HBVdb

Dataset for protein HBx of genotype F

[Download (right click)] [Alignment] [Repertoires]

374 sequence(s)

>gnl|hbvpro|AB036905_HBx_P-F Product feature CHAIN AB036905_HBx_P-F of FT:mat_peptide AB036905_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8248-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036906_HBx_P-F Product feature CHAIN AB036906_HBx_P-F of FT:mat_peptide AB036906_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8248-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036907_HBx_P-F Product feature CHAIN AB036907_HBx_P-F of FT:mat_peptide AB036907_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8339-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036908_HBx_P-F Product feature CHAIN AB036908_HBx_P-F of FT:mat_peptide AB036908_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8337). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036909_HBx_P-F Product feature CHAIN AB036909_HBx_P-F of FT:mat_peptide AB036909_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8339-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036910_HBx_P-F Product feature CHAIN AB036910_HBx_P-F of FT:mat_peptide AB036910_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8251). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036911_HBx_P-F Product feature CHAIN AB036911_HBx_P-F of FT:mat_peptide AB036911_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8255). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036912_HBx_P-F Product feature CHAIN AB036912_HBx_P-F of FT:mat_peptide AB036912_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8323). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036913_HBx_P-F Product feature CHAIN AB036913_HBx_P-F of FT:mat_peptide AB036913_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8346). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036914_HBx_P-F Product feature CHAIN AB036914_HBx_P-F of FT:mat_peptide AB036914_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8349). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036915_HBx_P-F Product feature CHAIN AB036915_HBx_P-F of FT:mat_peptide AB036915_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8351). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036916_HBx_P-F Product feature CHAIN AB036916_HBx_P-F of FT:mat_peptide AB036916_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8371). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036917_HBx_P-F Product feature CHAIN AB036917_HBx_P-F of FT:mat_peptide AB036917_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8375-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036918_HBx_P-F Product feature CHAIN AB036918_HBx_P-F of FT:mat_peptide AB036918_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8375-2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036919_HBx_P-F Product feature CHAIN AB036919_HBx_P-F of FT:mat_peptide AB036919_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8381). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB036920_HBx_P-F Product feature CHAIN AB036920_HBx_P-F of FT:mat_peptide AB036920_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8624). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB064316_HBx_P-F Product feature CHAIN AB064316_HBx_P-F of FT:mat_peptide AB064316_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB086397_HBx_P-F Product feature CHAIN AB086397_HBx_P-F of FT:mat_peptide AB086397_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate JPF1130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB116549_HBx_P-F Product feature CHAIN AB116549_HBx_P-F of FT:mat_peptide AB116549_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB116550_HBx_P-F Product feature CHAIN AB116550_HBx_P-F of FT:mat_peptide AB116550_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB116551_HBx_P-F Product feature CHAIN AB116551_HBx_P-F of FT:mat_peptide AB116551_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB116552_HBx_P-F Product feature CHAIN AB116552_HBx_P-F of FT:mat_peptide AB116552_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB116654_HBx_P-F Product feature CHAIN AB116654_HBx_P-F of FT:mat_peptide AB116654_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPSSPSAVPADDGSYLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB166850_HBx_P-F Product feature CHAIN AB166850_HBx_P-F of FT:mat_peptide AB166850_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV-BL592). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPIVLHNRTIGLSGRSMTWIEEYIKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB214516_HBx_P-F Product feature CHAIN AB214516_HBx_P-F of FT:mat_peptide AB214516_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV-BL597). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLACCSFSCAASCALRFTSARRME
TTVNARQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB365446_HBx_P-F Product feature CHAIN AB365446_HBx_P-F of FT:mat_peptide AB365446_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRLE
TTVNAPWSLPIVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPVNFFTSA
>gnl|hbvpro|AB365449_HBx_P-F Product feature CHAIN AB365449_HBx_P-F of FT:mat_peptide AB365449_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB365450_HBx_P-F Product feature CHAIN AB365450_HBx_P-F of FT:mat_peptide AB365450_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTXLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223962_HBx_P-F Product feature CHAIN AF223962_HBx_P-F of FT:mat_peptide AF223962_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223963_HBx_P-F Product feature CHAIN AF223963_HBx_P-F of FT:mat_peptide AF223963_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223964_HBx_P-F Product feature CHAIN AF223964_HBx_P-F of FT:mat_peptide AF223964_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223965_HBx_P-F Product feature CHAIN AF223965_HBx_P-F of FT:mat_peptide AF223965_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY090455_HBx_P-F Product feature CHAIN AY090455_HBx_P-F of FT:mat_peptide AY090455_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY090456_HBx_P-F Product feature CHAIN AY090456_HBx_P-F of FT:mat_peptide AY090456_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY090458_HBx_C-F Product feature CHAIN AY090458_HBx_C-F of FT:mat_peptide AY090458_HBx_C-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY090459_HBx_P-F Product feature CHAIN AY090459_HBx_P-F of FT:mat_peptide AY090459_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY090461_HBx_P-F Product feature CHAIN AY090461_HBx_P-F of FT:mat_peptide AY090461_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY179735_HBx_P-F Product feature CHAIN AY179735_HBx_P-F of FT:mat_peptide AY179735_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY311369_HBx_P-F Product feature CHAIN AY311369_HBx_P-F of FT:mat_peptide AY311369_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD4139). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSTVQAYDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY311370_HBx_P-F Product feature CHAIN AY311370_HBx_P-F of FT:mat_peptide AY311370_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD14999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629930_HBx_P-F Product feature CHAIN DQ629930_HBx_P-F of FT:mat_peptide DQ629930_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1321m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLGPPRDGLYLHPVGADSRGRSLSGSLGVVPHPSQSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629931_HBx_P-F Product feature CHAIN DQ629931_HBx_P-F of FT:mat_peptide DQ629931_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1430h). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629932_HBx_P-F Product feature CHAIN DQ629932_HBx_P-F of FT:mat_peptide DQ629932_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1481m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAAGMCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLNIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629933_HBx_P-F Product feature CHAIN DQ629933_HBx_P-F of FT:mat_peptide DQ629933_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1606h). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFNSA
>gnl|hbvpro|DQ629934_HBx_P-F Product feature CHAIN DQ629934_HBx_P-F of FT:mat_peptide DQ629934_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1628h). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPGSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLQVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629935_HBx_P-F Product feature CHAIN DQ629935_HBx_P-F of FT:mat_peptide DQ629935_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2028d). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQMDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFSTSA
>gnl|hbvpro|DQ629936_HBx_P-F Product feature CHAIN DQ629936_HBx_P-F of FT:mat_peptide DQ629936_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2584e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=152 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLRGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFT
>gnl|hbvpro|DQ629937_HBx_P-F Product feature CHAIN DQ629937_HBx_P-F of FT:mat_peptide DQ629937_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2589m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLYLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKNWEELGEEIRLKVFVLGGCRHKMVCSPAPCNFFTSP
