HBVdb

Dataset for protein MHBs of genotype F

[Download (right click)] [Alignment] [Repertoires]

264 sequence(s)

>gnl|hbvpro|AB036905_MHBs_P-F Product feature CHAIN AB036905_MHBs_P-F of FT:mat_peptide AB036905_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8248-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036906_MHBs_P-F Product feature CHAIN AB036906_MHBs_P-F of FT:mat_peptide AB036906_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8248-2). Non-functional genomic sequence. [Hepadnaviridae] (length=278 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLTNGTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSP
TVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036907_MHBs_P-F Product feature CHAIN AB036907_MHBs_P-F of FT:mat_peptide AB036907_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8339-2). Non-functional genomic sequence. [Hepadnaviridae] (length=278 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLTNGTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSP
TVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036908_MHBs_P-F Product feature CHAIN AB036908_MHBs_P-F of FT:mat_peptide AB036908_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8337). Non-functional genomic sequence. [Hepadnaviridae] (length=278 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLTNGTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSP
TVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036909_MHBs_P-F Product feature CHAIN AB036909_MHBs_P-F of FT:mat_peptide AB036909_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8339-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036910_MHBs_P-F Product feature CHAIN AB036910_MHBs_P-F of FT:mat_peptide AB036910_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8251). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSTFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036911_MHBs_P-F Product feature CHAIN AB036911_MHBs_P-F of FT:mat_peptide AB036911_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8255). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036912_MHBs_P-F Product feature CHAIN AB036912_MHBs_P-F of FT:mat_peptide AB036912_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8323). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036913_MHBs_P-F Product feature CHAIN AB036913_MHBs_P-F of FT:mat_peptide AB036913_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8346). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLXGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036914_MHBs_P-F Product feature CHAIN AB036914_MHBs_P-F of FT:mat_peptide AB036914_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8349). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036915_MHBs_P-F Product feature CHAIN AB036915_MHBs_P-F of FT:mat_peptide AB036915_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8351). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036916_MHBs_P-F Product feature CHAIN AB036916_MHBs_P-F of FT:mat_peptide AB036916_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8371). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036917_MHBs_P-F Product feature CHAIN AB036917_MHBs_P-F of FT:mat_peptide AB036917_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8375-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036918_MHBs_P-F Product feature CHAIN AB036918_MHBs_P-F of FT:mat_peptide AB036918_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8375-2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036919_MHBs_P-F Product feature CHAIN AB036919_MHBs_P-F of FT:mat_peptide AB036919_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8381). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036920_MHBs_P-F Product feature CHAIN AB036920_MHBs_P-F of FT:mat_peptide AB036920_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8624). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB064316_MHBs_P-F Product feature CHAIN AB064316_MHBs_P-F of FT:mat_peptide AB064316_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB086397_MHBs_P-F Product feature CHAIN AB086397_MHBs_P-F of FT:mat_peptide AB086397_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate JPF1130). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQXLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAAFFLLIKI
LTIPRSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116549_MHBs_P-F Product feature CHAIN AB116549_MHBs_P-F of FT:mat_peptide AB116549_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116550_MHBs_P-F Product feature CHAIN AB116550_MHBs_P-F of FT:mat_peptide AB116550_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPKGKALYFPAGGSSSGTQNPAPTIASLTSSTFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLRNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116551_MHBs_P-F Product feature CHAIN AB116551_MHBs_P-F of FT:mat_peptide AB116551_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116552_MHBs_P-F Product feature CHAIN AB116552_MHBs_P-F of FT:mat_peptide AB116552_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116654_MHBs_P-F Product feature CHAIN AB116654_MHBs_P-F of FT:mat_peptide AB116654_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVFSLLTKI
LTIPQSLDSWWTSLNFLGGTTGCPGQNSLSPTSNHLPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFTLLLLIFCYLWVSS
>gnl|hbvpro|AB166850_MHBs_P-F Product feature CHAIN AB166850_MHBs_P-F of FT:mat_peptide AB166850_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV-BL592). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALSPPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
RTIPQSLDLWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB214516_MHBs_P-F Product feature CHAIN AB214516_MHBs_P-F of FT:mat_peptide AB214516_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV-BL597). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALSPPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLIIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365446_MHBs_P-F Product feature CHAIN AB365446_MHBs_P-F of FT:mat_peptide AB365446_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVFFLLTKI
LTIPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365449_MHBs_P-F Product feature CHAIN AB365449_MHBs_P-F of FT:mat_peptide AB365449_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL93). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLXGPLLVLQAVCFLWTKI
LKTPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCNTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365450_MHBs_P-F Product feature CHAIN AB365450_MHBs_P-F of FT:mat_peptide AB365450_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL102). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTXMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365453_MHBs_P-F Product feature CHAIN AB365453_MHBs_P-F of FT:mat_peptide AB365453_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL584). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSTTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF223962_MHBs_P-F Product feature CHAIN AF223962_MHBs_P-F of FT:mat_peptide AF223962_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF223963_MHBs_P-F Product feature CHAIN AF223963_MHBs_P-F of FT:mat_peptide AF223963_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPPLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF223964_MHBs_P-F Product feature CHAIN AF223964_MHBs_P-F of FT:mat_peptide AF223964_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFHAGGSSSGTQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF223965_MHBs_P-F Product feature CHAIN AF223965_MHBs_P-F of FT:mat_peptide AF223965_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDSITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY090455_MHBs_P-F Product feature CHAIN AY090455_MHBs_P-F of FT:mat_peptide AY090455_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVHFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY090458_MHBs_C-F Product feature CHAIN AY090458_MHBs_C-F of FT:mat_peptide AY090458_MHBs_C-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY090459_MHBs_P-F Product feature CHAIN AY090459_MHBs_P-F of FT:mat_peptide AY090459_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY090461_MHBs_P-F Product feature CHAIN AY090461_MHBs_P-F of FT:mat_peptide AY090461_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY179735_MHBs_P-F Product feature CHAIN AY179735_MHBs_P-F of FT:mat_peptide AY179735_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLEGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY311369_MHBs_P-F Product feature CHAIN AY311369_MHBs_P-F of FT:mat_peptide AY311369_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD4139). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY311370_MHBs_P-F Product feature CHAIN AY311370_MHBs_P-F of FT:mat_peptide AY311370_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD14999). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAGGFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ131124_MHBs_P-F Product feature CHAIN DQ131124_MHBs_P-F of FT:mat_peptide DQ131124_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate M-F). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ776247_MHBs_P-F Product feature CHAIN DQ776247_MHBs_P-F of FT:mat_peptide DQ776247_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA54). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823086_MHBs_P-F Product feature CHAIN DQ823086_MHBs_P-F of FT:mat_peptide DQ823086_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823087_MHBs_P-F Product feature CHAIN DQ823087_MHBs_P-F of FT:mat_peptide DQ823087_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSAKFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823088_MHBs_P-F Product feature CHAIN DQ823088_MHBs_P-F of FT:mat_peptide DQ823088_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823089_MHBs_P-F Product feature CHAIN DQ823089_MHBs_P-F of FT:mat_peptide DQ823089_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQVLLDPRVKALYYPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823090_MHBs_P-F Product feature CHAIN DQ823090_MHBs_P-F of FT:mat_peptide DQ823090_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823091_MHBs_P-F Product feature CHAIN DQ823091_MHBs_P-F of FT:mat_peptide DQ823091_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823092_MHBs_P-F Product feature CHAIN DQ823092_MHBs_P-F of FT:mat_peptide DQ823092_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823093_MHBs_P-F Product feature CHAIN DQ823093_MHBs_P-F of FT:mat_peptide DQ823093_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823094_MHBs_P-F Product feature CHAIN DQ823094_MHBs_P-F of FT:mat_peptide DQ823094_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823095_MHBs_P-F Product feature CHAIN DQ823095_MHBs_P-F of FT:mat_peptide DQ823095_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA45). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899142_MHBs_P-F Product feature CHAIN DQ899142_MHBs_P-F of FT:mat_peptide DQ899142_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Warao152). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPMVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTGGPAMSMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899143_MHBs_P-F Product feature CHAIN DQ899143_MHBs_P-F of FT:mat_peptide DQ899143_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Warao189). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMSMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899144_MHBs_P-F Product feature CHAIN DQ899144_MHBs_P-F of FT:mat_peptide DQ899144_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira75). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVKALYFPAGGSSSGTQNPAPTIASLTSSIYSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899145_MHBs_P-F Product feature CHAIN DQ899145_MHBs_P-F of FT:mat_peptide DQ899145_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira76). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIYSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899146_MHBs_P-F Product feature CHAIN DQ899146_MHBs_P-F of FT:mat_peptide DQ899146_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira80). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVKALYFPAGGSSSGTQNPAPTIASLTSSIYSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLPRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899147_MHBs_P-F Product feature CHAIN DQ899147_MHBs_P-F of FT:mat_peptide DQ899147_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSRTQNPAPTIASLTSSIYSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLQCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQRTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899148_MHBs_P-F Product feature CHAIN DQ899148_MHBs_P-F of FT:mat_peptide DQ899148_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Yanomami114). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALSDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899149_MHBs_P-F Product feature CHAIN DQ899149_MHBs_P-F of FT:mat_peptide DQ899149_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Piaroa3019). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899150_MHBs_P-F Product feature CHAIN DQ899150_MHBs_P-F of FT:mat_peptide DQ899150_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Colombia8). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYRWVSI
>gnl|hbvpro|EF576808_MHBs_P-F Product feature CHAIN EF576808_MHBs_P-F of FT:mat_peptide EF576808_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SAL7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYLPAGGSSSETQNPAPTIASLISSISLTTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLEGLPRCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF576812_MHBs_P-F Product feature CHAIN EF576812_MHBs_P-F of FT:mat_peptide EF576812_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SAL13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU159674_MHBs_P-F Product feature CHAIN EU159674_MHBs_P-F of FT:mat_peptide EU159674_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Irish-18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCSGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU366116_MHBs_P-F Product feature CHAIN EU366116_MHBs_P-F of FT:mat_peptide EU366116_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA61). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU366118_MHBs_P-F Product feature CHAIN EU366118_MHBs_P-F of FT:mat_peptide EU366118_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA67). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU366132_MHBs_P-F Product feature CHAIN EU366132_MHBs_P-F of FT:mat_peptide EU366132_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA95). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWTSTQFHQALLDPRVRALYLXAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLRPLLVLQAVFFSLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPLTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPIVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU366133_MHBs_P-F Product feature CHAIN EU366133_MHBs_P-F of FT:mat_peptide EU366133_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA96). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFWKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU670262_MHBs_P-F Product feature CHAIN EU670262_MHBs_P-F of FT:mat_peptide EU670262_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 549). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPASGSSSETQNPAPTIASLTSSIFLKTGAPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ589066_MHBs_P-F Product feature CHAIN FJ589066_MHBs_P-F of FT:mat_peptide FJ589066_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_054). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLSFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSTLRPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ589067_MHBs_P-F Product feature CHAIN FJ589067_MHBs_P-F of FT:mat_peptide FJ589067_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_083). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCRILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657519_MHBs_P-F Product feature CHAIN FJ657519_MHBs_P-F of FT:mat_peptide FJ657519_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA110). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVXALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657522_MHBs_P-F Product feature CHAIN FJ657522_MHBs_P-F of FT:mat_peptide FJ657522_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657525_MHBs_P-F Product feature CHAIN FJ657525_MHBs_P-F of FT:mat_peptide FJ657525_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA107). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPRSLDSWWTSLSFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657528_MHBs_P-F Product feature CHAIN FJ657528_MHBs_P-F of FT:mat_peptide FJ657528_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA108). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMTMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657529_MHBs_P-F Product feature CHAIN FJ657529_MHBs_P-F of FT:mat_peptide FJ657529_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA109). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709457_MHBs_P-F Product feature CHAIN FJ709457_MHBs_P-F of FT:mat_peptide FJ709457_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709458_MHBs_P-F Product feature CHAIN FJ709458_MHBs_P-F of FT:mat_peptide FJ709458_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLEGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709459_MHBs_P-F Product feature CHAIN FJ709459_MHBs_P-F of FT:mat_peptide FJ709459_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709460_MHBs_P-F Product feature CHAIN FJ709460_MHBs_P-F of FT:mat_peptide FJ709460_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709462_MHBs_P-F Product feature CHAIN FJ709462_MHBs_P-F of FT:mat_peptide FJ709462_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709463_MHBs_P-F Product feature CHAIN FJ709463_MHBs_P-F of FT:mat_peptide FJ709463_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFXPLLPIFCYLWVSI
>gnl|hbvpro|FJ709464_MHBs_P-F Product feature CHAIN FJ709464_MHBs_P-F of FT:mat_peptide FJ709464_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709465_MHBs_P-F Product feature CHAIN FJ709465_MHBs_P-F of FT:mat_peptide FJ709465_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRTLYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709494_MHBs_P-F Product feature CHAIN FJ709494_MHBs_P-F of FT:mat_peptide FJ709494_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HE981181_MHBs_P-F Product feature CHAIN HE981181_MHBs_P-F of FT:mat_peptide HE981181_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HE981182_MHBs_P-F Product feature CHAIN HE981182_MHBs_P-F of FT:mat_peptide HE981182_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVPFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HE981183_MHBs_P-F Product feature CHAIN HE981183_MHBs_P-F of FT:mat_peptide HE981183_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVPFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585186_MHBs_P-F Product feature CHAIN HM585186_MHBs_P-F of FT:mat_peptide HM585186_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585187_MHBs_P-F Product feature CHAIN HM585187_MHBs_P-F of FT:mat_peptide HM585187_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585188_MHBs_P-F Product feature CHAIN HM585188_MHBs_P-F of FT:mat_peptide HM585188_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585189_MHBs_P-F Product feature CHAIN HM585189_MHBs_P-F of FT:mat_peptide HM585189_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585190_MHBs_P-F Product feature CHAIN HM585190_MHBs_P-F of FT:mat_peptide HM585190_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585191_MHBs_P-F Product feature CHAIN HM585191_MHBs_P-F of FT:mat_peptide HM585191_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585192_MHBs_P-F Product feature CHAIN HM585192_MHBs_P-F of FT:mat_peptide HM585192_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585193_MHBs_P-F Product feature CHAIN HM585193_MHBs_P-F of FT:mat_peptide HM585193_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585194_MHBs_P-F Product feature CHAIN HM585194_MHBs_P-F of FT:mat_peptide HM585194_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585195_MHBs_P-F Product feature CHAIN HM585195_MHBs_P-F of FT:mat_peptide HM585195_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNATQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585196_MHBs_P-F Product feature CHAIN HM585196_MHBs_P-F of FT:mat_peptide HM585196_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585197_MHBs_P-F Product feature CHAIN HM585197_MHBs_P-F of FT:mat_peptide HM585197_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585198_MHBs_P-F