HBVdb

Dataset for protein SHBs of genotype F

[Download (right click)] [Alignment] [Repertoires]

555 sequence(s)

>gnl|hbvpro|AB036905_SHBs_P-F Product feature CHAIN AB036905_SHBs_P-F of FT:mat_peptide AB036905_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8248-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036906_SHBs_P-F Product feature CHAIN AB036906_SHBs_P-F of FT:mat_peptide AB036906_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8248-2). Non-functional genomic sequence. [Hepadnaviridae] (length=223 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLTNGTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLW
EWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036907_SHBs_P-F Product feature CHAIN AB036907_SHBs_P-F of FT:mat_peptide AB036907_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8339-2). Non-functional genomic sequence. [Hepadnaviridae] (length=223 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLTNGTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLW
EWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036908_SHBs_P-F Product feature CHAIN AB036908_SHBs_P-F of FT:mat_peptide AB036908_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8337). Non-functional genomic sequence. [Hepadnaviridae] (length=223 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLTNGTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLW
EWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036909_SHBs_P-F Product feature CHAIN AB036909_SHBs_P-F of FT:mat_peptide AB036909_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8339-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036910_SHBs_P-F Product feature CHAIN AB036910_SHBs_P-F of FT:mat_peptide AB036910_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8251). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036911_SHBs_P-F Product feature CHAIN AB036911_SHBs_P-F of FT:mat_peptide AB036911_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8255). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036912_SHBs_P-F Product feature CHAIN AB036912_SHBs_P-F of FT:mat_peptide AB036912_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8323). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036913_SHBs_P-F Product feature CHAIN AB036913_SHBs_P-F of FT:mat_peptide AB036913_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8346). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLXGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036914_SHBs_P-F Product feature CHAIN AB036914_SHBs_P-F of FT:mat_peptide AB036914_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8349). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036915_SHBs_P-F Product feature CHAIN AB036915_SHBs_P-F of FT:mat_peptide AB036915_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8351). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036916_SHBs_P-F Product feature CHAIN AB036916_SHBs_P-F of FT:mat_peptide AB036916_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8371). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036917_SHBs_P-F Product feature CHAIN AB036917_SHBs_P-F of FT:mat_peptide AB036917_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8375-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036918_SHBs_P-F Product feature CHAIN AB036918_SHBs_P-F of FT:mat_peptide AB036918_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8375-2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036919_SHBs_P-F Product feature CHAIN AB036919_SHBs_P-F of FT:mat_peptide AB036919_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8381). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB036920_SHBs_P-F Product feature CHAIN AB036920_SHBs_P-F of FT:mat_peptide AB036920_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VNZ8624). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB037944_SHBs_P-F Product feature CHAIN AB037944_SHBs_P-F of FT:mat_peptide AB037944_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VnzHBS8375). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB037945_SHBs_P-F Product feature CHAIN AB037945_SHBs_P-F of FT:mat_peptide AB037945_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VnzHBS8349). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB037946_SHBs_P-F Product feature CHAIN AB037946_SHBs_P-F of FT:mat_peptide AB037946_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate VnzHBS8624). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB064316_SHBs_P-F Product feature CHAIN AB064316_SHBs_P-F of FT:mat_peptide AB064316_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB086397_SHBs_P-F Product feature CHAIN AB086397_SHBs_P-F of FT:mat_peptide AB086397_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate JPF1130). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAAFFLLIKILTIPRSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116549_SHBs_P-F Product feature CHAIN AB116549_SHBs_P-F of FT:mat_peptide AB116549_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116550_SHBs_P-F Product feature CHAIN AB116550_SHBs_P-F of FT:mat_peptide AB116550_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLRNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116551_SHBs_P-F Product feature CHAIN AB116551_SHBs_P-F of FT:mat_peptide AB116551_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116552_SHBs_P-F Product feature CHAIN AB116552_SHBs_P-F of FT:mat_peptide AB116552_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB116654_SHBs_P-F Product feature CHAIN AB116654_SHBs_P-F of FT:mat_peptide AB116654_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFSLLTKILTIPQSLDSWWTSLNFLGGTTGCPGQNSLSPTSNHLPTSCPPTCPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFTLLLLIFCYLWVSS
>gnl|hbvpro|AB166850_SHBs_P-F Product feature CHAIN AB166850_SHBs_P-F of FT:mat_peptide AB166850_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV-BL592). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDLWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB214516_SHBs_P-F Product feature CHAIN AB214516_SHBs_P-F of FT:mat_peptide AB214516_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV-BL597). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLIIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365437_SHBs_P-F Product feature CHAIN AB365437_SHBs_P-F of FT:mat_peptide AB365437_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL113). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNTTSGLRGPLLVLRAVCFLLTKIRTMPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLVCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGACKTCTTLAQGTSMFPSCCCSKPSDRNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFILLLPIFCYLWVSI
>gnl|hbvpro|AB365443_SHBs_P-F Product feature CHAIN AB365443_SHBs_P-F of FT:mat_peptide AB365443_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL584). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365444_SHBs_P-F Product feature CHAIN AB365444_SHBs_P-F of FT:mat_peptide AB365444_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL585). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGGLPGCLGQNSQSPTSNHLPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPVIPGSTTTSTGPCKTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSL
>gnl|hbvpro|AB365446_SHBs_P-F Product feature CHAIN AB365446_SHBs_P-F of FT:mat_peptide AB365446_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL3). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365449_SHBs_P-F Product feature CHAIN AB365449_SHBs_P-F of FT:mat_peptide AB365449_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL93). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLXGPLLVLQAVCFLWTKILKTPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCNTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365450_SHBs_P-F Product feature CHAIN AB365450_SHBs_P-F of FT:mat_peptide AB365450_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL102). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTXMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AB365453_SHBs_P-F Product feature CHAIN AB365453_SHBs_P-F of FT:mat_peptide AB365453_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BOL584). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF043561_SHBs_P-F Product feature CHAIN AF043561_SHBs_P-F of FT:mat_peptide AF043561_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=225 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCXLWVS
>gnl|hbvpro|AF043573_SHBs_P-F Product feature CHAIN AF043573_SHBs_P-F of FT:mat_peptide AF043573_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF043577_SHBs_P-F Product feature CHAIN AF043577_SHBs_P-F of FT:mat_peptide AF043577_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF043578_SHBs_P-F Product feature CHAIN AF043578_SHBs_P-F of FT:mat_peptide AF043578_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF223962_SHBs_P-F Product feature CHAIN AF223962_SHBs_P-F of FT:mat_peptide AF223962_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa4). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF223963_SHBs_P-F Product feature CHAIN AF223963_SHBs_P-F of FT:mat_peptide AF223963_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa11). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPPLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF223964_SHBs_P-F Product feature CHAIN AF223964_SHBs_P-F of FT:mat_peptide AF223964_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa14). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF223965_SHBs_P-F Product feature CHAIN AF223965_SHBs_P-F of FT:mat_peptide AF223965_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate sa16). Complete genome. [Hepadnaviridae] (length=226 residues).
MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF288623_SHBs_P-F Product feature CHAIN AF288623_SHBs_P-F of FT:mat_peptide AF288623_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA43). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWPSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF288624_SHBs_P-F Product feature CHAIN AF288624_SHBs_P-F of FT:mat_peptide AF288624_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA33). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSIMSPFIPLLPIXCYLWVSI
>gnl|hbvpro|AF288625_SHBs_P-F Product feature CHAIN AF288625_SHBs_P-F of FT:mat_peptide AF288625_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA38). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSXLSPFIPLLPIFCYLWVAI
>gnl|hbvpro|AF288626_SHBs_P-F Product feature CHAIN AF288626_SHBs_P-F of FT:mat_peptide AF288626_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF288627_SHBs_P-F Product feature CHAIN AF288627_SHBs_P-F of FT:mat_peptide AF288627_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLHVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AF288628_SHBs_P-F Product feature CHAIN AF288628_SHBs_P-F of FT:mat_peptide AF288628_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=225 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVS
>gnl|hbvpro|AY090455_SHBs_P-F Product feature CHAIN AY090455_SHBs_P-F of FT:mat_peptide AY090455_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY090456_SHBs_P-F Product feature CHAIN AY090456_SHBs_P-F of FT:mat_peptide AY090456_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMLPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGQNLCSILSPFIPLLPIFCYLWVSS
>gnl|hbvpro|AY090458_SHBs_C-F Product feature CHAIN AY090458_SHBs_C-F of FT:mat_peptide AY090458_SHBs_C-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY090459_SHBs_P-F Product feature CHAIN AY090459_SHBs_P-F of FT:mat_peptide AY090459_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY090461_SHBs_P-F Product feature CHAIN AY090461_SHBs_P-F of FT:mat_peptide AY090461_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY179735_SHBs_P-F Product feature CHAIN AY179735_SHBs_P-F of FT:mat_peptide AY179735_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA10). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264387_SHBs_P-F Product feature CHAIN AY264387_SHBs_P-F of FT:mat_peptide AY264387_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTGTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|AY264388_SHBs_P-F Product feature CHAIN AY264388_SHBs_P-F of FT:mat_peptide AY264388_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLTGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264389_SHBs_P-F Product feature CHAIN AY264389_SHBs_P-F of FT:mat_peptide AY264389_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTRILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264390_SHBs_P-F Product feature CHAIN AY264390_SHBs_P-F of FT:mat_peptide AY264390_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILRPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264391_SHBs_P-F Product feature CHAIN AY264391_SHBs_P-F of FT:mat_peptide AY264391_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLSAIWMIWYWGPNLCSILRPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264392_SHBs_P-F Product feature CHAIN AY264392_SHBs_P-F of FT:mat_peptide AY264392_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264393_SHBs_P-F Product feature CHAIN AY264393_SHBs_P-F of FT:mat_peptide AY264393_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264394_SHBs_P-F Product feature CHAIN AY264394_SHBs_P-F of FT:mat_peptide AY264394_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSRLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264395_SHBs_P-F Product feature CHAIN AY264395_SHBs_P-F of FT:mat_peptide AY264395_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQSTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264396_SHBs_P-F Product feature CHAIN AY264396_SHBs_P-F of FT:mat_peptide AY264396_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPLDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILRSFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264397_SHBs_P-F Product feature CHAIN AY264397_SHBs_P-F of FT:mat_peptide AY264397_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTATSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264398_SHBs_P-F Product feature CHAIN AY264398_SHBs_P-F of FT:mat_peptide AY264398_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPLDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLSAIWMIWYWGPNLCNILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|AY264399_SHBs_P-F Product feature CHAIN AY264399_SHBs_P-F of FT:mat_peptide AY264399_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGSPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264400_SHBs_P-F Product feature CHAIN AY264400_SHBs_P-F of FT:mat_peptide AY264400_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGR
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY264401_SHBs_P-F Product feature CHAIN AY264401_SHBs_P-F of FT:mat_peptide AY264401_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=223 residues).
MENITSGLLGPLLVLQAGYFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLTNGTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLW
EWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY311347_SHBs_P-F Product feature CHAIN AY311347_SHBs_P-F of FT:mat_peptide AY311347_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD513). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWGVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY311355_SHBs_P-F Product feature CHAIN AY311355_SHBs_P-F of FT:mat_peptide AY311355_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD14860). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
TENITSGLLGPLLVLQAVCFWLTKIRKIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|AY311358_SHBs_P-F Product feature CHAIN AY311358_SHBs_P-F of FT:mat_peptide AY311358_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD17786). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWGTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSLALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPVLPIFCYLWVYI
>gnl|hbvpro|AY311360_SHBs_P-F Product feature CHAIN AY311360_SHBs_P-F of FT:mat_peptide AY311360_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD247276). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|AY311361_SHBs_P-F Product feature CHAIN AY311361_SHBs_P-F of FT:mat_peptide AY311361_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD25021). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|AY311362_SHBs_P-F Product feature CHAIN AY311362_SHBs_P-F of FT:mat_peptide AY311362_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD27855). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGLPECPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|AY311369_SHBs_P-F Product feature CHAIN AY311369_SHBs_P-F of FT:mat_peptide AY311369_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD4139). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY311370_SHBs_P-F Product feature CHAIN AY311370_SHBs_P-F of FT:mat_peptide AY311370_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BD14999). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGGFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY739216_SHBs_P-F Product feature CHAIN AY739216_SHBs_P-F of FT:mat_peptide AY739216_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|AY739217_SHBs_P-F Product feature CHAIN AY739217_SHBs_P-F of FT:mat_peptide AY739217_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILKIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLSVCPLLPGSTTTSTGPCKTCTSLAQGTSMFPSCCCSKPSDGTCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ131124_SHBs_P-F Product feature CHAIN DQ131124_SHBs_P-F of FT:mat_peptide DQ131124_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate M-F). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ131127_SHBs_P-F Product feature CHAIN DQ131127_SHBs_P-F of FT:mat_peptide DQ131127_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate S-Fmut). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPQLPIFCYLWVSI
>gnl|hbvpro|DQ131128_SHBs_P-F Product feature CHAIN DQ131128_SHBs_P-F of FT:mat_peptide DQ131128_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate S-Fwt). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ403173_SHBs_P-F Product feature CHAIN DQ403173_SHBs_P-F of FT:mat_peptide DQ403173_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate S04007150). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMTWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ403174_SHBs_P-F Product feature CHAIN DQ403174_SHBs_P-F of FT:mat_peptide DQ403174_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate S04007356). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMTWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ403175_SHBs_P-F Product feature CHAIN DQ403175_SHBs_P-F of FT:mat_peptide DQ403175_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate s05024567). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMTWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ776247_SHBs_P-F Product feature CHAIN DQ776247_SHBs_P-F of FT:mat_peptide DQ776247_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA54). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823086_SHBs_P-F Product feature CHAIN DQ823086_SHBs_P-F of FT:mat_peptide DQ823086_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR2). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823087_SHBs_P-F Product feature CHAIN DQ823087_SHBs_P-F of FT:mat_peptide DQ823087_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FOR5). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823088_SHBs_P-F Product feature CHAIN DQ823088_SHBs_P-F of FT:mat_peptide DQ823088_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH1). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823089_SHBs_P-F Product feature CHAIN DQ823089_SHBs_P-F of FT:mat_peptide DQ823089_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH4). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823090_SHBs_P-F Product feature CHAIN DQ823090_SHBs_P-F of FT:mat_peptide DQ823090_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH6). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823091_SHBs_P-F Product feature CHAIN DQ823091_SHBs_P-F of FT:mat_peptide DQ823091_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH7). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823092_SHBs_P-F Product feature CHAIN DQ823092_SHBs_P-F of FT:mat_peptide DQ823092_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH8). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823093_SHBs_P-F Product feature CHAIN DQ823093_SHBs_P-F of FT:mat_peptide DQ823093_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CH15). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823094_SHBs_P-F Product feature CHAIN DQ823094_SHBs_P-F of FT:mat_peptide DQ823094_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA44). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ823095_SHBs_P-F Product feature CHAIN DQ823095_SHBs_P-F of FT:mat_peptide DQ823095_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA45). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899142_SHBs_P-F Product feature CHAIN DQ899142_SHBs_P-F of FT:mat_peptide DQ899142_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Warao152). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899143_SHBs_P-F Product feature CHAIN DQ899143_SHBs_P-F of FT:mat_peptide DQ899143_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Warao189). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899144_SHBs_P-F Product feature CHAIN DQ899144_SHBs_P-F of FT:mat_peptide DQ899144_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira75). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899145_SHBs_P-F Product feature CHAIN DQ899145_SHBs_P-F of FT:mat_peptide DQ899145_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira76). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899146_SHBs_P-F Product feature CHAIN DQ899146_SHBs_P-F of FT:mat_peptide DQ899146_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira80). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLPRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899147_SHBs_P-F Product feature CHAIN DQ899147_SHBs_P-F of FT:mat_peptide DQ899147_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira116). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLQCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQRTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899148_SHBs_P-F Product feature CHAIN DQ899148_SHBs_P-F of FT:mat_peptide DQ899148_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Yanomami114). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899149_SHBs_P-F Product feature CHAIN DQ899149_SHBs_P-F of FT:mat_peptide DQ899149_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Piaroa3019). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|DQ899150_SHBs_P-F Product feature CHAIN DQ899150_SHBs_P-F of FT:mat_peptide DQ899150_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Colombia8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYRWVSI
>gnl|hbvpro|EF397981_SHBs_P-F Product feature CHAIN EF397981_SHBs_P-F of FT:mat_peptide EF397981_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bucaramanga 11). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF397982_SHBs_P-F Product feature CHAIN EF397982_SHBs_P-F of FT:mat_peptide EF397982_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bucaramanga 14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF397983_SHBs_P-F Product feature CHAIN EF397983_SHBs_P-F of FT:mat_peptide EF397983_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bogota 16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF397984_SHBs_P-F Product feature CHAIN EF397984_SHBs_P-F of FT:mat_peptide EF397984_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bogota 33). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLIKILTIPKSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLLIFCYLWVSI
>gnl|hbvpro|EF397985_SHBs_P-F Product feature CHAIN EF397985_SHBs_P-F of FT:mat_peptide EF397985_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bogota 36). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF397986_SHBs_P-F Product feature CHAIN EF397986_SHBs_P-F of FT:mat_peptide EF397986_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bogota 63). Partial genome (Contains: HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSCLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSTLSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF397987_SHBs_P-F Product feature CHAIN EF397987_SHBs_P-F of FT:mat_peptide EF397987_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bogota 67). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFYWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF397989_SHBs_P-F Product feature CHAIN EF397989_SHBs_P-F of FT:mat_peptide EF397989_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bogota 70). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF397990_SHBs_P-F Product feature CHAIN EF397990_SHBs_P-F of FT:mat_peptide EF397990_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Bogota 72). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF398029_SHBs_P-F Product feature CHAIN EF398029_SHBs_P-F of FT:mat_peptide EF398029_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398030_SHBs_P-F Product feature CHAIN EF398030_SHBs_P-F of FT:mat_peptide EF398030_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398031_SHBs_P-F Product feature CHAIN EF398031_SHBs_P-F of FT:mat_peptide EF398031_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 29). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398032_SHBs_P-F Product feature CHAIN EF398032_SHBs_P-F of FT:mat_peptide EF398032_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 32). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398033_SHBs_P-F Product feature CHAIN EF398033_SHBs_P-F of FT:mat_peptide EF398033_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 55). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398034_SHBs_P-F Product feature CHAIN EF398034_SHBs_P-F of FT:mat_peptide EF398034_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 60). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVSQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398035_SHBs_P-F Product feature CHAIN EF398035_SHBs_P-F of FT:mat_peptide EF398035_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 66). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398037_SHBs_P-F Product feature CHAIN EF398037_SHBs_P-F of FT:mat_peptide EF398037_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 82). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLSGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398038_SHBs_P-F Product feature CHAIN EF398038_SHBs_P-F of FT:mat_peptide EF398038_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 85). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398039_SHBs_P-F Product feature CHAIN EF398039_SHBs_P-F of FT:mat_peptide EF398039_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 94). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398040_SHBs_P-F Product feature CHAIN EF398040_SHBs_P-F of FT:mat_peptide EF398040_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 139). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|EF398041_SHBs_P-F Product feature CHAIN EF398041_SHBs_P-F of FT:mat_peptide EF398041_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Japreira 121). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF576808_SHBs_P-F Product feature CHAIN EF576808_SHBs_P-F of FT:mat_peptide EF576808_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SAL7). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPRCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF576812_SHBs_P-F Product feature CHAIN EF576812_SHBs_P-F of FT:mat_peptide EF576812_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SAL13). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690470_SHBs_P-F Product feature CHAIN EF690470_SHBs_P-F of FT:mat_peptide EF690470_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 325-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690484_SHBs_P-F Product feature CHAIN EF690484_SHBs_P-F of FT:mat_peptide EF690484_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 211-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690485_SHBs_P-F Product feature CHAIN EF690485_SHBs_P-F of FT:mat_peptide EF690485_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 321-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690486_SHBs_P-F Product feature CHAIN EF690486_SHBs_P-F of FT:mat_peptide EF690486_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 323-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690487_SHBs_P-F Product feature CHAIN EF690487_SHBs_P-F of FT:mat_peptide EF690487_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate apurina_01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690488_SHBs_P-F Product feature CHAIN EF690488_SHBs_P-F of FT:mat_peptide EF690488_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate apurina_02). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690489_SHBs_P-F Product feature CHAIN EF690489_SHBs_P-F of FT:mat_peptide EF690489_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate apurina_03). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690490_SHBs_P-F Product feature CHAIN EF690490_SHBs_P-F of FT:mat_peptide EF690490_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate apurina_04). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690491_SHBs_P-F Product feature CHAIN EF690491_SHBs_P-F of FT:mat_peptide EF690491_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate apurina_05). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690492_SHBs_P-F Product feature CHAIN EF690492_SHBs_P-F of FT:mat_peptide EF690492_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 213-NE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690493_SHBs_P-F Product feature CHAIN EF690493_SHBs_P-F of FT:mat_peptide EF690493_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 324-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690494_SHBs_P-F Product feature CHAIN EF690494_SHBs_P-F of FT:mat_peptide EF690494_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 222-NE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690495_SHBs_P-F Product feature CHAIN EF690495_SHBs_P-F of FT:mat_peptide EF690495_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 231-NE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690496_SHBs_P-F Product feature CHAIN EF690496_SHBs_P-F of FT:mat_peptide EF690496_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 016-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690497_SHBs_P-F Product feature CHAIN EF690497_SHBs_P-F of FT:mat_peptide EF690497_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 058-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690498_SHBs_P-F Product feature CHAIN EF690498_SHBs_P-F of FT:mat_peptide EF690498_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 002-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690499_SHBs_P-F Product feature CHAIN EF690499_SHBs_P-F of FT:mat_peptide EF690499_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 003-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690500_SHBs_P-F Product feature CHAIN EF690500_SHBs_P-F of FT:mat_peptide EF690500_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 004-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690501_SHBs_P-F Product feature CHAIN EF690501_SHBs_P-F of FT:mat_peptide EF690501_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 307-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690502_SHBs_P-F Product feature CHAIN EF690502_SHBs_P-F of FT:mat_peptide EF690502_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 238-NE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690503_SHBs_P-F Product feature CHAIN EF690503_SHBs_P-F of FT:mat_peptide EF690503_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 327-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690504_SHBs_P-F Product feature CHAIN EF690504_SHBs_P-F of FT:mat_peptide EF690504_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 313-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690505_SHBs_P-F Product feature CHAIN EF690505_SHBs_P-F of FT:mat_peptide EF690505_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 023-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSF
>gnl|hbvpro|EF690506_SHBs_P-F Product feature CHAIN EF690506_SHBs_P-F of FT:mat_peptide EF690506_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 227-NE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690507_SHBs_P-F Product feature CHAIN EF690507_SHBs_P-F of FT:mat_peptide EF690507_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 210-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPECPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVTWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690508_SHBs_P-F Product feature CHAIN EF690508_SHBs_P-F of FT:mat_peptide EF690508_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 052-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSRNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTITGPCKTCTTIAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690509_SHBs_P-F Product feature CHAIN EF690509_SHBs_P-F of FT:mat_peptide EF690509_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 322-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLRPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCICIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690510_SHBs_P-F Product feature CHAIN EF690510_SHBs_P-F of FT:mat_peptide EF690510_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 209-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTTPQSLDSWWTSLNFLGELPACPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVRFVQWCVGLSPTVWLLVILMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690511_SHBs_P-F Product feature CHAIN EF690511_SHBs_P-F of FT:mat_peptide EF690511_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 179-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVSFLLIKILTIPQSLDSWWTSLNSLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLYSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690512_SHBs_P-F Product feature CHAIN EF690512_SHBs_P-F of FT:mat_peptide EF690512_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 326-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690513_SHBs_P-F Product feature CHAIN EF690513_SHBs_P-F of FT:mat_peptide EF690513_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 221-NE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EF690514_SHBs_P-F Product feature CHAIN EF690514_SHBs_P-F of FT:mat_peptide EF690514_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 232-NE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU159674_SHBs_P-F Product feature CHAIN EU159674_SHBs_P-F of FT:mat_peptide EU159674_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Irish-18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCSGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU366116_SHBs_P-F Product feature CHAIN EU366116_SHBs_P-F of FT:mat_peptide EU366116_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA61). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU366118_SHBs_P-F Product feature CHAIN EU366118_SHBs_P-F of FT:mat_peptide EU366118_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA67). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU366132_SHBs_P-F Product feature CHAIN EU366132_SHBs_P-F of FT:mat_peptide EU366132_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA95). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLRPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPLTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPIVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU366133_SHBs_P-F Product feature CHAIN EU366133_SHBs_P-F of FT:mat_peptide EU366133_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA96). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU670260_SHBs_P-F Product feature CHAIN EU670260_SHBs_P-F of FT:mat_peptide EU670260_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 453). Partial genome (Contains: HBx, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLHVSQAVCSLLTKILTIPQRLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU670261_SHBs_P-F Product feature CHAIN EU670261_SHBs_P-F of FT:mat_peptide EU670261_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 499). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=226 residues).
