product feature CHAIN DQ899145_HBc_P-F of FT:mat_peptide DQ899145_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ899146_HBc_P-F Product feature CHAIN DQ899146_HBc_P-F of FT:mat_peptide DQ899146_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira80). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLFDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ899147_HBc_P-F Product feature CHAIN DQ899147_HBc_P-F of FT:mat_peptide DQ899147_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ899148_HBc_P-F Product feature CHAIN DQ899148_HBc_P-F of FT:mat_peptide DQ899148_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Yanomami114). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ899149_HBc_P-F Product feature CHAIN DQ899149_HBc_P-F of FT:mat_peptide DQ899149_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Piaroa3019). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQWPRRRRSQSPASQC
>gnl|hbvpro|DQ899150_HBc_P-F Product feature CHAIN DQ899150_HBc_P-F of FT:mat_peptide DQ899150_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Colombia8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQLPRRRRSQSPASQC
>gnl|hbvpro|EF576808_HBc_P-F Product feature CHAIN EF576808_HBc_P-F of FT:mat_peptide EF576808_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SAL7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSARDLFDTASALYRDALESPQHCTPHHTALRQAILCWGELTTLASWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EF576812_HBc_P-F Product feature CHAIN EF576812_HBc_P-F of FT:mat_peptide EF576812_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SAL13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU185743_HBc_P-F Product feature CHAIN EU185743_HBc_P-F of FT:mat_peptide EU185743_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MSM6). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASLVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRXGRSPRRRT
PSPRRQRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU185744_HBc_P-F Product feature CHAIN EU185744_HBc_P-F of FT:mat_peptide EU185744_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MSM7). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRXRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU366116_HBc_P-F Product feature CHAIN EU366116_HBc_P-F of FT:mat_peptide EU366116_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA61). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU366118_HBc_P-F Product feature CHAIN EU366118_HBc_P-F of FT:mat_peptide EU366118_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU366132_HBc_P-F Product feature CHAIN EU366132_HBc_P-F of FT:mat_peptide EU366132_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA95). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASRELLSFLPNDFYPSARDLLDTATALYRDALESPEHCSPHHTVIRQAVLCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTTVGLKLRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU366133_HBc_P-F Product feature CHAIN EU366133_HBc_P-F of FT:mat_peptide EU366133_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA96). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU670261_HBc_P-F Product feature CHAIN EU670261_HBc_P-F of FT:mat_peptide EU670261_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 499). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU670262_HBc_P-F Product feature CHAIN EU670262_HBc_P-F of FT:mat_peptide EU670262_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 549). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELVTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ589065_HBc_P-F Product feature CHAIN FJ589065_HBc_P-F of FT:mat_peptide FJ589065_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_024). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSPASQC
>gnl|hbvpro|FJ589066_HBc_P-F Product feature CHAIN FJ589066_HBc_P-F of FT:mat_peptide FJ589066_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_054). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLTFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMVFASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRDTVIQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRPRGRTPRRRT
PSPRRRRSQSPGRRRSQSPSSQC
>gnl|hbvpro|FJ589067_HBc_P-F Product feature CHAIN FJ589067_HBc_P-F of FT:mat_peptide FJ589067_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_083). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|FJ657519_HBc_P-F Product feature CHAIN FJ657519_HBc_P-F of FT:mat_peptide FJ657519_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA110). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSPASQC
>gnl|hbvpro|FJ657522_HBc_P-F Product feature CHAIN FJ657522_HBc_P-F of FT:mat_peptide FJ657522_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ657525_HBc_P-F Product feature CHAIN FJ657525_HBc_P-F of FT:mat_peptide FJ657525_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA107). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCSPHHTALRQVSLCWSELMTFAIWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHXSCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|FJ657528_HBc_P-F Product feature CHAIN FJ657528_HBc_P-F of FT:mat_peptide FJ657528_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA108). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ657529_HBc_P-F Product feature CHAIN FJ657529_HBc_P-F of FT:mat_peptide FJ657529_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA109). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709457_HBc_P-F Product feature CHAIN FJ709457_HBc_P-F of FT:mat_peptide FJ709457_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709458_HBc_P-F Product feature CHAIN FJ709458_HBc_P-F of FT:mat_peptide FJ709458_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709459_HBc_P-F Product feature CHAIN FJ709459_HBc_P-F of FT:mat_peptide FJ709459_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709460_HBc_P-F Product feature CHAIN FJ709460_HBc_P-F of FT:mat_peptide FJ709460_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709462_HBc_P-F Product feature CHAIN FJ709462_HBc_P-F of FT:mat_peptide FJ709462_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709463_HBc_P-F Product feature CHAIN FJ709463_HBc_P-F of FT:mat_peptide FJ709463_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709464_HBc_P-F Product feature CHAIN FJ709464_HBc_P-F of FT:mat_peptide FJ709464_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709465_HBc_P-F Product feature CHAIN FJ709465_HBc_P-F of FT:mat_peptide FJ709465_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ709494_HBc_P-F Product feature CHAIN FJ709494_HBc_P-F of FT:mat_peptide FJ709494_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HE981181_HBc_P-F Product feature CHAIN HE981181_HBc_P-F of FT:mat_peptide HE981181_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HE981182_HBc_P-F Product feature CHAIN HE981182_HBc_P-F of FT:mat_peptide HE981182_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HE981186_HBc_P-F Product feature CHAIN HE981186_HBc_P-F of FT:mat_peptide HE981186_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585186_HBc_P-F Product feature CHAIN HM585186_HBc_P-F of FT:mat_peptide HM585186_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585187_HBc_P-F Product feature CHAIN HM585187_HBc_P-F of FT:mat_peptide HM585187_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585188_HBc_P-F Product feature CHAIN HM585188_HBc_P-F of FT:mat_peptide HM585188_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585189_HBc_P-F Product feature CHAIN HM585189_HBc_P-F of FT:mat_peptide HM585189_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585190_HBc_P-F Product feature CHAIN HM585190_HBc_P-F of FT:mat_peptide HM585190_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585191_HBc_P-F Product feature CHAIN HM585191_HBc_P-F of FT:mat_peptide HM585191_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585192_HBc_P-F Product feature CHAIN HM585192_HBc_P-F of FT:mat_peptide HM585192_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585193_HBc_P-F Product feature CHAIN HM585193_HBc_P-F of FT:mat_peptide HM585193_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585194_HBc_P-F Product feature CHAIN HM585194_HBc_P-F of FT:mat_peptide HM585194_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585195_HBc_P-F Product feature CHAIN HM585195_HBc_P-F of FT:mat_peptide HM585195_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585196_HBc_P-F Product feature CHAIN HM585196_HBc_P-F of FT:mat_peptide HM585196_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585197_HBc_P-F Product feature CHAIN HM585197_HBc_P-F of FT:mat_peptide HM585197_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585198_HBc_P-F Product feature CHAIN HM585198_HBc_P-F of FT:mat_peptide HM585198_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585199_HBc_P-F Product feature CHAIN HM585199_HBc_P-F of FT:mat_peptide HM585199_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM585200_HBc_P-F Product feature CHAIN HM585200_HBc_P-F of FT:mat_peptide HM585200_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM590471_HBc_P-F Product feature CHAIN HM590471_HBc_P-F of FT:mat_peptide HM590471_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM590472_HBc_P-F Product feature CHAIN HM590472_HBc_P-F of FT:mat_peptide HM590472_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM590473_HBc_P-F Product feature CHAIN HM590473_HBc_P-F of FT:mat_peptide HM590473_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM590474_HBc_P-F Product feature CHAIN HM590474_HBc_P-F of FT:mat_peptide HM590474_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH3). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM622135_HBc_P-F Product feature CHAIN HM622135_HBc_P-F of FT:mat_peptide HM622135_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM627320_HBc_P-F Product feature CHAIN HM627320_HBc_P-F of FT:mat_peptide HM627320_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQXILCWGELMTLASWVGNNLDDPA
ARDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HQ378247_HBc_P-F Product feature CHAIN HQ378247_HBc_P-F of FT:mat_peptide HQ378247_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate IRL-2009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HQ420165_HBc_P-F Product feature CHAIN HQ420165_HBc_P-F of FT:mat_peptide HQ420165_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4Mg). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HQ420166_HBc_P-F Product feature CHAIN HQ420166_HBc_P-F of FT:mat_peptide HQ420166_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5Mg). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JF439884_HBc_P-F Product feature CHAIN JF439884_HBc_P-F of FT:mat_peptide JF439884_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate ANG03G1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JF439885_HBc_P-F Product feature CHAIN JF439885_HBc_P-F of FT:mat_peptide JF439885_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate ANG03G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN688691_HBc_P-F Product feature CHAIN JN688691_HBc_P-F of FT:mat_peptide JN688691_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV122). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN688699_HBc_P-F Product feature CHAIN JN688699_HBc_P-F of FT:mat_peptide JN688699_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV133). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPXRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN688701_HBc_P-F Product feature CHAIN JN688701_HBc_P-F of FT:mat_peptide JN688701_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV135). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRXALESPEHCTHXHTALRQAILCWGELMNLASWVGNNLDDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN688703_HBc_P-F Product feature CHAIN JN688703_HBc_P-F of FT:mat_peptide JN688703_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV137). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN688709_HBc_P-F Product feature CHAIN JN688709_HBc_P-F of FT:mat_peptide JN688709_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV143). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELXSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAIVCWGEVXTXASWVGHNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCXXFGRDTVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|JN688720_HBc_P-F Product feature CHAIN JN688720_HBc_P-F of FT:mat_peptide JN688720_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV224). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTAXALYRDALESPEHCTPHHTAIRQAVLCWNELMTFASWVGNNLEDPA
ARDLVVNYVNINMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN792914_HBc_P-F Product feature CHAIN JN792914_HBc_P-F of FT:mat_peptide JN792914_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8052-03506). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN792916_HBc_P-F Product feature CHAIN JN792916_HBc_P-F of FT:mat_peptide JN792916_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7703-00047). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHLSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PTPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN792917_HBc_P-F Product feature CHAIN JN792917_HBc_P-F of FT:mat_peptide JN792917_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8070-05260). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLQDPA
ARDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN792918_HBc_P-F Product feature CHAIN JN792918_HBc_P-F of FT:mat_peptide JN792918_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8070-03547). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTHHHTALRQAILCWGELMTLASWVGNNLDDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN792919_HBc_P-F Product feature CHAIN JN792919_HBc_P-F of FT:mat_peptide JN792919_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8327-13282). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMIFASWVGNNLEDPA
ARDLVVNYVNINMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN792920_HBc_P-F Product feature CHAIN JN792920_HBc_P-F of FT:mat_peptide JN792920_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8327-05424). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPG
ARDLVVNYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXXYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN792921_HBc_P-F Product feature CHAIN JN792921_HBc_P-F of FT:mat_peptide JN792921_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9401-03738). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAXLCWGELMTLASWVGNNLEDPX
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|JN792922_HBc_P-F Product feature CHAIN JN792922_HBc_P-F of FT:mat_peptide JN792922_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9401-03301). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN811655_HBc_P-F Product feature CHAIN JN811655_HBc_P-F of FT:mat_peptide JN811655_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3Mg). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JN811656_HBc_P-F Product feature CHAIN JN811656_HBc_P-F of FT:mat_peptide JN811656_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4Mg). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JQ272888_HBc_P-F Product feature CHAIN JQ272888_HBc_P-F of FT:mat_peptide JQ272888_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTAIRQAILCWGELMVFASWVGNNLQDAA
ARDLVVDYVNTHMGLKIRHLLWFHLSCLMFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPSSRC
>gnl|hbvpro|JX079936_HBc_P-F Product feature CHAIN JX079936_HBc_P-F of FT:mat_peptide JX079936_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FF2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPPSHC
>gnl|hbvpro|JX079937_HBc_P-F Product feature CHAIN JX079937_HBc_P-F of FT:mat_peptide JX079937_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FF5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSXRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX899376_HBc_P-F Product feature CHAIN JX899376_HBc_P-F of FT:mat_peptide JX899376_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBcMX-115). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPPDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494394_HBc_P-F Product feature CHAIN KC494394_HBc_P-F of FT:mat_peptide KC494394_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR12-NORTH). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISSLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494395_HBc_P-F Product feature CHAIN KC494395_HBc_P-F of FT:mat_peptide KC494395_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR11-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494396_HBc_P-F Product feature CHAIN KC494396_HBc_P-F of FT:mat_peptide KC494396_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR10-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLDDPG
ARDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494397_HBc_P-F Product feature CHAIN KC494397_HBc_P-F of FT:mat_peptide KC494397_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR9-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494398_HBc_P-F Product feature CHAIN KC494398_HBc_P-F of FT:mat_peptide KC494398_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR8-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494399_HBc_P-F Product feature CHAIN KC494399_HBc_P-F of FT:mat_peptide KC494399_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR7-CENTRAL). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLIDTASALYRDALESPEHCSPHHTALRQAVGCWGEVSTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494400_HBc_P-F Product feature CHAIN KC494400_HBc_P-F of FT:mat_peptide KC494400_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR6-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVKYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRSSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494401_HBc_P-F Product feature CHAIN KC494401_HBc_P-F of FT:mat_peptide KC494401_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR5-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRPGRSPRKRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494402_HBc_P-F Product feature CHAIN KC494402_HBc_P-F of FT:mat_peptide KC494402_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR4-NORTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494403_HBc_P-F Product feature CHAIN KC494403_HBc_P-F of FT:mat_peptide KC494403_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR3-NORTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC494404_HBc_P-F Product feature CHAIN KC494404_HBc_P-F of FT:mat_peptide KC494404_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR2-NORTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSPASQC
>gnl|hbvpro|KC494405_HBc_P-F Product feature CHAIN KC494405_HBc_P-F of FT:mat_peptide KC494405_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR1-NORTHEAST). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF199901_HBc_P-F Product feature CHAIN KF199901_HBc_P-F of FT:mat_peptide KF199901_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RVLA). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF779236_HBc_P-F Product feature CHAIN KF779236_HBc_P-F of FT:mat_peptide KF779236_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate DEN6107). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ586805_HBc_P-F Product feature CHAIN KJ586805_HBc_P-F of FT:mat_peptide KJ586805_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTAFRQAILCWGELMTLASWGGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLGFHISSLTFGRETVLEYLVFFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ586806_HBc_P-F Product feature CHAIN KJ586806_HBc_P-F of FT:mat_peptide KJ586806_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ586807_HBc_P-F Product feature CHAIN KJ586807_HBc_P-F of FT:mat_peptide KJ586807_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ586808_HBc_P-F Product feature CHAIN KJ586808_HBc_P-F of FT:mat_peptide KJ586808_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ638656_HBc_P-F Product feature CHAIN KJ638656_HBc_P-F of FT:mat_peptide KJ638656_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTAIRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ638657_HBc_P-F Product feature CHAIN KJ638657_HBc_P-F of FT:mat_peptide KJ638657_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT013). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPXHTALRQAILCWGELMTXASWVGNNLEDPX
ARBLVVBYVNXNMGLKIRXLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ638659_HBc_P-F Product feature CHAIN KJ638659_HBc_P-F of FT:mat_peptide KJ638659_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT025). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWTEVMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ638660_HBc_P-F Product feature CHAIN KJ638660_HBc_P-F of FT:mat_peptide KJ638660_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT030). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPXDFFPSXRDLIDTASALYRDALESPEHCTPNHTALRQAIVCWGEVMTLAAWVGHNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEXLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRSRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ638662_HBc_P-F Product feature CHAIN KJ638662_HBc_P-F of FT:mat_peptide KJ638662_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT040). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQXILCWGELTNLGSWVGNNLEDXA
ARDXVVNYVNTNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ638663_HBc_P-F Product feature CHAIN KJ638663_HBc_P-F of FT:mat_peptide KJ638663_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT047). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLXTASALYRDALESPEHCTPHHTALRQAVLCWTEVMTLATWVGHNLDDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLNYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSPDSRC
>gnl|hbvpro|KJ638664_HBc_P-F Product feature CHAIN KJ638664_HBc_P-F of FT:mat_peptide KJ638664_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT049). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASEELLSFLPLDFFPSARDLLDTASALYRDALESPEHCTPHHTALRQAILCWNEVTTLASWVGNNLEDPA