>gnl|hbvpro|DQ629938_HBx_P-F Product feature CHAIN DQ629938_HBx_P-F of FT:mat_peptide DQ629938_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2737m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFPCA
>gnl|hbvpro|DQ629940_HBx_P-F Product feature CHAIN DQ629940_HBx_P-F of FT:mat_peptide DQ629940_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2833e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629941_HBx_P-F Product feature CHAIN DQ629941_HBx_P-F of FT:mat_peptide DQ629941_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2834e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVSPHLPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRSLGLSGWSMPWIEDYIKDCVFKDWEEVGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629943_HBx_P-F Product feature CHAIN DQ629943_HBx_P-F of FT:mat_peptide DQ629943_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEDIRLKVFVLGGCRHKLVCSPAPCHLFTSA
>gnl|hbvpro|DQ629944_HBx_P-F Product feature CHAIN DQ629944_HBx_P-F of FT:mat_peptide DQ629944_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3096e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRFLSGSLGVVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLLGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|DQ629945_HBx_P-F Product feature CHAIN DQ629945_HBx_P-F of FT:mat_peptide DQ629945_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3254h). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKGTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629946_HBx_P-F Product feature CHAIN DQ629946_HBx_P-F of FT:mat_peptide DQ629946_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3338m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAYPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTLSPPRGLPTVFHKRTLGLSGWSMPWIEEYIKDCVLRTWEELGEEIRVKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629947_HBx_P-F Product feature CHAIN DQ629947_HBx_P-F of FT:mat_peptide DQ629947_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3355h). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRLTSARRME
TTVNAPRSLPTVLHQRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCWHKLGCSPPPCNFFTPS
>gnl|hbvpro|DQ629948_HBx_P-F Product feature CHAIN DQ629948_HBx_P-F of FT:mat_peptide DQ629948_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3456h). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629949_HBx_P-F Product feature CHAIN DQ629949_HBx_P-F of FT:mat_peptide DQ629949_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 347h). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLTVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629950_HBx_P-F Product feature CHAIN DQ629950_HBx_P-F of FT:mat_peptide DQ629950_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3751m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629951_HBx_P-F Product feature CHAIN DQ629951_HBx_P-F of FT:mat_peptide DQ629951_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3826e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLNVFLLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|DQ629953_HBx_P-F Product feature CHAIN DQ629953_HBx_P-F of FT:mat_peptide DQ629953_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4026e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629954_HBx_P-F Product feature CHAIN DQ629954_HBx_P-F of FT:mat_peptide DQ629954_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4301e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|DQ629955_HBx_P-F Product feature CHAIN DQ629955_HBx_P-F of FT:mat_peptide DQ629955_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 445e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLNVFLLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|DQ629956_HBx_P-F Product feature CHAIN DQ629956_HBx_P-F of FT:mat_peptide DQ629956_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4539e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPGSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629958_HBx_P-F Product feature CHAIN DQ629958_HBx_P-F of FT:mat_peptide DQ629958_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4899m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTVGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629959_HBx_P-F Product feature CHAIN DQ629959_HBx_P-F of FT:mat_peptide DQ629959_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4902e). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALHFTSVGPLG
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629960_HBx_P-F Product feature CHAIN DQ629960_HBx_P-F of FT:mat_peptide DQ629960_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4904m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
ATVNAPRSLPTVLHKRTIGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629961_HBx_P-F Product feature CHAIN DQ629961_HBx_P-F of FT:mat_peptide DQ629961_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5251m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629962_HBx_P-F Product feature CHAIN DQ629962_HBx_P-F of FT:mat_peptide DQ629962_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5252m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629963_HBx_P-F Product feature CHAIN DQ629963_HBx_P-F of FT:mat_peptide DQ629963_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5399m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629964_HBx_P-F Product feature CHAIN DQ629964_HBx_P-F of FT:mat_peptide DQ629964_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5433m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629965_HBx_P-F Product feature CHAIN DQ629965_HBx_P-F of FT:mat_peptide DQ629965_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 551h). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGSCRHKLVCSTAPCNFFTSA
>gnl|hbvpro|DQ629966_HBx_P-F Product feature CHAIN DQ629966_HBx_P-F of FT:mat_peptide DQ629966_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 575h). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629967_HBx_P-F Product feature CHAIN DQ629967_HBx_P-F of FT:mat_peptide DQ629967_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5838m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPRPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRFKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629968_HBx_P-F Product feature CHAIN DQ629968_HBx_P-F of FT:mat_peptide DQ629968_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5840e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMISVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629969_HBx_P-F Product feature CHAIN DQ629969_HBx_P-F of FT:mat_peptide DQ629969_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6026e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFSSA
>gnl|hbvpro|DQ629971_HBx_P-F Product feature CHAIN DQ629971_HBx_P-F of FT:mat_peptide DQ629971_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6067m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629972_HBx_P-F Product feature CHAIN DQ629972_HBx_P-F of FT:mat_peptide DQ629972_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6151m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSG
>gnl|hbvpro|DQ629973_HBx_P-F Product feature CHAIN DQ629973_HBx_P-F of FT:mat_peptide DQ629973_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6194m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCMHMLACSPEPCNFFTSA
>gnl|hbvpro|DQ629974_HBx_P-F Product feature CHAIN DQ629974_HBx_P-F of FT:mat_peptide DQ629974_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6217m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629977_HBx_P-F Product feature CHAIN DQ629977_HBx_P-F of FT:mat_peptide DQ629977_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6400m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629978_HBx_P-F Product feature CHAIN DQ629978_HBx_P-F of FT:mat_peptide DQ629978_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6401m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEENRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629979_HBx_P-F Product feature CHAIN DQ629979_HBx_P-F of FT:mat_peptide DQ629979_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6403m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629981_HBx_P-F Product feature CHAIN DQ629981_HBx_P-F of FT:mat_peptide DQ629981_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6484m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVKLLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629985_HBx_P-F Product feature CHAIN DQ629985_HBx_P-F of FT:mat_peptide DQ629985_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6544m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTANAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEITLKIIDLGGCMDKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629986_HBx_P-F Product feature CHAIN DQ629986_HBx_P-F of FT:mat_peptide DQ629986_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6572m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPWSLPKVLHKRTVGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629987_HBx_P-F Product feature CHAIN DQ629987_HBx_P-F of FT:mat_peptide DQ629987_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6593m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629988_HBx_P-F Product feature CHAIN DQ629988_HBx_P-F of FT:mat_peptide DQ629988_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6604m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSTSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629989_HBx_P-F Product feature CHAIN DQ629989_HBx_P-F of FT:mat_peptide DQ629989_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6649m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCFQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629990_HBx_P-F Product feature CHAIN DQ629990_HBx_P-F of FT:mat_peptide DQ629990_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6653m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629991_HBx_P-F Product feature CHAIN DQ629991_HBx_P-F of FT:mat_peptide DQ629991_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6682m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFTDWEELGEEIRFKILVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629992_HBx_P-F Product feature CHAIN DQ629992_HBx_P-F of FT:mat_peptide DQ629992_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6760m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629993_HBx_P-F Product feature CHAIN DQ629993_HBx_P-F of FT:mat_peptide DQ629993_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6781m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRYTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKWVCSPAPCNFFTSA
>gnl|hbvpro|DQ629994_HBx_P-F Product feature CHAIN DQ629994_HBx_P-F of FT:mat_peptide DQ629994_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6825m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLNVFLLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|DQ629995_HBx_P-F Product feature CHAIN DQ629995_HBx_P-F of FT:mat_peptide DQ629995_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 6891m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629996_HBx_P-F Product feature CHAIN DQ629996_HBx_P-F of FT:mat_peptide DQ629996_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 865m). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSRSLGAVPPPLPSATPADDGSHLSLRGLPVFSFSSALPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEAMGEEIRLKVFVLGSCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ629997_HBx_P-F Product feature CHAIN DQ629997_HBx_P-F of FT:mat_peptide DQ629997_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 920e). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ776247_HBx_P-F Product feature CHAIN DQ776247_HBx_P-F of FT:mat_peptide DQ776247_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823086_HBx_P-F Product feature CHAIN DQ823086_HBx_P-F of FT:mat_peptide DQ823086_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823087_HBx_P-F Product feature CHAIN DQ823087_HBx_P-F of FT:mat_peptide DQ823087_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|DQ823088_HBx_P-F Product feature CHAIN DQ823088_HBx_P-F of FT:mat_peptide DQ823088_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTXGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823089_HBx_P-F Product feature CHAIN DQ823089_HBx_P-F of FT:mat_peptide DQ823089_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTXGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823090_HBx_P-F Product feature CHAIN DQ823090_HBx_P-F of FT:mat_peptide DQ823090_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823091_HBx_P-F Product feature CHAIN DQ823091_HBx_P-F of FT:mat_peptide DQ823091_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823092_HBx_P-F Product feature CHAIN DQ823092_HBx_P-F of FT:mat_peptide DQ823092_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823093_HBx_P-F Product feature CHAIN DQ823093_HBx_P-F of FT:mat_peptide DQ823093_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823094_HBx_P-F Product feature CHAIN DQ823094_HBx_P-F of FT:mat_peptide DQ823094_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ823095_HBx_P-F Product feature CHAIN DQ823095_HBx_P-F of FT:mat_peptide DQ823095_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ899142_HBx_P-F Product feature CHAIN DQ899142_HBx_P-F of FT:mat_peptide DQ899142_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Warao152). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCTFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWKELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ899143_HBx_P-F Product feature CHAIN DQ899143_HBx_P-F of FT:mat_peptide DQ899143_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Warao189). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ899144_HBx_P-F Product feature CHAIN DQ899144_HBx_P-F of FT:mat_peptide DQ899144_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGGSMTWIAEYIKDCVFKDWEELGEETKLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ899145_HBx_P-F Product feature CHAIN DQ899145_HBx_P-F of FT:mat_peptide DQ899145_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPLSLPTVLHKRTLGLSGGSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ899146_HBx_P-F Product feature CHAIN DQ899146_HBx_P-F of FT:mat_peptide DQ899146_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGGSMTWIAEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ899147_HBx_P-F Product feature CHAIN DQ899147_HBx_P-F of FT:mat_peptide DQ899147_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGGSMTWIAEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ899148_HBx_P-F Product feature CHAIN DQ899148_HBx_P-F of FT:mat_peptide DQ899148_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Yanomami114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNIFTSA
>gnl|hbvpro|DQ899149_HBx_P-F Product feature CHAIN DQ899149_HBx_P-F of FT:mat_peptide DQ899149_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Piaroa3019). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ899150_HBx_P-F Product feature CHAIN DQ899150_HBx_P-F of FT:mat_peptide DQ899150_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Colombia8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPWNFFTSA
>gnl|hbvpro|EF026745_HBx_P-F Product feature CHAIN EF026745_HBx_P-F of FT:mat_peptide EF026745_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR2). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF026746_HBx_P-F Product feature CHAIN EF026746_HBx_P-F of FT:mat_peptide EF026746_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR5). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|EF026747_HBx_P-F Product feature CHAIN EF026747_HBx_P-F of FT:mat_peptide EF026747_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH1). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTXGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF026748_HBx_P-F Product feature CHAIN EF026748_HBx_P-F of FT:mat_peptide EF026748_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH4). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTXGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF026749_HBx_P-F Product feature CHAIN EF026749_HBx_P-F of FT:mat_peptide EF026749_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH6). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF026750_HBx_P-F Product feature CHAIN EF026750_HBx_P-F of FT:mat_peptide EF026750_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH7). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF026751_HBx_P-F Product feature CHAIN EF026751_HBx_P-F of FT:mat_peptide EF026751_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH8). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF026752_HBx_P-F Product feature CHAIN EF026752_HBx_P-F of FT:mat_peptide EF026752_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH15). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF026753_HBx_P-F Product feature CHAIN EF026753_HBx_P-F of FT:mat_peptide EF026753_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA44). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF026754_HBx_P-F Product feature CHAIN EF026754_HBx_P-F of FT:mat_peptide EF026754_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA45). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF397982_HBx_P-F Product feature CHAIN EF397982_HBx_P-F of FT:mat_peptide EF397982_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bucaramanga 14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRYKLVCSPAPCNFFTSA
>gnl|hbvpro|EF576808_HBx_P-F Product feature CHAIN EF576808_HBx_P-F of FT:mat_peptide EF576808_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SAL7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF576812_HBx_P-F Product feature CHAIN EF576812_HBx_P-F of FT:mat_peptide EF576812_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SAL13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPSSASAVPANHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU366116_HBx_P-F Product feature CHAIN EU366116_HBx_P-F of FT:mat_peptide EU366116_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU366118_HBx_P-F Product feature CHAIN EU366118_HBx_P-F of FT:mat_peptide EU366118_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU366132_HBx_P-F Product feature CHAIN EU366132_HBx_P-F of FT:mat_peptide EU366132_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU366133_HBx_P-F Product feature CHAIN EU366133_HBx_P-F of FT:mat_peptide EU366133_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU670260_HBx_P-F Product feature CHAIN EU670260_HBx_P-F of FT:mat_peptide EU670260_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 453). Partial genome (Contains: HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU670261_HBx_P-F Product feature CHAIN EU670261_HBx_P-F of FT:mat_peptide EU670261_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 499). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU670262_HBx_P-F Product feature CHAIN EU670262_HBx_P-F of FT:mat_peptide EU670262_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 549). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ589065_HBx_P-F Product feature CHAIN FJ589065_HBx_P-F of FT:mat_peptide FJ589065_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_024). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSFGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAACFFFTSA
>gnl|hbvpro|FJ589066_HBx_P-F Product feature CHAIN FJ589066_HBx_P-F of FT:mat_peptide FJ589066_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_054). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSXXXXXFFTSA
>gnl|hbvpro|FJ589067_HBx_P-F Product feature CHAIN FJ589067_HBx_P-F of FT:mat_peptide FJ589067_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_083). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARHME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ657519_HBx_P-F Product feature CHAIN FJ657519_HBx_P-F of FT:mat_peptide FJ657519_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA110). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ657522_HBx_P-F Product feature CHAIN FJ657522_HBx_P-F of FT:mat_peptide FJ657522_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ657525_HBx_P-F Product feature CHAIN FJ657525_HBx_P-F of FT:mat_peptide FJ657525_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLAGRSMTWIEEYIKDCVFADWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ657528_HBx_P-F Product feature CHAIN FJ657528_HBx_P-F of FT:mat_peptide FJ657528_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ657529_HBx_P-F Product feature CHAIN FJ657529_HBx_P-F of FT:mat_peptide FJ657529_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709457_HBx_P-F Product feature CHAIN FJ709457_HBx_P-F of FT:mat_peptide FJ709457_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709458_HBx_P-F Product feature CHAIN FJ709458_HBx_P-F of FT:mat_peptide FJ709458_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709459_HBx_P-F Product feature CHAIN FJ709459_HBx_P-F of FT:mat_peptide FJ709459_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709460_HBx_P-F Product feature CHAIN FJ709460_HBx_P-F of FT:mat_peptide FJ709460_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709462_HBx_P-F Product feature CHAIN FJ709462_HBx_P-F of FT:mat_peptide FJ709462_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709463_HBx_P-F Product feature CHAIN FJ709463_HBx_P-F of FT:mat_peptide FJ709463_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709464_HBx_P-F Product feature CHAIN FJ709464_HBx_P-F of FT:mat_peptide FJ709464_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709465_HBx_P-F Product feature CHAIN FJ709465_HBx_P-F of FT:mat_peptide FJ709465_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ709494_HBx_P-F Product feature CHAIN FJ709494_HBx_P-F of FT:mat_peptide FJ709494_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HE981181_HBx_P-F Product feature CHAIN HE981181_HBx_P-F of FT:mat_peptide HE981181_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HE981182_HBx_P-F Product feature CHAIN HE981182_HBx_P-F of FT:mat_peptide HE981182_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HE981183_HBx_P-F Product feature CHAIN HE981183_HBx_P-F of FT:mat_peptide HE981183_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585186_HBx_P-F Product feature CHAIN HM585186_HBx_P-F of FT:mat_peptide HM585186_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585187_HBx_P-F Product feature CHAIN HM585187_HBx_P-F of FT:mat_peptide HM585187_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585188_HBx_P-F Product feature CHAIN HM585188_HBx_P-F of FT:mat_peptide HM585188_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585189_HBx_P-F Product feature CHAIN HM585189_HBx_P-F of FT:mat_peptide HM585189_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585190_HBx_P-F Product feature CHAIN HM585190_HBx_P-F of FT:mat_peptide HM585190_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585191_HBx_P-F Product feature CHAIN HM585191_HBx_P-F of FT:mat_peptide HM585191_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585192_HBx_P-F Product feature CHAIN HM585192_HBx_P-F of FT:mat_peptide HM585192_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585193_HBx_P-F Product feature CHAIN HM585193_HBx_P-F of FT:mat_peptide HM585193_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585194_HBx_P-F Product feature CHAIN HM585194_HBx_P-F of FT:mat_peptide HM585194_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585195_HBx_P-F Product feature CHAIN HM585195_HBx_P-F of FT:mat_peptide HM585195_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585196_HBx_P-F Product feature CHAIN HM585196_HBx_P-F of FT:mat_peptide HM585196_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585197_HBx_P-F Product feature CHAIN HM585197_HBx_P-F of FT:mat_peptide HM585197_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585198_HBx_P-F Product feature CHAIN HM585198_HBx_P-F of FT:mat_peptide HM585198_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585199_HBx_P-F Product feature CHAIN HM585199_HBx_P-F of FT:mat_peptide HM585199_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM585200_HBx_P-F Product feature CHAIN HM585200_HBx_P-F of FT:mat_peptide HM585200_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM590471_HBx_P-F Product feature CHAIN HM590471_HBx_P-F of FT:mat_peptide HM590471_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM590472_HBx_P-F Product feature CHAIN HM590472_HBx_P-F of FT:mat_peptide HM590472_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM590473_HBx_P-F Product feature CHAIN HM590473_HBx_P-F of FT:mat_peptide HM590473_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM590474_HBx_P-F Product feature CHAIN HM590474_HBx_P-F of FT:mat_peptide HM590474_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAAWLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTALHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM622135_HBx_P-F Product feature CHAIN HM622135_HBx_P-F of FT:mat_peptide HM622135_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKAYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM627320_HBx_P-F Product feature CHAIN HM627320_HBx_P-F of FT:mat_peptide HM627320_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ378247_HBx_P-F Product feature CHAIN HQ378247_HBx_P-F of FT:mat_peptide HQ378247_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate IRL-2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911673_HBx_P-F Product feature CHAIN JF911673_HBx_P-F of FT:mat_peptide JF911673_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA66). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARSME
TPVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEEVGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911674_HBx_P-F Product feature CHAIN JF911674_HBx_P-F of FT:mat_peptide JF911674_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA67). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911675_HBx_P-F Product feature CHAIN JF911675_HBx_P-F of FT:mat_peptide JF911675_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA70). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911676_HBx_P-F Product feature CHAIN JF911676_HBx_P-F of FT:mat_peptide JF911676_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA71). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCKHKLGCSPTPCNFFTSA
>gnl|hbvpro|JF911677_HBx_P-F Product feature CHAIN JF911677_HBx_P-F of FT:mat_peptide JF911677_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA75). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911678_HBx_P-F Product feature CHAIN JF911678_HBx_P-F of FT:mat_peptide JF911678_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA55). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVLLLRGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911679_HBx_P-F Product feature CHAIN JF911679_HBx_P-F of FT:mat_peptide JF911679_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA61). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911680_HBx_P-F Product feature CHAIN JF911680_HBx_P-F of FT:mat_peptide JF911680_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA54). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911692_HBx_P-F Product feature CHAIN JF911692_HBx_P-F of FT:mat_peptide JF911692_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA68). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALYKRTIGLSGRSMTWIEEYIKDCVFTDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911693_HBx_P-F Product feature CHAIN JF911693_HBx_P-F of FT:mat_peptide JF911693_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA58). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLTPSSPSAVPSDNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF911694_HBx_P-F Product feature CHAIN JF911694_HBx_P-F of FT:mat_peptide JF911694_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA73). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEESRLKVFVLGGCRHKLVCSPAPCIFFTSA
>gnl|hbvpro|JF911695_HBx_P-F Product feature CHAIN JF911695_HBx_P-F of FT:mat_peptide JF911695_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA60). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MGARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPSDDGSHLSLRGLPICAFSPAGPCALRFTSARRME
TTVNAHWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JF911696_HBx_P-F Product feature CHAIN JF911696_HBx_P-F of FT:mat_peptide JF911696_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA69). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLYKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN688691_HBx_P-F Product feature CHAIN JN688691_HBx_P-F of FT:mat_peptide JN688691_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN688699_HBx_P-F Product feature CHAIN JN688699_HBx_P-F of FT:mat_peptide JN688699_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV133). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCXHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN688701_HBx_P-F Product feature CHAIN JN688701_HBx_P-F of FT:mat_peptide JN688701_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV135). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTTGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN688703_HBx_P-F Product feature CHAIN JN688703_HBx_P-F of FT:mat_peptide JN688703_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV137). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN688709_HBx_P-F Product feature CHAIN JN688709_HBx_P-F of FT:mat_peptide JN688709_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV143). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADXGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEXIRLKVFVLGGCXHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688720_HBx_P-F Product feature CHAIN JN688720_HBx_P-F of FT:mat_peptide JN688720_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV224). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSGRFMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792914_HBx_P-F Product feature CHAIN JN792914_HBx_P-F of FT:mat_peptide JN792914_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8052-03506). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTILHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792916_HBx_P-F Product feature CHAIN JN792916_HBx_P-F of FT:mat_peptide JN792916_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7703-00047). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792917_HBx_P-F Product feature CHAIN JN792917_HBx_P-F of FT:mat_peptide JN792917_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8070-05260). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792918_HBx_P-F Product feature CHAIN JN792918_HBx_P-F of FT:mat_peptide JN792918_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8070-03547). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVRAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALLFTSARLME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792919_HBx_P-F Product feature CHAIN JN792919_HBx_P-F of FT:mat_peptide JN792919_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8327-13282). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRTVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792920_HBx_P-F Product feature CHAIN JN792920_HBx_P-F of FT:mat_peptide JN792920_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8327-05424). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSLTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792922_HBx_P-F Product feature CHAIN JN792922_HBx_P-F of FT:mat_peptide JN792922_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9401-03301). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN811655_HBx_P-F Product feature CHAIN JN811655_HBx_P-F of FT:mat_peptide JN811655_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3Mg). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN811656_HBx_P-F Product feature CHAIN JN811656_HBx_P-F of FT:mat_peptide JN811656_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4Mg). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272888_HBx_P-F Product feature CHAIN JQ272888_HBx_P-F of FT:mat_peptide JQ272888_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHGSHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272889_HBx_P-F Product feature CHAIN JQ272889_HBx_P-F of FT:mat_peptide JQ272889_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ1). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272890_HBx_P-F Product feature CHAIN JQ272890_HBx_P-F of FT:mat_peptide JQ272890_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ2). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFPSARRME
TTVNAPRSLPTVLHKRTLGLSGRSIAWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272891_HBx_P-F Product feature CHAIN JQ272891_HBx_P-F of FT:mat_peptide JQ272891_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ3). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALLFISARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272892_HBx_P-F Product feature CHAIN JQ272892_HBx_P-F of FT:mat_peptide JQ272892_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ4). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272893_HBx_P-F Product feature CHAIN JQ272893_HBx_P-F of FT:mat_peptide JQ272893_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ6). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272894_HBx_P-F Product feature CHAIN JQ272894_HBx_P-F of FT:mat_peptide JQ272894_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ7). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAISPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272895_HBx_P-F Product feature CHAIN JQ272895_HBx_P-F of FT:mat_peptide JQ272895_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ8). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIGLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272898_HBx_P-F Product feature CHAIN JQ272898_HBx_P-F of FT:mat_peptide JQ272898_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ11). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272899_HBx_P-F Product feature CHAIN JQ272899_HBx_P-F of FT:mat_peptide JQ272899_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ12). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272900_HBx_P-F Product feature CHAIN JQ272900_HBx_P-F of FT:mat_peptide JQ272900_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ13). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSYLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAHWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCTFFTSA
>gnl|hbvpro|JQ272901_HBx_P-F Product feature CHAIN JQ272901_HBx_P-F of FT:mat_peptide JQ272901_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ14). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272904_HBx_P-F Product feature CHAIN JQ272904_HBx_P-F of FT:mat_peptide JQ272904_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ17). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272905_HBx_P-F Product feature CHAIN JQ272905_HBx_P-F of FT:mat_peptide JQ272905_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ18). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272906_HBx_P-F Product feature CHAIN JQ272906_HBx_P-F of FT:mat_peptide JQ272906_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ19). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272907_HBx_P-F Product feature CHAIN JQ272907_HBx_P-F of FT:mat_peptide JQ272907_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ20). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272908_HBx_P-F Product feature CHAIN JQ272908_HBx_P-F of FT:mat_peptide JQ272908_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ21). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272909_HBx_P-F Product feature CHAIN JQ272909_HBx_P-F of FT:mat_peptide JQ272909_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ22). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272910_HBx_P-F Product feature CHAIN JQ272910_HBx_P-F of FT:mat_peptide JQ272910_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ23). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272913_HBx_P-F Product feature CHAIN JQ272913_HBx_P-F of FT:mat_peptide JQ272913_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ27). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ272914_HBx_P-F Product feature CHAIN JQ272914_HBx_P-F of FT:mat_peptide JQ272914_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ28). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX079936_HBx_P-F Product feature CHAIN JX079936_HBx_P-F of FT:mat_peptide JX079936_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FF2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX079937_HBx_P-F Product feature CHAIN JX079937_HBx_P-F of FT:mat_peptide JX079937_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FF5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494394_HBx_P-F Product feature CHAIN KC494394_HBx_P-F of FT:mat_peptide KC494394_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR12-NORTH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPERDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSTAPCNFFTSA
>gnl|hbvpro|KC494395_HBx_P-F Product feature CHAIN KC494395_HBx_P-F of FT:mat_peptide KC494395_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR11-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494396_HBx_P-F Product feature CHAIN KC494396_HBx_P-F of FT:mat_peptide KC494396_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR10-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDTARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEESRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494397_HBx_P-F Product feature CHAIN KC494397_HBx_P-F of FT:mat_peptide KC494397_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR9-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494398_HBx_P-F Product feature CHAIN KC494398_HBx_P-F of FT:mat_peptide KC494398_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR8-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494399_HBx_P-F Product feature CHAIN KC494399_HBx_P-F of FT:mat_peptide KC494399_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR7-CENTRAL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAXWSLPTALHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494400_HBx_P-F Product feature CHAIN KC494400_HBx_P-F of FT:mat_peptide KC494400_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR6-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494401_HBx_P-F Product feature CHAIN KC494401_HBx_P-F of FT:mat_peptide KC494401_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR5-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFLLRGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494402_HBx_P-F Product feature CHAIN KC494402_HBx_P-F of FT:mat_peptide KC494402_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR4-NORTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494403_HBx_P-F Product feature CHAIN KC494403_HBx_P-F of FT:mat_peptide KC494403_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR3-NORTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494404_HBx_P-F Product feature CHAIN KC494404_HBx_P-F of FT:mat_peptide KC494404_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR2-NORTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC494405_HBx_P-F Product feature CHAIN KC494405_HBx_P-F of FT:mat_peptide KC494405_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR1-NORTHEAST). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCQPAPCTFFTSA
>gnl|hbvpro|KJ586805_HBx_P-F Product feature CHAIN KJ586805_HBx_P-F of FT:mat_peptide KJ586805_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ586806_HBx_P-F Product feature CHAIN KJ586806_HBx_P-F of FT:mat_peptide KJ586806_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ586807_HBx_P-F Product feature CHAIN KJ586807_HBx_P-F of FT:mat_peptide KJ586807_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ586808_HBx_P-F Product feature CHAIN KJ586808_HBx_P-F of FT:mat_peptide KJ586808_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ638656_HBx_P-F Product feature CHAIN KJ638656_HBx_P-F of FT:mat_peptide KJ638656_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYFKDCVFNDWEELGEEIWLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ638657_HBx_P-F Product feature CHAIN KJ638657_HBx_P-F of FT:mat_peptide KJ638657_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT013). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPABDGSPLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KJ638659_HBx_P-F Product feature CHAIN KJ638659_HBx_P-F of FT:mat_peptide KJ638659_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT025). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ638660_HBx_P-F Product feature CHAIN KJ638660_HBx_P-F of FT:mat_peptide KJ638660_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT030). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADDGSHLSFRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALHKRTLGLSGRSMTWIEDYIKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ638662_HBx_P-F Product feature CHAIN KJ638662_HBx_P-F of FT:mat_peptide KJ638662_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT040). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ638663_HBx_P-F Product feature CHAIN KJ638663_HBx_P-F of FT:mat_peptide KJ638663_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT047). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARHME
TTVNAPRSLPTVLYKRTLGLSGRSMTWIEGYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ638664_HBx_P-F Product feature CHAIN KJ638664_HBx_P-F of FT:mat_peptide KJ638664_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT049). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPPDDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ676694_HBx_P-F Product feature CHAIN KJ676694_HBx_P-F of FT:mat_peptide KJ676694_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4_03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPXBDGSHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHXSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVXXPVPCNFFTSA
>gnl|hbvpro|KJ843163_HBx_P-F Product feature CHAIN KJ843163_HBx_P-F of FT:mat_peptide KJ843163_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPASCNFFTSA
>gnl|hbvpro|KJ843164_HBx_P-F Product feature CHAIN KJ843164_HBx_P-F of FT:mat_peptide KJ843164_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843167_HBx_P-F Product feature CHAIN KJ843167_HBx_P-F of FT:mat_peptide KJ843167_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843168_HBx_P-F Product feature CHAIN KJ843168_HBx_P-F of FT:mat_peptide KJ843168_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag06). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843169_HBx_P-F Product feature CHAIN KJ843169_HBx_P-F of FT:mat_peptide KJ843169_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag07). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLYKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843170_HBx_P-F Product feature CHAIN KJ843170_HBx_P-F of FT:mat_peptide KJ843170_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843171_HBx_P-F Product feature CHAIN KJ843171_HBx_P-F of FT:mat_peptide KJ843171_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag09). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843174_HBx_P-F Product feature CHAIN KJ843174_HBx_P-F of FT:mat_peptide KJ843174_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843175_HBx_P-F Product feature CHAIN KJ843175_HBx_P-F of FT:mat_peptide KJ843175_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843176_HBx_P-F Product feature CHAIN KJ843176_HBx_P-F of FT:mat_peptide KJ843176_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843177_HBx_P-F Product feature CHAIN KJ843177_HBx_P-F of FT:mat_peptide KJ843177_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843178_HBx_P-F Product feature CHAIN KJ843178_HBx_P-F of FT:mat_peptide KJ843178_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843179_HBx_P-F Product feature CHAIN KJ843179_HBx_P-F of FT:mat_peptide KJ843179_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843180_HBx_P-F Product feature CHAIN KJ843180_HBx_P-F of FT:mat_peptide KJ843180_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843181_HBx_P-F Product feature CHAIN KJ843181_HBx_P-F of FT:mat_peptide KJ843181_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843185_HBx_P-F Product feature CHAIN KJ843185_HBx_P-F of FT:mat_peptide KJ843185_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRAKVFVLGGCRHKKVCSPAPCNFFTSA
>gnl|hbvpro|KJ843189_HBx_P-F Product feature CHAIN KJ843189_HBx_P-F of FT:mat_peptide KJ843189_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843190_HBx_P-F Product feature CHAIN KJ843190_HBx_P-F of FT:mat_peptide KJ843190_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843191_HBx_P-F Product feature CHAIN KJ843191_HBx_P-F of FT:mat_peptide KJ843191_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGFSGRSQTWIEEYIKDCVFKDWEELGXEIRLKVFVLGGCRXKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843193_HBx_P-F Product feature CHAIN KJ843193_HBx_P-F of FT:mat_peptide KJ843193_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843194_HBx_P-F Product feature CHAIN KJ843194_HBx_P-F of FT:mat_peptide KJ843194_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843195_HBx_P-F Product feature CHAIN KJ843195_HBx_P-F of FT:mat_peptide KJ843195_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843196_HBx_P-F Product feature CHAIN KJ843196_HBx_P-F of FT:mat_peptide KJ843196_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNTPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843197_HBx_P-F Product feature CHAIN KJ843197_HBx_P-F of FT:mat_peptide KJ843197_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843198_HBx_P-F Product feature CHAIN KJ843198_HBx_P-F of FT:mat_peptide KJ843198_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843199_HBx_P-F Product feature CHAIN KJ843199_HBx_P-F of FT:mat_peptide KJ843199_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNTPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843200_HBx_P-F Product feature CHAIN KJ843200_HBx_P-F of FT:mat_peptide KJ843200_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843201_HBx_P-F Product feature CHAIN KJ843201_HBx_P-F of FT:mat_peptide KJ843201_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRVITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843202_HBx_P-F Product feature CHAIN KJ843202_HBx_P-F of FT:mat_peptide KJ843202_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843203_HBx_P-F Product feature CHAIN KJ843203_HBx_P-F of FT:mat_peptide KJ843203_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843204_HBx_P-F Product feature CHAIN KJ843204_HBx_P-F of FT:mat_peptide KJ843204_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843205_HBx_P-F Product feature CHAIN KJ843205_HBx_P-F of FT:mat_peptide