Product feature CHAIN HM585198_MHBs_P-F of FT:mat_peptide HM585198_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585199_MHBs_P-F Product feature CHAIN HM585199_MHBs_P-F of FT:mat_peptide HM585199_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585200_MHBs_P-F Product feature CHAIN HM585200_MHBs_P-F of FT:mat_peptide HM585200_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTLFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWDWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM590471_MHBs_P-F Product feature CHAIN HM590471_MHBs_P-F of FT:mat_peptide HM590471_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM590472_MHBs_P-F Product feature CHAIN HM590472_MHBs_P-F of FT:mat_peptide HM590472_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM590473_MHBs_P-F Product feature CHAIN HM590473_MHBs_P-F of FT:mat_peptide HM590473_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM622135_MHBs_P-F Product feature CHAIN HM622135_MHBs_P-F of FT:mat_peptide HM622135_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGHLGPLLVLQAVCSLLTKI
RTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM627320_MHBs_P-F Product feature CHAIN HM627320_MHBs_P-F of FT:mat_peptide HM627320_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALXDPRVRXLYXPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HQ378247_MHBs_P-F Product feature CHAIN HQ378247_MHBs_P-F of FT:mat_peptide HQ378247_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate IRL-2009). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JF439884_MHBs_P-F Product feature CHAIN JF439884_MHBs_P-F of FT:mat_peptide JF439884_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate ANG03G1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNRCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JF439885_MHBs_P-F Product feature CHAIN JF439885_MHBs_P-F of FT:mat_peptide JF439885_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate ANG03G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNRCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604211_MHBs_P-F Product feature CHAIN JN604211_MHBs_P-F of FT:mat_peptide JN604211_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 476-7401-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPALNMENITSGLLGPLLVLQAVFFLLTKI
LTIPXXLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604225_MHBs_P-F Product feature CHAIN JN604225_MHBs_P-F of FT:mat_peptide JN604225_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 477-5408-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLSFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGLNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604233_MHBs_P-F Product feature CHAIN JN604233_MHBs_P-F of FT:mat_peptide JN604233_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 478-0355-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTTTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604271_MHBs_P-F Product feature CHAIN JN604271_MHBs_P-F of FT:mat_peptide JN604271_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 476-8502-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSSFSTTGGPATNMDNITSGLLGPLLVLQAVCFLLIKI
LTIPRSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688691_MHBs_P-F Product feature CHAIN JN688691_MHBs_P-F of FT:mat_peptide JN688691_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV122). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688699_MHBs_P-F Product feature CHAIN JN688699_MHBs_P-F of FT:mat_peptide JN688699_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV133). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688701_MHBs_P-F Product feature CHAIN JN688701_MHBs_P-F of FT:mat_peptide JN688701_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV135). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVXFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688703_MHBs_P-F Product feature CHAIN JN688703_MHBs_P-F of FT:mat_peptide JN688703_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV137). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688709_MHBs_P-F Product feature CHAIN JN688709_MHBs_P-F of FT:mat_peptide JN688709_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV143). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHSTQLDPRVRALYXPAGGSSSETQNLAQTIASLXSSIFSKTGGXAMNMDNITSGLLGPLLVLQGVFFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688720_MHBs_P-F Product feature CHAIN JN688720_MHBs_P-F of FT:mat_peptide JN688720_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV224). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSDTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVFFSLIKI
RTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792917_MHBs_P-F Product feature CHAIN JN792917_MHBs_P-F of FT:mat_peptide JN792917_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8070-05260). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQTLLDPRVRDLYLPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTSF
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792918_MHBs_P-F Product feature CHAIN JN792918_MHBs_P-F of FT:mat_peptide JN792918_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8070-03547). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRDLYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLIKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792919_MHBs_P-F Product feature CHAIN JN792919_MHBs_P-F of FT:mat_peptide JN792919_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8327-13282). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792920_MHBs_P-F Product feature CHAIN JN792920_MHBs_P-F of FT:mat_peptide JN792920_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8327-05424). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792921_MHBs_P-F Product feature CHAIN JN792921_MHBs_P-F of FT:mat_peptide JN792921_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9401-03738). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQXLLBPRVRALYFPAGGSSSXTQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGXPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLXPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792922_MHBs_P-F Product feature CHAIN JN792922_MHBs_P-F of FT:mat_peptide JN792922_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9401-03301). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN811655_MHBs_P-F Product feature CHAIN JN811655_MHBs_P-F of FT:mat_peptide JN811655_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3Mg). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSIVSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN811656_MHBs_P-F Product feature CHAIN JN811656_MHBs_P-F of FT:mat_peptide JN811656_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4Mg). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JQ272888_MHBs_P-F Product feature CHAIN JQ272888_MHBs_P-F of FT:mat_peptide JQ272888_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ29). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSAKFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSTTGDLAMNMDNITSGLLGPLLVLQAVCFLLIKI
LTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSTLSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JX079936_MHBs_P-F Product feature CHAIN JX079936_MHBs_P-F of FT:mat_peptide JX079936_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FF2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JX079937_MHBs_P-F Product feature CHAIN JX079937_MHBs_P-F of FT:mat_peptide JX079937_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FF5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFSYLWVSI
>gnl|hbvpro|KC494394_MHBs_P-F Product feature CHAIN KC494394_MHBs_P-F of FT:mat_peptide KC494394_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR12-NORTH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494395_MHBs_P-F Product feature CHAIN KC494395_MHBs_P-F of FT:mat_peptide KC494395_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR11-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494396_MHBs_P-F Product feature CHAIN KC494396_MHBs_P-F of FT:mat_peptide KC494396_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR10-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVWALYFPAGGSSSGTQNPAPTIASLTSSIFPKTGGPAMNMDNITSGLLGPLLVLHAVCFLLTKI
LTMPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494397_MHBs_P-F Product feature CHAIN KC494397_MHBs_P-F of FT:mat_peptide KC494397_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR9-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNTYSGLLRPLLVSQAVCSLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMVPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494398_MHBs_P-F Product feature CHAIN KC494398_MHBs_P-F of FT:mat_peptide KC494398_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR8-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494399_MHBs_P-F Product feature CHAIN KC494399_MHBs_P-F of FT:mat_peptide KC494399_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR7-CENTRAL). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVYFLLIKI
LIMPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494400_MHBs_P-F Product feature CHAIN KC494400_MHBs_P-F of FT:mat_peptide KC494400_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR6-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGRTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494401_MHBs_P-F Product feature CHAIN KC494401_MHBs_P-F of FT:mat_peptide KC494401_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR5-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494402_MHBs_P-F Product feature CHAIN KC494402_MHBs_P-F of FT:mat_peptide KC494402_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR4-NORTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKFLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494403_MHBs_P-F Product feature CHAIN KC494403_MHBs_P-F of FT:mat_peptide KC494403_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR3-NORTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494404_MHBs_P-F Product feature CHAIN KC494404_MHBs_P-F of FT:mat_peptide KC494404_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR2-NORTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494405_MHBs_P-F Product feature CHAIN KC494405_MHBs_P-F of FT:mat_peptide KC494405_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR1-NORTHEAST). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF199901_MHBs_P-F Product feature CHAIN KF199901_MHBs_P-F of FT:mat_peptide KF199901_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RVLA). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGCSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASVRFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF779236_MHBs_P-F Product feature CHAIN KF779236_MHBs_P-F of FT:mat_peptide KF779236_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate DEN6107). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTVNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ586805_MHBs_P-F Product feature CHAIN KJ586805_MHBs_P-F of FT:mat_peptide KJ586805_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ586806_MHBs_P-F Product feature CHAIN KJ586806_MHBs_P-F of FT:mat_peptide KJ586806_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ586807_MHBs_P-F Product feature CHAIN KJ586807_MHBs_P-F of FT:mat_peptide KJ586807_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MAWNSPQFHQGLLIPRVKGLLLVAGGSSSKTQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLNSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFMPLLPIFCYLWVSI
>gnl|hbvpro|KJ586808_MHBs_P-F Product feature CHAIN KJ586808_MHBs_P-F of FT:mat_peptide KJ586808_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638656_MHBs_P-F Product feature CHAIN KJ638656_MHBs_P-F of FT:mat_peptide KJ638656_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNTTSGHLGLLLVLQAVCFLLTKI
LKIPQNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSRPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLGSILSHFIPLLPIFCYLWGSI
>gnl|hbvpro|KJ638657_MHBs_P-F Product feature CHAIN KJ638657_MHBs_P-F of FT:mat_peptide KJ638657_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT013). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQRNSTQFHQALLDPRVRALCVPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPXSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638659_MHBs_P-F Product feature CHAIN KJ638659_MHBs_P-F of FT:mat_peptide KJ638659_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT025). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLXKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638660_MHBs_P-F Product feature CHAIN KJ638660_MHBs_P-F of FT:mat_peptide KJ638660_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT030). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNTTQFHQALQDPRVRALLSPAGGSSSETQNPAPTIASLTSSIFXKTGGPVMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPXLCXILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638662_MHBs_P-F Product feature CHAIN KJ638662_MHBs_P-F of FT:mat_peptide KJ638662_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT040). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNTTQFHQALLDPXVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPVMNMDNITSGLLGPLLVLQAVCFLLIKI
LTIPQSLDSWWTSRNFLGEIPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638664_MHBs_P-F Product feature CHAIN KJ638664_MHBs_P-F of FT:mat_peptide KJ638664_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT049). Complete genome. [Hepadnaviridae] (length=281 residues).
IKWKWNTFHQALLDPKVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVSFLLTKI
LTIPQSLDSWWTSLNFLGGPPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KJ676694_MHBs_P-F Product feature CHAIN KJ676694_MHBs_P-F of FT:mat_peptide KJ676694_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4_03). Complete genome. [Hepadnaviridae] (length=281 residues).
XQNNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVSFLLIKI
LTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843163_MHBs_P-F Product feature CHAIN KJ843163_MHBs_P-F of FT:mat_peptide KJ843163_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag01). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVRFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843164_MHBs_P-F Product feature CHAIN KJ843164_MHBs_P-F of FT:mat_peptide KJ843164_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag02). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843167_MHBs_P-F Product feature CHAIN KJ843167_MHBs_P-F of FT:mat_peptide KJ843167_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag05). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843169_MHBs_P-F Product feature CHAIN KJ843169_MHBs_P-F of FT:mat_peptide KJ843169_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag07). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843170_MHBs_P-F Product feature CHAIN KJ843170_MHBs_P-F of FT:mat_peptide KJ843170_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag08). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843171_MHBs_P-F Product feature CHAIN KJ843171_MHBs_P-F of FT:mat_peptide KJ843171_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag09). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843174_MHBs_P-F Product feature CHAIN KJ843174_MHBs_P-F of FT:mat_peptide KJ843174_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHHALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843175_MHBs_P-F Product feature CHAIN KJ843175_MHBs_P-F of FT:mat_peptide KJ843175_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843176_MHBs_P-F Product feature CHAIN KJ843176_MHBs_P-F of FT:mat_peptide KJ843176_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843177_MHBs_P-F Product feature CHAIN KJ843177_MHBs_P-F of FT:mat_peptide KJ843177_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843178_MHBs_P-F Product feature CHAIN KJ843178_MHBs_P-F of FT:mat_peptide KJ843178_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843179_MHBs_P-F Product feature CHAIN KJ843179_MHBs_P-F of FT:mat_peptide KJ843179_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843180_MHBs_P-F Product feature CHAIN KJ843180_MHBs_P-F of FT:mat_peptide KJ843180_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843181_MHBs_P-F Product feature CHAIN KJ843181_MHBs_P-F of FT:mat_peptide KJ843181_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843185_MHBs_P-F Product feature CHAIN KJ843185_MHBs_P-F of FT:mat_peptide KJ843185_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843189_MHBs_P-F Product feature CHAIN KJ843189_MHBs_P-F of FT:mat_peptide KJ843189_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843190_MHBs_P-F Product feature CHAIN KJ843190_MHBs_P-F of FT:mat_peptide KJ843190_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843191_MHBs_P-F Product feature CHAIN KJ843191_MHBs_P-F of FT:mat_peptide KJ843191_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843193_MHBs_P-F Product feature CHAIN KJ843193_MHBs_P-F of FT:mat_peptide KJ843193_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843194_MHBs_P-F Product feature CHAIN KJ843194_MHBs_P-F of FT:mat_peptide KJ843194_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843195_MHBs_P-F Product feature CHAIN KJ843195_MHBs_P-F of FT:mat_peptide KJ843195_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843196_MHBs_P-F Product feature CHAIN KJ843196_MHBs_P-F of FT:mat_peptide KJ843196_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843197_MHBs_P-F Product feature CHAIN KJ843197_MHBs_P-F of FT:mat_peptide KJ843197_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843198_MHBs_P-F Product feature CHAIN KJ843198_MHBs_P-F of FT:mat_peptide KJ843198_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843199_MHBs_P-F Product feature CHAIN KJ843199_MHBs_P-F of FT:mat_peptide KJ843199_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843200_MHBs_P-F Product feature CHAIN KJ843200_MHBs_P-F of FT:mat_peptide KJ843200_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843201_MHBs_P-F Product feature CHAIN KJ843201_MHBs_P-F of FT:mat_peptide KJ843201_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843202_MHBs_P-F Product feature CHAIN KJ843202_MHBs_P-F of FT:mat_peptide KJ843202_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVE
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843203_MHBs_P-F Product feature CHAIN KJ843203_MHBs_P-F of FT:mat_peptide KJ843203_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag43). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLALGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843204_MHBs_P-F Product feature CHAIN KJ843204_MHBs_P-F of FT:mat_peptide KJ843204_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843205_MHBs_P-F Product feature CHAIN KJ843205_MHBs_P-F of FT:mat_peptide KJ843205_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag45). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843206_MHBs_P-F Product feature CHAIN KJ843206_MHBs_P-F of FT:mat_peptide KJ843206_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843207_MHBs_P-F Product feature CHAIN KJ843207_MHBs_P-F of FT:mat_peptide KJ843207_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843208_MHBs_P-F Product feature CHAIN KJ843208_MHBs_P-F of FT:mat_peptide KJ843208_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843209_MHBs_P-F Product feature CHAIN KJ843209_MHBs_P-F of FT:mat_peptide KJ843209_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag49). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843210_MHBs_P-F Product feature CHAIN KJ843210_MHBs_P-F of FT:mat_peptide KJ843210_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag50). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843211_MHBs_P-F Product feature CHAIN KJ843211_MHBs_P-F of FT:mat_peptide KJ843211_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag51). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843212_MHBs_P-F Product feature CHAIN KJ843212_MHBs_P-F of FT:mat_peptide KJ843212_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag52). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843213_MHBs_P-F Product feature CHAIN KJ843213_MHBs_P-F of FT:mat_peptide KJ843213_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag53). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843219_MHBs_P-F Product feature CHAIN KJ843219_MHBs_P-F of FT:mat_peptide KJ843219_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr01). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843220_MHBs_P-F Product feature CHAIN KJ843220_MHBs_P-F of FT:mat_peptide KJ843220_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr03). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843221_MHBs_P-F Product feature CHAIN KJ843221_MHBs_P-F of FT:mat_peptide KJ843221_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr04). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843222_MHBs_P-F Product feature CHAIN KJ843222_MHBs_P-F of FT:mat_peptide KJ843222_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr05). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843223_MHBs_P-F Product feature CHAIN KJ843223_MHBs_P-F of FT:mat_peptide KJ843223_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr06). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVKALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
XTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSN
>gnl|hbvpro|KJ843224_MHBs_P-F Product feature CHAIN KJ843224_MHBs_P-F of FT:mat_peptide KJ843224_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr07). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843225_MHBs_P-F Product feature CHAIN KJ843225_MHBs_P-F of FT:mat_peptide KJ843225_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr08). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSIQFHQALLDQRVRTLCLPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVYFLLIKI
LTIPQNLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843226_MHBs_P-F Product feature CHAIN KJ843226_MHBs_P-F of FT:mat_peptide KJ843226_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr09). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKXCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KM233681_MHBs_P-F Product feature CHAIN KM233681_MHBs_P-F of FT:mat_peptide KM233681_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAVNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KM998715_MHBs_P-F Product feature CHAIN KM998715_MHBs_P-F of FT:mat_peptide KM998715_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNISSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718103_MHBs_P-F Product feature CHAIN KP718103_MHBs_P-F of FT:mat_peptide KP718103_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PA-01-1214). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718104_MHBs_P-F Product feature CHAIN KP718104_MHBs_P-F of FT:mat_peptide KP718104_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CL0004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGAPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718106_MHBs_P-F Product feature CHAIN KP718106_MHBs_P-F of FT:mat_peptide KP718106_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PA-01-1650). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASAXFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718107_MHBs_P-F Product feature CHAIN KP718107_MHBs_P-F of FT:mat_peptide KP718107_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT097). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718109_MHBs_P-F Product feature CHAIN KP718109_MHBs_P-F of FT:mat_peptide KP718109_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7555_HIV). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYSPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718110_MHBs_P-F Product feature CHAIN KP718110_MHBs_P-F of FT:mat_peptide KP718110_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8728_HIV). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSNQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSTFLXTGGPAMNMDNITSGLLGPLLVLQAVCFLLIKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718111_MHBs_P-F Product feature CHAIN KP718111_MHBs_P-F of FT:mat_peptide KP718111_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8827_HIV). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFLKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWGSARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718112_MHBs_P-F Product feature CHAIN KP718112_MHBs_P-F of FT:mat_peptide KP718112_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GP10-4910). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718113_MHBs_P-F Product feature CHAIN KP718113_MHBs_P-F of FT:mat_peptide KP718113_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GP10-3634). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGAPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995097_MHBs_P-F Product feature CHAIN KP995097_MHBs_P-F of FT:mat_peptide KP995097_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTMPQSLDLWWTSLSFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995098_MHBs_P-F Product feature CHAIN KP995098_MHBs_P-F of FT:mat_peptide KP995098_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995101_MHBs_P-F Product feature CHAIN KP995101_MHBs_P-F of FT:mat_peptide KP995101_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 63-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSPGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995104_MHBs_P-F Product feature CHAIN KP995104_MHBs_P-F of FT:mat_peptide KP995104_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 81-Cirrhosis). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995105_MHBs_P-F Product feature CHAIN KP995105_MHBs_P-F of FT:mat_peptide KP995105_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 134-Cirrhosis). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995106_MHBs_P-F Product feature CHAIN KP995106_MHBs_P-F of FT:mat_peptide KP995106_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 143-Cirrhosis). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCLGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995107_MHBs_P-F Product feature CHAIN KP995107_MHBs_P-F of FT:mat_peptide KP995107_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 201-HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNTTSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995109_MHBs_P-F Product feature CHAIN KP995109_MHBs_P-F of FT:mat_peptide KP995109_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 209-Cirrhosis). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALSFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLIKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995110_MHBs_P-F Product feature CHAIN KP995110_MHBs_P-F of FT:mat_peptide KP995110_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 231-HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCLGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTALAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995111_MHBs_P-F Product feature CHAIN KP995111_MHBs_P-F of FT:mat_peptide KP995111_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 234-Cirrhosis). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPKVTALYFPAGGSSSGTQNPAPTIASLTSSIFSTTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDSQGMLP
VCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWGSI
>gnl|hbvpro|KP995113_MHBs_P-F Product feature CHAIN KP995113_MHBs_P-F of FT:mat_peptide KP995113_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2351-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSKLLGPLLVLQGVFFSLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLFLIFCYLWVSI
>gnl|hbvpro|KP995114_MHBs_P-F Product feature CHAIN KP995114_MHBs_P-F of FT:mat_peptide KP995114_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2369-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSKFHQHLLEPGVRALCLPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLRPLLVLQAVSFLLTKI
RTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWTCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPIVWLLAIWMIWYWGPNLFSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995115_MHBs_P-F Product feature CHAIN KP995115_MHBs_P-F of FT:mat_peptide KP995115_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2370-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLIKI
LTIPQSLDSWWTSLNFLGGLPVCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995116_MHBs_P-F Product feature CHAIN KP995116_MHBs_P-F of FT:mat_peptide KP995116_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2503-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFWYLWVSI
>gnl|hbvpro|KP995117_MHBs_P-F Product feature CHAIN KP995117_MHBs_P-F of FT:mat_peptide KP995117_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2504-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLNPRVRALYFPAGGSSSGTQNPAPTIASLTSSTFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LKIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTPLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVHFVQWCVG
LSPTVWLLVIWMIWYWGPNLHSILSPFIPLLPIFCYLWGSI
>gnl|hbvpro|KP995118_MHBs_P-F Product feature CHAIN KP995118_MHBs_P-F of FT:mat_peptide KP995118_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2517-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYHGILP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKFLWGWASARFSWLSLLVQFVQWCVE
LSPTVWLLVILMIWYWGPNLCSILSHFIPLLPIFWYLWVSI