ARDQVVNYVNTNMGLKIRQLLWFHISCLTFGRTTVLEYLVSFGVWIRTPPAYRPANAPILSTLPETRVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ676694_HBc_P-F Product feature CHAIN KJ676694_HBc_P-F of FT:mat_peptide KJ676694_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4_03). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFYPSVRDLIDTASALYRDALESPEHCTPHHTALRQAILCWTEVMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|KJ843163_HBc_P-F Product feature CHAIN KJ843163_HBc_P-F of FT:mat_peptide KJ843163_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag01). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843164_HBc_P-F Product feature CHAIN KJ843164_HBc_P-F of FT:mat_peptide KJ843164_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag02). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843167_HBc_P-F Product feature CHAIN KJ843167_HBc_P-F of FT:mat_peptide KJ843167_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag05). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILGWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSLGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843168_HBc_P-F Product feature CHAIN KJ843168_HBc_P-F of FT:mat_peptide KJ843168_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag06). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843169_HBc_P-F Product feature CHAIN KJ843169_HBc_P-F of FT:mat_peptide KJ843169_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag07). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843170_HBc_P-F Product feature CHAIN KJ843170_HBc_P-F of FT:mat_peptide KJ843170_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag08). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843171_HBc_P-F Product feature CHAIN KJ843171_HBc_P-F of FT:mat_peptide KJ843171_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag09). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843174_HBc_P-F Product feature CHAIN KJ843174_HBc_P-F of FT:mat_peptide KJ843174_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843175_HBc_P-F Product feature CHAIN KJ843175_HBc_P-F of FT:mat_peptide KJ843175_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843176_HBc_P-F Product feature CHAIN KJ843176_HBc_P-F of FT:mat_peptide KJ843176_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843177_HBc_P-F Product feature CHAIN KJ843177_HBc_P-F of FT:mat_peptide KJ843177_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843178_HBc_P-F Product feature CHAIN KJ843178_HBc_P-F of FT:mat_peptide KJ843178_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843179_HBc_P-F Product feature CHAIN KJ843179_HBc_P-F of FT:mat_peptide KJ843179_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843180_HBc_P-F Product feature CHAIN KJ843180_HBc_P-F of FT:mat_peptide KJ843180_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843181_HBc_P-F Product feature CHAIN KJ843181_HBc_P-F of FT:mat_peptide KJ843181_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843185_HBc_P-F Product feature CHAIN KJ843185_HBc_P-F of FT:mat_peptide KJ843185_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843189_HBc_P-F Product feature CHAIN KJ843189_HBc_P-F of FT:mat_peptide KJ843189_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843190_HBc_P-F Product feature CHAIN KJ843190_HBc_P-F of FT:mat_peptide KJ843190_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843191_HBc_P-F Product feature CHAIN KJ843191_HBc_P-F of FT:mat_peptide KJ843191_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRXRRSQSPRRRXSQSPASQC
>gnl|hbvpro|KJ843193_HBc_P-F Product feature CHAIN KJ843193_HBc_P-F of FT:mat_peptide KJ843193_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843194_HBc_P-F Product feature CHAIN KJ843194_HBc_P-F of FT:mat_peptide KJ843194_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843195_HBc_P-F Product feature CHAIN KJ843195_HBc_P-F of FT:mat_peptide KJ843195_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASLELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWSEVMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843196_HBc_P-F Product feature CHAIN KJ843196_HBc_P-F of FT:mat_peptide KJ843196_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843197_HBc_P-F Product feature CHAIN KJ843197_HBc_P-F of FT:mat_peptide KJ843197_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843198_HBc_P-F Product feature CHAIN KJ843198_HBc_P-F of FT:mat_peptide KJ843198_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASPLYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843199_HBc_P-F Product feature CHAIN KJ843199_HBc_P-F of FT:mat_peptide KJ843199_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843200_HBc_P-F Product feature CHAIN KJ843200_HBc_P-F of FT:mat_peptide KJ843200_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843201_HBc_P-F Product feature CHAIN KJ843201_HBc_P-F of FT:mat_peptide KJ843201_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843202_HBc_P-F Product feature CHAIN KJ843202_HBc_P-F of FT:mat_peptide KJ843202_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843203_HBc_P-F Product feature CHAIN KJ843203_HBc_P-F of FT:mat_peptide KJ843203_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843204_HBc_P-F Product feature CHAIN KJ843204_HBc_P-F of FT:mat_peptide KJ843204_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843205_HBc_P-F Product feature CHAIN KJ843205_HBc_P-F of FT:mat_peptide KJ843205_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843206_HBc_P-F Product feature CHAIN KJ843206_HBc_P-F of FT:mat_peptide KJ843206_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843207_HBc_P-F Product feature CHAIN KJ843207_HBc_P-F of FT:mat_peptide KJ843207_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843208_HBc_P-F Product feature CHAIN KJ843208_HBc_P-F of FT:mat_peptide KJ843208_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843209_HBc_P-F Product feature CHAIN KJ843209_HBc_P-F of FT:mat_peptide KJ843209_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag49). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843210_HBc_P-F Product feature CHAIN KJ843210_HBc_P-F of FT:mat_peptide KJ843210_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRRPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843211_HBc_P-F Product feature CHAIN KJ843211_HBc_P-F of FT:mat_peptide KJ843211_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843212_HBc_P-F Product feature CHAIN KJ843212_HBc_P-F of FT:mat_peptide KJ843212_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag52). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843213_HBc_P-F Product feature CHAIN KJ843213_HBc_P-F of FT:mat_peptide KJ843213_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843219_HBc_P-F Product feature CHAIN KJ843219_HBc_P-F of FT:mat_peptide KJ843219_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr01). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843220_HBc_P-F Product feature CHAIN KJ843220_HBc_P-F of FT:mat_peptide KJ843220_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr03). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843221_HBc_P-F Product feature CHAIN KJ843221_HBc_P-F of FT:mat_peptide KJ843221_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr04). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843222_HBc_P-F Product feature CHAIN KJ843222_HBc_P-F of FT:mat_peptide KJ843222_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr05). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843223_HBc_P-F Product feature CHAIN KJ843223_HBc_P-F of FT:mat_peptide KJ843223_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr06). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843224_HBc_P-F Product feature CHAIN KJ843224_HBc_P-F of FT:mat_peptide KJ843224_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr07). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KJ843225_HBc_P-F Product feature CHAIN KJ843225_HBc_P-F of FT:mat_peptide KJ843225_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr08). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|KJ843226_HBc_P-F Product feature CHAIN KJ843226_HBc_P-F of FT:mat_peptide KJ843226_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr09). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KM233681_HBc_P-F Product feature CHAIN KM233681_HBc_P-F of FT:mat_peptide KM233681_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KM998715_HBc_P-F Product feature CHAIN KM998715_HBc_P-F of FT:mat_peptide KM998715_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP718103_HBc_P-F Product feature CHAIN KP718103_HBc_P-F of FT:mat_peptide KP718103_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PA-01-1214). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP718104_HBc_P-F Product feature CHAIN KP718104_HBc_P-F of FT:mat_peptide KP718104_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CL0004). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPAPQC
>gnl|hbvpro|KP718106_HBc_P-F Product feature CHAIN KP718106_HBc_P-F of FT:mat_peptide KP718106_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PA-01-1650). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDXYKEFGASXELLSFLPSDFFPSXRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGXNLEBPA
ARDLXXNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIXTPPAYXPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASXC
>gnl|hbvpro|KP718107_HBc_P-F Product feature CHAIN KP718107_HBc_P-F of FT:mat_peptide KP718107_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT097). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGXNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP718109_HBc_P-F Product feature CHAIN KP718109_HBc_P-F of FT:mat_peptide KP718109_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7555_HIV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYCPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP718110_HBc_P-F Product feature CHAIN KP718110_HBc_P-F of FT:mat_peptide KP718110_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8728_HIV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFRDALESPEHCSHHHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCIIFGRDIVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP718111_HBc_P-F Product feature CHAIN KP718111_HBc_P-F of FT:mat_peptide KP718111_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8827_HIV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP718112_HBc_P-F Product feature CHAIN KP718112_HBc_P-F of FT:mat_peptide KP718112_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GP10-4910). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP718113_HBc_P-F Product feature CHAIN KP718113_HBc_P-F of FT:mat_peptide KP718113_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GP10-3634). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPAPQC
>gnl|hbvpro|KP995091_HBc_P-F Product feature CHAIN KP995091_HBc_P-F of FT:mat_peptide KP995091_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 54-Chronic). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995095_HBc_P-F Product feature CHAIN KP995095_HBc_P-F of FT:mat_peptide KP995095_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 465-Cirrhosis). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAIVCWGEVMTLASWVGNHLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995096_HBc_P-F Product feature CHAIN KP995096_HBc_P-F of FT:mat_peptide KP995096_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2515-Chronic). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTAFRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995097_HBc_P-F Product feature CHAIN KP995097_HBc_P-F of FT:mat_peptide KP995097_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSARDLFDTASALYRDALESPEHCTPHHTALRQAILCWGELTTLASWVGNNLDDAA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVVQYLVSFGVWIRTPPAYRPPNAPILSMLPEVAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995098_HBc_P-F Product feature CHAIN KP995098_HBc_P-F of FT:mat_peptide KP995098_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995101_HBc_P-F Product feature CHAIN KP995101_HBc_P-F of FT:mat_peptide KP995101_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 63-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTAIRQIILCWGELMSLASWVGNNLEDPA
ARDLVVNYVNNNMGLKIRQMLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRGRAPRRRT
PSPRRRRSQSPRGRRSQSPSSRC
>gnl|hbvpro|KP995104_HBc_P-F Product feature CHAIN KP995104_HBc_P-F of FT:mat_peptide KP995104_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 81-Cirrhosis). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995105_HBc_P-F Product feature CHAIN KP995105_HBc_P-F of FT:mat_peptide KP995105_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 134-Cirrhosis). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRQALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995106_HBc_P-F Product feature CHAIN KP995106_HBc_P-F of FT:mat_peptide KP995106_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 143-Cirrhosis). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQMLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995107_HBc_P-F Product feature CHAIN KP995107_HBc_P-F of FT:mat_peptide KP995107_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 201-HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995109_HBc_P-F Product feature CHAIN KP995109_HBc_P-F of FT:mat_peptide KP995109_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 209-Cirrhosis). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAIVCWGEVMTLASWVGHNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995110_HBc_P-F Product feature CHAIN KP995110_HBc_P-F of FT:mat_peptide KP995110_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 231-HCC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995111_HBc_P-F Product feature CHAIN KP995111_HBc_P-F of FT:mat_peptide KP995111_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 234-Cirrhosis). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPIDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQTVLCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|KP995113_HBc_P-F Product feature CHAIN KP995113_HBc_P-F of FT:mat_peptide KP995113_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2351-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSVRDLIDTASALYRDALESPEHCTPNHTAIRQVLLCWNELMTFASWVGENLDDPA
ARNSVVNYVNTNMGLKIRQLLWFHISCLTFGTQTVVEYLVSFGVWIRTPLPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995114_HBc_P-F Product feature CHAIN KP995114_HBc_P-F of FT:mat_peptide KP995114_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2369-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALHRDALESPEHCSPHHTAIRQAVSCWGELITLASWVGNNLDDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRQVVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995115_HBc_P-F Product feature CHAIN KP995115_HBc_P-F of FT:mat_peptide KP995115_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2370-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWDELMIFASWVGNNLDDPA
SRDLVVNYVNINMGLKIRRLLWFHISCIMFGRDLVLEYLVSFGVWIRTPPNYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPSSRC
>gnl|hbvpro|KP995116_HBc_P-F Product feature CHAIN KP995116_HBc_P-F of FT:mat_peptide KP995116_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2503-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995117_HBc_P-F Product feature CHAIN KP995117_HBc_P-F of FT:mat_peptide KP995117_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2504-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995118_HBc_P-F Product feature CHAIN KP995118_HBc_P-F of FT:mat_peptide KP995118_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2517-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995119_HBc_P-F Product feature CHAIN KP995119_HBc_P-F of FT:mat_peptide KP995119_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2524-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995120_HBc_P-F Product feature CHAIN KP995120_HBc_P-F of FT:mat_peptide KP995120_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2579-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995123_HBc_P-F Product feature CHAIN KP995123_HBc_P-F of FT:mat_peptide KP995123_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X10-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995124_HBc_P-F Product feature CHAIN KP995124_HBc_P-F of FT:mat_peptide KP995124_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X11-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995125_HBc_P-F Product feature CHAIN KP995125_HBc_P-F of FT:mat_peptide KP995125_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X13-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP995126_HBc_P-F Product feature CHAIN KP995126_HBc_P-F of FT:mat_peptide KP995126_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X14-Chronic). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KT896494_HBc_P-F Product feature CHAIN KT896494_HBc_P-F of FT:mat_peptide KT896494_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MAN183). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRDALESPEHCTPHHTALRQAILCWVELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSPSSQC
>gnl|hbvpro|KX264496_HBc_P-F Product feature CHAIN KX264496_HBc_P-F of FT:mat_peptide KX264496_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1-ame). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KX264497_HBc_P-F Product feature CHAIN KX264497_HBc_P-F of FT:mat_peptide KX264497_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F2-ame). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KX264498_HBc_P-F Product feature CHAIN KX264498_HBc_P-F of FT:mat_peptide KX264498_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F3-ame). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KX264499_HBc_P-F Product feature CHAIN KX264499_HBc_P-F of FT:mat_peptide KX264499_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4-ame). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KX757665_HBc_P-F Product feature CHAIN KX757665_HBc_P-F of FT:mat_peptide KX757665_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate TH6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KX757672_HBc_P-F Product feature CHAIN KX757672_HBc_P-F of FT:mat_peptide KX757672_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate TH78). Partial genome (Contains: HBe, HBc, LHBs, MHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKGSQSPASQC
>gnl|hbvpro|KY382411_HBc_P-F Product feature CHAIN KY382411_HBc_P-F of FT:mat_peptide KY382411_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4_wt). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY382415_HBc_P-F Product feature CHAIN KY382415_HBc_P-F of FT:mat_peptide KY382415_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_wt). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLXVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY382416_HBc_P-F Product feature CHAIN KY382416_HBc_P-F of FT:mat_peptide KY382416_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_double_mut). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLXVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY382417_HBc_P-F Product feature CHAIN KY382417_HBc_P-F of FT:mat_peptide KY382417_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_quadruple_mut). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLXVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY458061_HBc_P-F Product feature CHAIN KY458061_HBc_P-F of FT:mat_peptide KY458061_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY458062_HBc_P-F Product feature CHAIN KY458062_HBc_P-F of FT:mat_peptide KY458062_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY476322_HBc_P-F Product feature CHAIN KY476322_HBc_P-F of FT:mat_peptide KY476322_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV01). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY476323_HBc_P-F Product feature CHAIN KY476323_HBc_P-F of FT:mat_peptide KY476323_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV03). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY476324_HBc_P-F Product feature CHAIN KY476324_HBc_P-F of FT:mat_peptide KY476324_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|KY476325_HBc_P-F Product feature CHAIN KY476325_HBc_P-F of FT:mat_peptide KY476325_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYRDALESPEHCTHHHTALRQAIVCWLEVTTLASWVGNNLDDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY476326_HBc_P-F Product feature CHAIN KY476326_HBc_P-F of FT:mat_peptide KY476326_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVRGRGXSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY476327_HBc_P-F Product feature CHAIN KY476327_HBc_P-F of FT:mat_peptide KY476327_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPLDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY476328_HBc_P-F Product feature CHAIN KY476328_HBc_P-F of FT:mat_peptide KY476328_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTAAALYRDALESSEHCTHHHTALRQAILCWGEVMNLASWVGNNLQDPA
ARDLVVNYVNTHMGLKIRQLLWFHVSCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVXRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY476329_HBc_P-F Product feature CHAIN KY476329_HBc_P-F of FT:mat_peptide KY476329_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPNHTALRQAILCWNEVTEFGNWVGNNLEDPA
ARDLVVDYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEATVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|KY476330_HBc_P-F Product feature CHAIN KY476330_HBc_P-F of FT:mat_peptide KY476330_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEYGASAELLSFLPTDFYPSVRDLLDTAQALFRDALESPEHCTPHHTALRHVILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTHMGLKIRQLLWFHTSCLTFGREVVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPGSRC
>gnl|hbvpro|KY476331_HBc_P-F Product feature CHAIN KY476331_HBc_P-F of FT:mat_peptide KY476331_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY476332_HBc_P-F Product feature CHAIN KY476332_HBc_P-F of FT:mat_peptide KY476332_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH051986_HBc_P-F Product feature CHAIN MH051986_HBc_P-F of FT:mat_peptide MH051986_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B106W). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH051987_HBc_P-F Product feature CHAIN MH051987_HBc_P-F of FT:mat_peptide MH051987_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B127W). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPGGRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MK058437_HBc_P-F Product feature CHAIN MK058437_HBc_P-F of FT:mat_peptide MK058437_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|X69798_HBc_P-F Product feature CHAIN X69798_HBc_P-F of FT:mat_peptide X69798_HBc_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|X75658_HBc_C-F Product feature CHAIN X75658_HBc_C-F of FT:mat_peptide X75658_HBc_C-F of [Viruses] Hepatitis B Virus genotype F (isolate Fou). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELFSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|X75663_HBc_P-F Product feature CHAIN X75663_HBc_P-F of FT:mat_peptide X75663_HBc_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9203). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELFSFLASDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
© 1998-2019