MDNITSGLPGPLLVSQAVCSSLTKILTIPKRLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPESTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|EU670262_SHBs_P-F Product feature CHAIN EU670262_SHBs_P-F of FT:mat_peptide EU670262_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 549). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ589065_SHBs_P-F Product feature CHAIN FJ589065_SHBs_P-F of FT:mat_peptide FJ589065_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_024). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ589066_SHBs_P-F Product feature CHAIN FJ589066_SHBs_P-F of FT:mat_peptide FJ589066_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_054). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSTLRPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ589067_SHBs_P-F Product feature CHAIN FJ589067_SHBs_P-F of FT:mat_peptide FJ589067_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_083). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCRILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ589070_SHBs_P-F Product feature CHAIN FJ589070_SHBs_P-F of FT:mat_peptide FJ589070_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate UdeA_009). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLEGLPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657519_SHBs_P-F Product feature CHAIN FJ657519_SHBs_P-F of FT:mat_peptide FJ657519_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA110). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657522_SHBs_P-F Product feature CHAIN FJ657522_SHBs_P-F of FT:mat_peptide FJ657522_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA116). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657525_SHBs_P-F Product feature CHAIN FJ657525_SHBs_P-F of FT:mat_peptide FJ657525_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA107). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLSFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657528_SHBs_P-F Product feature CHAIN FJ657528_SHBs_P-F of FT:mat_peptide FJ657528_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA108). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ657529_SHBs_P-F Product feature CHAIN FJ657529_SHBs_P-F of FT:mat_peptide FJ657529_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BA109). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709457_SHBs_P-F Product feature CHAIN FJ709457_SHBs_P-F of FT:mat_peptide FJ709457_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI1). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709458_SHBs_P-F Product feature CHAIN FJ709458_SHBs_P-F of FT:mat_peptide FJ709458_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI2). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709459_SHBs_P-F Product feature CHAIN FJ709459_SHBs_P-F of FT:mat_peptide FJ709459_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI3). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709460_SHBs_P-F Product feature CHAIN FJ709460_SHBs_P-F of FT:mat_peptide FJ709460_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI4). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709461_SHBs_P-F Product feature CHAIN FJ709461_SHBs_P-F of FT:mat_peptide FJ709461_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709462_SHBs_P-F Product feature CHAIN FJ709462_SHBs_P-F of FT:mat_peptide FJ709462_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI6). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709463_SHBs_P-F Product feature CHAIN FJ709463_SHBs_P-F of FT:mat_peptide FJ709463_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI7). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFXPLLPIFCYLWVSI
>gnl|hbvpro|FJ709464_SHBs_P-F Product feature CHAIN FJ709464_SHBs_P-F of FT:mat_peptide FJ709464_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI8). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709465_SHBs_P-F Product feature CHAIN FJ709465_SHBs_P-F of FT:mat_peptide FJ709465_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI9). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709466_SHBs_P-F Product feature CHAIN FJ709466_SHBs_P-F of FT:mat_peptide FJ709466_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTMPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLWNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709468_SHBs_P-F Product feature CHAIN FJ709468_SHBs_P-F of FT:mat_peptide FJ709468_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLGSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709469_SHBs_P-F Product feature CHAIN FJ709469_SHBs_P-F of FT:mat_peptide FJ709469_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQNLDSWWTSLNFLGGTXGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVST
>gnl|hbvpro|FJ709473_SHBs_P-F Product feature CHAIN FJ709473_SHBs_P-F of FT:mat_peptide FJ709473_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCSLLIKILTIPQNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709476_SHBs_P-F Product feature CHAIN FJ709476_SHBs_P-F of FT:mat_peptide FJ709476_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709478_SHBs_P-F Product feature CHAIN FJ709478_SHBs_P-F of FT:mat_peptide FJ709478_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCSLLIKILTIPQNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709480_SHBs_P-F Product feature CHAIN FJ709480_SHBs_P-F of FT:mat_peptide FJ709480_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCSLLTKILTIPQXLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709481_SHBs_P-F Product feature CHAIN FJ709481_SHBs_P-F of FT:mat_peptide FJ709481_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI25). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709482_SHBs_P-F Product feature CHAIN FJ709482_SHBs_P-F of FT:mat_peptide FJ709482_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGQNLCXILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709484_SHBs_P-F Product feature CHAIN FJ709484_SHBs_P-F of FT:mat_peptide FJ709484_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709485_SHBs_P-F Product feature CHAIN FJ709485_SHBs_P-F of FT:mat_peptide FJ709485_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVISMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709487_SHBs_P-F Product feature CHAIN FJ709487_SHBs_P-F of FT:mat_peptide FJ709487_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI34). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709488_SHBs_P-F Product feature CHAIN FJ709488_SHBs_P-F of FT:mat_peptide FJ709488_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI35). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709491_SHBs_P-F Product feature CHAIN FJ709491_SHBs_P-F of FT:mat_peptide FJ709491_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI38). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709493_SHBs_P-F Product feature CHAIN FJ709493_SHBs_P-F of FT:mat_peptide FJ709493_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709494_SHBs_P-F Product feature CHAIN FJ709494_SHBs_P-F of FT:mat_peptide FJ709494_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI41). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709495_SHBs_P-F Product feature CHAIN FJ709495_SHBs_P-F of FT:mat_peptide FJ709495_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI42). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|FJ709496_SHBs_P-F Product feature CHAIN FJ709496_SHBs_P-F of FT:mat_peptide FJ709496_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CHI43). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486140_SHBs_P-F Product feature CHAIN GQ486140_SHBs_P-F of FT:mat_peptide GQ486140_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVXFLLTKILTXPXSLDSWWTSLNFLGXLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILXPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486468_SHBs_P-F Product feature CHAIN GQ486468_SHBs_P-F of FT:mat_peptide GQ486468_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS433). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486493_SHBs_P-F Product feature CHAIN GQ486493_SHBs_P-F of FT:mat_peptide GQ486493_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS458). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486515_SHBs_P-F Product feature CHAIN GQ486515_SHBs_P-F of FT:mat_peptide GQ486515_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS480). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCXKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486537_SHBs_P-F Product feature CHAIN GQ486537_SHBs_P-F of FT:mat_peptide GQ486537_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS502). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486570_SHBs_P-F Product feature CHAIN GQ486570_SHBs_P-F of FT:mat_peptide GQ486570_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS535). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486582_SHBs_P-F Product feature CHAIN GQ486582_SHBs_P-F of FT:mat_peptide GQ486582_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS547). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486626_SHBs_P-F Product feature CHAIN GQ486626_SHBs_P-F of FT:mat_peptide GQ486626_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS591). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCXKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486779_SHBs_P-F Product feature CHAIN GQ486779_SHBs_P-F of FT:mat_peptide GQ486779_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS744). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPECPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|GQ486830_SHBs_P-F Product feature CHAIN GQ486830_SHBs_P-F of FT:mat_peptide GQ486830_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GS795). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPXSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLXLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLXVIWMIWYWGPNLCSILSPFIPLXPIFCYLWVSI