>gnl|hbvpro|KP995119_MHBs_P-F Product feature CHAIN KP995119_MHBs_P-F of FT:mat_peptide KP995119_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2524-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995120_MHBs_P-F Product feature CHAIN KP995120_MHBs_P-F of FT:mat_peptide KP995120_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2579-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995123_MHBs_P-F Product feature CHAIN KP995123_MHBs_P-F of FT:mat_peptide KP995123_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X10-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995124_MHBs_P-F Product feature CHAIN KP995124_MHBs_P-F of FT:mat_peptide KP995124_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X11-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995125_MHBs_P-F Product feature CHAIN KP995125_MHBs_P-F of FT:mat_peptide KP995125_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X13-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995126_MHBs_P-F Product feature CHAIN KP995126_MHBs_P-F of FT:mat_peptide KP995126_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X14-Chronic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KT896494_MHBs_P-F Product feature CHAIN KT896494_MHBs_P-F of FT:mat_peptide KT896494_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MAN183). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQLLLDPRVRALCFPAGGSSSGTQNPAPTIASLTSSIFSTTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264496_MHBs_P-F Product feature CHAIN KX264496_MHBs_P-F of FT:mat_peptide KX264496_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1-ame). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264497_MHBs_P-F Product feature CHAIN KX264497_MHBs_P-F of FT:mat_peptide KX264497_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F2-ame). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264498_MHBs_P-F Product feature CHAIN KX264498_MHBs_P-F of FT:mat_peptide KX264498_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F3-ame). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264499_MHBs_P-F Product feature CHAIN KX264499_MHBs_P-F of FT:mat_peptide KX264499_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4-ame). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY382411_MHBs_P-F Product feature CHAIN KY382411_MHBs_P-F of FT:mat_peptide KY382411_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4_wt). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY382415_MHBs_P-F Product feature CHAIN KY382415_MHBs_P-F of FT:mat_peptide KY382415_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_wt). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIAXLTSSIFXKTGGPAXNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASXRFSWLXLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY382416_MHBs_P-F Product feature CHAIN KY382416_MHBs_P-F of FT:mat_peptide KY382416_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_double_mut). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIAXLTSSIFXKTGGPAXNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASXRFSWLXLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY382417_MHBs_P-F Product feature CHAIN KY382417_MHBs_P-F of FT:mat_peptide KY382417_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_quadruple_mut). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIAXLTSSIFXKTGGPAXNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASXRFSWLXLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY458061_MHBs_P-F Product feature CHAIN KY458061_MHBs_P-F of FT:mat_peptide KY458061_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNISSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY458062_MHBs_P-F Product feature CHAIN KY458062_MHBs_P-F of FT:mat_peptide KY458062_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNISSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476322_MHBs_P-F Product feature CHAIN KY476322_MHBs_P-F of FT:mat_peptide KY476322_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV01). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476323_MHBs_P-F Product feature CHAIN KY476323_MHBs_P-F of FT:mat_peptide KY476323_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV03). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLAPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDSITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476324_MHBs_P-F Product feature CHAIN KY476324_MHBs_P-F of FT:mat_peptide KY476324_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLTTGAPATNMDNITSGLLGPLLVLQAVFFLLTKI
LTIPKSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476325_MHBs_P-F Product feature CHAIN KY476325_MHBs_P-F of FT:mat_peptide KY476325_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDSITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSIWSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476326_MHBs_P-F Product feature CHAIN KY476326_MHBs_P-F of FT:mat_peptide KY476326_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSQFHQALLDPRVRALYXPAGGSSSETQNPAPTIASLTSSISSKTGGPAMNMDNITSGLLGPLLVLXAVCFWLTKI
RKIPQSLDSWWTSLNFLGGPPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQETSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLSSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476327_MHBs_P-F Product feature CHAIN KY476327_MHBs_P-F of FT:mat_peptide KY476327_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV28). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTQFHQALLDPRVRALYFPAGGSSSETQHPAPIIASLTSSIFLKTGAPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476328_MHBs_P-F Product feature CHAIN KY476328_MHBs_P-F of FT:mat_peptide KY476328_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDSITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476329_MHBs_P-F Product feature CHAIN KY476329_MHBs_P-F of FT:mat_peptide KY476329_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV33). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNTPQFHQALLDPRVRALCFPAGGSSSETQNPAPTIASLTSSIFLKTGAPATNMDNISSGLLGPLLVLQAVCFLLTKI
LTIPRSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476330_MHBs_P-F Product feature CHAIN KY476330_MHBs_P-F of FT:mat_peptide KY476330_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFSLTKI
LTIPQSLDSWWTSRNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476332_MHBs_P-F Product feature CHAIN KY476332_MHBs_P-F of FT:mat_peptide KY476332_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MH051986_MHBs_P-F Product feature CHAIN MH051986_MHBs_P-F of FT:mat_peptide MH051986_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B106W). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MH051987_MHBs_P-F Product feature CHAIN MH051987_MHBs_P-F of FT:mat_peptide MH051987_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B127W). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSRTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MK058437_MHBs_P-F Product feature CHAIN MK058437_MHBs_P-F of FT:mat_peptide MK058437_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|X69798_MHBs_P-F Product feature CHAIN X69798_MHBs_P-F of FT:mat_peptide X69798_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|X75658_MHBs_C-F Product feature CHAIN X75658_MHBs_C-F of FT:mat_peptide X75658_MHBs_C-F of [Viruses] Hepatitis B Virus genotype F (isolate Fou). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTHFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWEPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|X75663_MHBs_P-F Product feature CHAIN X75663_MHBs_P-F of FT:mat_peptide X75663_MHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9203). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTHFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTGGPAMNMENITSGLLGPLRVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGGLPRCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTALAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
© 1998-2019