KJ843205_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843206_HBx_P-F Product feature CHAIN KJ843206_HBx_P-F of FT:mat_peptide KJ843206_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843207_HBx_P-F Product feature CHAIN KJ843207_HBx_P-F of FT:mat_peptide KJ843207_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843208_HBx_P-F Product feature CHAIN KJ843208_HBx_P-F of FT:mat_peptide KJ843208_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843209_HBx_P-F Product feature CHAIN KJ843209_HBx_P-F of FT:mat_peptide KJ843209_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843210_HBx_P-F Product feature CHAIN KJ843210_HBx_P-F of FT:mat_peptide KJ843210_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843211_HBx_P-F Product feature CHAIN KJ843211_HBx_P-F of FT:mat_peptide KJ843211_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843212_HBx_P-F Product feature CHAIN KJ843212_HBx_P-F of FT:mat_peptide KJ843212_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|KJ843213_HBx_P-F Product feature CHAIN KJ843213_HBx_P-F of FT:mat_peptide KJ843213_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843219_HBx_P-F Product feature CHAIN KJ843219_HBx_P-F of FT:mat_peptide KJ843219_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843220_HBx_P-F Product feature CHAIN KJ843220_HBx_P-F of FT:mat_peptide KJ843220_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVXGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843221_HBx_P-F Product feature CHAIN KJ843221_HBx_P-F of FT:mat_peptide KJ843221_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843222_HBx_P-F Product feature CHAIN KJ843222_HBx_P-F of FT:mat_peptide KJ843222_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843223_HBx_P-F Product feature CHAIN KJ843223_HBx_P-F of FT:mat_peptide KJ843223_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPPGGLPTSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHNRTIGLSGRSMTWIEEYIKDCVFXDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843224_HBx_P-F Product feature CHAIN KJ843224_HBx_P-F of FT:mat_peptide KJ843224_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr07). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843225_HBx_P-F Product feature CHAIN KJ843225_HBx_P-F of FT:mat_peptide KJ843225_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPWCLPTVLYNRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ843226_HBx_P-F Product feature CHAIN KJ843226_HBx_P-F of FT:mat_peptide KJ843226_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr09). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM233681_HBx_P-F Product feature CHAIN KM233681_HBx_P-F of FT:mat_peptide KM233681_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIKEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM659861_HBx_P-F Product feature CHAIN KM659861_HBx_P-F of FT:mat_peptide KM659861_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM998715_HBx_P-F Product feature CHAIN KM998715_HBx_P-F of FT:mat_peptide KM998715_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718103_HBx_P-F Product feature CHAIN KP718103_HBx_P-F of FT:mat_peptide KP718103_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PA-01-1214). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP718104_HBx_P-F Product feature CHAIN KP718104_HBx_P-F of FT:mat_peptide KP718104_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CL0004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP718106_HBx_P-F Product feature CHAIN KP718106_HBx_P-F of FT:mat_peptide KP718106_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PA-01-1650). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLXXFVLGGCRXKLVCSPAPCNFFTSA
>gnl|hbvpro|KP718107_HBx_P-F Product feature CHAIN KP718107_HBx_P-F of FT:mat_peptide KP718107_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT097). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSSSAVPADDGSHLSLRGLPVCSFSPAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|KP718109_HBx_P-F Product feature CHAIN KP718109_HBx_P-F of FT:mat_peptide KP718109_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7555_HIV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNGSYLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718110_HBx_P-F Product feature CHAIN KP718110_HBx_P-F of FT:mat_peptide KP718110_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8728_HIV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSYSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKIYVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP718111_HBx_P-F Product feature CHAIN KP718111_HBx_P-F of FT:mat_peptide KP718111_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8827_HIV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718112_HBx_P-F Product feature CHAIN KP718112_HBx_P-F of FT:mat_peptide KP718112_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GP10-4910). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNGSYLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEITLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718113_HBx_P-F Product feature CHAIN KP718113_HBx_P-F of FT:mat_peptide KP718113_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GP10-3634). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995097_HBx_P-F Product feature CHAIN KP995097_HBx_P-F of FT:mat_peptide KP995097_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGSLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALYKRTLGLSGGSMPWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|KP995098_HBx_P-F Product feature CHAIN KP995098_HBx_P-F of FT:mat_peptide KP995098_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995101_HBx_P-F Product feature CHAIN KP995101_HBx_P-F of FT:mat_peptide KP995101_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 63-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARHME
TTVNAPWNLPTVLHKRTLGLLGRSMTWIEDYIKDCVFKDWEELGEETRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995104_HBx_P-F Product feature CHAIN KP995104_HBx_P-F of FT:mat_peptide KP995104_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 81-Cirrhosis). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPFFPSTVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTALHKRTLGLSGWSMTRIDEYIKDCVFKDWEELGQESRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995105_HBx_P-F Product feature CHAIN KP995105_HBx_P-F of FT:mat_peptide KP995105_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 134-Cirrhosis). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRLE
TTVNTPWNLPTVLHKRTLGLSGRSMTRIEEYIKDCVFKDWEELGEEIRLMIFGLGGWRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995106_HBx_P-F Product feature CHAIN KP995106_HBx_P-F of FT:mat_peptide KP995106_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 143-Cirrhosis). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARHME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEETRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995107_HBx_P-F Product feature CHAIN KP995107_HBx_P-F of FT:mat_peptide KP995107_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 201-HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALYKRTLGLSGGSMPWIEDYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995109_HBx_P-F Product feature CHAIN KP995109_HBx_P-F of FT:mat_peptide KP995109_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 209-Cirrhosis). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995110_HBx_P-F Product feature CHAIN KP995110_HBx_P-F of FT:mat_peptide KP995110_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 231-HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALHKRTLGLSGWSMTWIEEYIKDCVFTDWEELGEETRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995111_HBx_P-F Product feature CHAIN KP995111_HBx_P-F of FT:mat_peptide KP995111_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 234-Cirrhosis). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995113_HBx_P-F Product feature CHAIN KP995113_HBx_P-F of FT:mat_peptide KP995113_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2351-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGDVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALHKRTLGLSGGSMPWIEEYIKDCVFKDWEESGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995114_HBx_P-F Product feature CHAIN KP995114_HBx_P-F of FT:mat_peptide KP995114_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2369-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPPGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALHKRTLGLSGGSMPWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995115_HBx_P-F Product feature CHAIN KP995115_HBx_P-F of FT:mat_peptide KP995115_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2370-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPIGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTALHKRTLGLSGGSMPWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995116_HBx_P-F Product feature CHAIN KP995116_HBx_P-F of FT:mat_peptide KP995116_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2503-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995117_HBx_P-F Product feature CHAIN KP995117_HBx_P-F of FT:mat_peptide KP995117_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2504-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995118_HBx_P-F Product feature CHAIN KP995118_HBx_P-F of FT:mat_peptide KP995118_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2517-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGAVPPPSSSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNMPTVLYKRTLGLSGRSMTWIEEYIKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995119_HBx_P-F Product feature CHAIN KP995119_HBx_P-F of FT:mat_peptide KP995119_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2524-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVSPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995120_HBx_P-F Product feature CHAIN KP995120_HBx_P-F of FT:mat_peptide KP995120_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2579-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGGSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCYFFTSA
>gnl|hbvpro|KP995123_HBx_P-F Product feature CHAIN KP995123_HBx_P-F of FT:mat_peptide KP995123_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X10-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARPME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995124_HBx_P-F Product feature CHAIN KP995124_HBx_P-F of FT:mat_peptide KP995124_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X11-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995125_HBx_P-F Product feature CHAIN KP995125_HBx_P-F of FT:mat_peptide KP995125_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X13-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP995126_HBx_P-F Product feature CHAIN KP995126_HBx_P-F of FT:mat_peptide KP995126_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X14-Chronic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSPGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KT896494_HBx_P-F Product feature CHAIN KT896494_HBx_P-F of FT:mat_peptide KT896494_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MAN183). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX264496_HBx_P-F Product feature CHAIN KX264496_HBx_P-F of FT:mat_peptide KX264496_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1-ame). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX264497_HBx_P-F Product feature CHAIN KX264497_HBx_P-F of FT:mat_peptide KX264497_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F2-ame). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX264498_HBx_P-F Product feature CHAIN KX264498_HBx_P-F of FT:mat_peptide KX264498_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F3-ame). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWNLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX264499_HBx_P-F Product feature CHAIN KX264499_HBx_P-F of FT:mat_peptide KX264499_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4-ame). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX757665_HBx_P-F Product feature CHAIN KX757665_HBx_P-F of FT:mat_peptide KX757665_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate TH6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGSFGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFXTSA
>gnl|hbvpro|KY382411_HBx_P-F Product feature CHAIN KY382411_HBx_P-F of FT:mat_peptide KY382411_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4_wt). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY382415_HBx_P-F Product feature CHAIN KY382415_HBx_P-F of FT:mat_peptide KY382415_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_wt). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY382416_HBx_P-F Product feature CHAIN KY382416_HBx_P-F of FT:mat_peptide KY382416_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_double_mut). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY382417_HBx_P-F Product feature CHAIN KY382417_HBx_P-F of FT:mat_peptide KY382417_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_quadruple_mut). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY458061_HBx_P-F Product feature CHAIN KY458061_HBx_P-F of FT:mat_peptide KY458061_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY458062_HBx_P-F Product feature CHAIN KY458062_HBx_P-F of FT:mat_peptide KY458062_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476322_HBx_P-F Product feature CHAIN KY476322_HBx_P-F of FT:mat_peptide KY476322_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476323_HBx_P-F Product feature CHAIN KY476323_HBx_P-F of FT:mat_peptide KY476323_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476324_HBx_P-F Product feature CHAIN KY476324_HBx_P-F of FT:mat_peptide KY476324_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476325_HBx_P-F Product feature CHAIN KY476325_HBx_P-F of FT:mat_peptide KY476325_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476326_HBx_P-F Product feature CHAIN KY476326_HBx_P-F of FT:mat_peptide KY476326_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSLASAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476327_HBx_P-F Product feature CHAIN KY476327_HBx_P-F of FT:mat_peptide KY476327_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476328_HBx_P-F Product feature CHAIN KY476328_HBx_P-F of FT:mat_peptide KY476328_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476329_HBx_P-F Product feature CHAIN KY476329_HBx_P-F of FT:mat_peptide KY476329_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLYKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVGSPAPCNFFTSA
>gnl|hbvpro|KY476330_HBx_P-F Product feature CHAIN KY476330_HBx_P-F of FT:mat_peptide KY476330_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARHME
TTVNAPRSLPTVLYKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476331_HBx_P-F Product feature CHAIN KY476331_HBx_P-F of FT:mat_peptide KY476331_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY476332_HBx_P-F Product feature CHAIN KY476332_HBx_P-F of FT:mat_peptide KY476332_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFTSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTIGLSGRSMTWIEGYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF593354_HBx_P-F Product feature CHAIN MF593354_HBx_P-F of FT:mat_peptide MF593354_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ31). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTALHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPXPCNFFTSA
>gnl|hbvpro|MF593356_HBx_P-F Product feature CHAIN MF593356_HBx_P-F of FT:mat_peptide MF593356_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ33). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLYKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF593360_HBx_P-F Product feature CHAIN MF593360_HBx_P-F of FT:mat_peptide MF593360_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ37). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLYKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPXPCNFFTSA
>gnl|hbvpro|MF593367_HBx_P-F Product feature CHAIN MF593367_HBx_P-F of FT:mat_peptide MF593367_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ47). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF593371_HBx_P-F Product feature CHAIN MF593371_HBx_P-F of FT:mat_peptide MF593371_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ53). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRPLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF593376_HBx_P-F Product feature CHAIN MF593376_HBx_P-F of FT:mat_peptide MF593376_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ58). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF593380_HBx_P-F Product feature CHAIN MF593380_HBx_P-F of FT:mat_peptide MF593380_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ62). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEXYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG001258_HBx_P-F Product feature CHAIN MG001258_HBx_P-F of FT:mat_peptide MG001258_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RI.98). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG001259_HBx_P-F Product feature CHAIN MG001259_HBx_P-F of FT:mat_peptide MG001259_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 33.1). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFSSA
>gnl|hbvpro|MH051986_HBx_P-F Product feature CHAIN MH051986_HBx_P-F of FT:mat_peptide MH051986_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B106W). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTMNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MH051987_HBx_P-F Product feature CHAIN MH051987_HBx_P-F of FT:mat_peptide MH051987_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B127W). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTMNAPWSLPTVLHKRTLGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK058437_HBx_P-F Product feature CHAIN MK058437_HBx_P-F of FT:mat_peptide MK058437_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPRSLPTVLHKRTLGLSGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|X69798_HBx_P-F Product feature CHAIN X69798_HBx_P-F of FT:mat_peptide X69798_HBx_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|X75658_HBx_C-F Product feature CHAIN X75658_HBx_C-F of FT:mat_peptide X75658_HBx_C-F of [Viruses] Hepatitis B Virus genotype F (isolate Fou). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESSGRTLPGPLGALPPSSASAVPADHGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTIGLSGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X75663_HBx_P-F Product feature CHAIN X75663_HBx_P-F of FT:mat_peptide X75663_HBx_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9203). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRTLPGSLGAVPPPSSSAVPADNGSHLSLRGLPVCSFSSAGPCALRFTSARRME
TTVNAPWSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
© 1998-2019