>gnl|hbvpro|HE981181_SHBs_P-F Product feature CHAIN HE981181_SHBs_P-F of FT:mat_peptide HE981181_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HE981182_SHBs_P-F Product feature CHAIN HE981182_SHBs_P-F of FT:mat_peptide HE981182_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVPFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HE981183_SHBs_P-F Product feature CHAIN HE981183_SHBs_P-F of FT:mat_peptide HE981183_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVPFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM101096_SHBs_P-F Product feature CHAIN HM101096_SHBs_P-F of FT:mat_peptide HM101096_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 36_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLSVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM101097_SHBs_P-F Product feature CHAIN HM101097_SHBs_P-F of FT:mat_peptide HM101097_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 17_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM101098_SHBs_P-F Product feature CHAIN HM101098_SHBs_P-F of FT:mat_peptide HM101098_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 18_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM101125_SHBs_P-F Product feature CHAIN HM101125_SHBs_P-F of FT:mat_peptide HM101125_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 02_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSTLSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM101130_SHBs_P-F Product feature CHAIN HM101130_SHBs_P-F of FT:mat_peptide HM101130_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 11_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467760_SHBs_P-F Product feature CHAIN HM467760_SHBs_P-F of FT:mat_peptide HM467760_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1015_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSRNFLGDLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467761_SHBs_P-F Product feature CHAIN HM467761_SHBs_P-F of FT:mat_peptide HM467761_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1021_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467762_SHBs_P-F Product feature CHAIN HM467762_SHBs_P-F of FT:mat_peptide HM467762_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1022_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467771_SHBs_P-F Product feature CHAIN HM467771_SHBs_P-F of FT:mat_peptide HM467771_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1106_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIISGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467772_SHBs_P-F Product feature CHAIN HM467772_SHBs_P-F of FT:mat_peptide HM467772_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1107_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467783_SHBs_P-F Product feature CHAIN HM467783_SHBs_P-F of FT:mat_peptide HM467783_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1147_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVFFLLIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467784_SHBs_P-F Product feature CHAIN HM467784_SHBs_P-F of FT:mat_peptide HM467784_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1148_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGPHGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467785_SHBs_P-F Product feature CHAIN HM467785_SHBs_P-F of FT:mat_peptide HM467785_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1149_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM467786_SHBs_P-F Product feature CHAIN HM467786_SHBs_P-F of FT:mat_peptide HM467786_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1151_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPECPGQNSQSPTSNHLLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585186_SHBs_P-F Product feature CHAIN HM585186_SHBs_P-F of FT:mat_peptide HM585186_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH4). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585187_SHBs_P-F Product feature CHAIN HM585187_SHBs_P-F of FT:mat_peptide HM585187_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH6). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585188_SHBs_P-F Product feature CHAIN HM585188_SHBs_P-F of FT:mat_peptide HM585188_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH7). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585189_SHBs_P-F Product feature CHAIN HM585189_SHBs_P-F of FT:mat_peptide HM585189_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH8). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585190_SHBs_P-F Product feature CHAIN HM585190_SHBs_P-F of FT:mat_peptide HM585190_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH9). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585191_SHBs_P-F Product feature CHAIN HM585191_SHBs_P-F of FT:mat_peptide HM585191_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH10). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585192_SHBs_P-F Product feature CHAIN HM585192_SHBs_P-F of FT:mat_peptide HM585192_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH11). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585193_SHBs_P-F Product feature CHAIN HM585193_SHBs_P-F of FT:mat_peptide HM585193_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH12). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585194_SHBs_P-F Product feature CHAIN HM585194_SHBs_P-F of FT:mat_peptide HM585194_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH16). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585195_SHBs_P-F Product feature CHAIN HM585195_SHBs_P-F of FT:mat_peptide HM585195_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH17). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585196_SHBs_P-F Product feature CHAIN HM585196_SHBs_P-F of FT:mat_peptide HM585196_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH18). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585197_SHBs_P-F Product feature CHAIN HM585197_SHBs_P-F of FT:mat_peptide HM585197_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH20). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585198_SHBs_P-F Product feature CHAIN HM585198_SHBs_P-F of FT:mat_peptide HM585198_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH1). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585199_SHBs_P-F Product feature CHAIN HM585199_SHBs_P-F of FT:mat_peptide HM585199_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH2). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM585200_SHBs_P-F Product feature CHAIN HM585200_SHBs_P-F of FT:mat_peptide HM585200_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH15). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM590471_SHBs_P-F Product feature CHAIN HM590471_SHBs_P-F of FT:mat_peptide HM590471_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH13). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM590472_SHBs_P-F Product feature CHAIN HM590472_SHBs_P-F of FT:mat_peptide HM590472_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH19). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM590473_SHBs_P-F Product feature CHAIN HM590473_SHBs_P-F of FT:mat_peptide HM590473_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH14). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM622135_SHBs_P-F Product feature CHAIN HM622135_SHBs_P-F of FT:mat_peptide HM622135_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH5). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGHLGPLLVLQAVCSLLTKIRTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HM627320_SHBs_P-F Product feature CHAIN HM627320_SHBs_P-F of FT:mat_peptide HM627320_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HCUCH21). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|HQ378247_SHBs_P-F Product feature CHAIN HQ378247_SHBs_P-F of FT:mat_peptide HQ378247_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate IRL-2009). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JF439884_SHBs_P-F Product feature CHAIN JF439884_SHBs_P-F of FT:mat_peptide JF439884_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate ANG03G1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNRCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JF439885_SHBs_P-F Product feature CHAIN JF439885_SHBs_P-F of FT:mat_peptide JF439885_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate ANG03G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNRCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN226078_SHBs_P-F Product feature CHAIN JN226078_SHBs_P-F of FT:mat_peptide JN226078_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PTV709_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604198_SHBs_P-F Product feature CHAIN JN604198_SHBs_P-F of FT:mat_peptide JN604198_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 477-4319-2). Partial genome (Contains: HBe, HBc, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSLSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLVVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604201_SHBs_P-F Product feature CHAIN JN604201_SHBs_P-F of FT:mat_peptide JN604201_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 478-2026-3). Partial genome (Contains: HBe, HBc, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIRILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLFLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWXSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604211_SHBs_P-F Product feature CHAIN JN604211_SHBs_P-F of FT:mat_peptide JN604211_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 476-7401-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVFFLLTKILTIPXXLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604225_SHBs_P-F Product feature CHAIN JN604225_SHBs_P-F of FT:mat_peptide JN604225_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 477-5408-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGLNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604233_SHBs_P-F Product feature CHAIN JN604233_SHBs_P-F of FT:mat_peptide JN604233_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 478-0355-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTTTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN604271_SHBs_P-F Product feature CHAIN JN604271_SHBs_P-F of FT:mat_peptide JN604271_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 476-8502-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPRSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688691_SHBs_P-F Product feature CHAIN JN688691_SHBs_P-F of FT:mat_peptide JN688691_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV122). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688699_SHBs_P-F Product feature CHAIN JN688699_SHBs_P-F of FT:mat_peptide JN688699_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV133). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688701_SHBs_P-F Product feature CHAIN JN688701_SHBs_P-F of FT:mat_peptide JN688701_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV135). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVXFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688703_SHBs_P-F Product feature CHAIN JN688703_SHBs_P-F of FT:mat_peptide JN688703_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV137). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688709_SHBs_P-F Product feature CHAIN JN688709_SHBs_P-F of FT:mat_peptide JN688709_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV143). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQGVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN688720_SHBs_P-F Product feature CHAIN JN688720_SHBs_P-F of FT:mat_peptide JN688720_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV224). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFFSLIKIRTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792914_SHBs_P-F Product feature CHAIN JN792914_SHBs_P-F of FT:mat_peptide JN792914_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8052-03506). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792916_SHBs_P-F Product feature CHAIN JN792916_SHBs_P-F of FT:mat_peptide JN792916_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7703-00047). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MDSITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792917_SHBs_P-F Product feature CHAIN JN792917_SHBs_P-F of FT:mat_peptide JN792917_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8070-05260). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTSFLTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTFCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792918_SHBs_P-F Product feature CHAIN JN792918_SHBs_P-F of FT:mat_peptide JN792918_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8070-03547). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792919_SHBs_P-F Product feature CHAIN JN792919_SHBs_P-F of FT:mat_peptide JN792919_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8327-13282). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792920_SHBs_P-F Product feature CHAIN JN792920_SHBs_P-F of FT:mat_peptide JN792920_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8327-05424). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792921_SHBs_P-F Product feature CHAIN JN792921_SHBs_P-F of FT:mat_peptide JN792921_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9401-03738). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGXPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN792922_SHBs_P-F Product feature CHAIN JN792922_SHBs_P-F of FT:mat_peptide JN792922_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9401-03301). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN811655_SHBs_P-F Product feature CHAIN JN811655_SHBs_P-F of FT:mat_peptide JN811655_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3Mg). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSIVSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN811656_SHBs_P-F Product feature CHAIN JN811656_SHBs_P-F of FT:mat_peptide JN811656_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 4Mg). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN983942_SHBs_P-F Product feature CHAIN JN983942_SHBs_P-F of FT:mat_peptide JN983942_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8069). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN983943_SHBs_P-F Product feature CHAIN JN983943_SHBs_P-F of FT:mat_peptide JN983943_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8087). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN983944_SHBs_P-F Product feature CHAIN JN983944_SHBs_P-F of FT:mat_peptide JN983944_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8089). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKIRKIPQNLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN983945_SHBs_P-F Product feature CHAIN JN983945_SHBs_P-F of FT:mat_peptide JN983945_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8093). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVSSLLIKILTIPQSLDSWWTSLNSLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN983946_SHBs_P-F Product feature CHAIN JN983946_SHBs_P-F of FT:mat_peptide JN983946_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNSLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JN983947_SHBs_P-F Product feature CHAIN JN983947_SHBs_P-F of FT:mat_peptide JN983947_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8128). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLSIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JQ272888_SHBs_P-F Product feature CHAIN JQ272888_SHBs_P-F of FT:mat_peptide JQ272888_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV_MDQ29). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSTLSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JX079936_SHBs_P-F Product feature CHAIN JX079936_SHBs_P-F of FT:mat_peptide JX079936_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FF2). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JX079937_SHBs_P-F Product feature CHAIN JX079937_SHBs_P-F of FT:mat_peptide JX079937_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FF5). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFSYLWVSI
>gnl|hbvpro|JX849588_SHBs_P-F Product feature CHAIN JX849588_SHBs_P-F of FT:mat_peptide JX849588_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PTV709_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JX849635_SHBs_P-F Product feature CHAIN JX849635_SHBs_P-F of FT:mat_peptide JX849635_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PTV069). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLXLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|JX849637_SHBs_P-F Product feature CHAIN JX849637_SHBs_P-F of FT:mat_peptide JX849637_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 355_F). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113364_SHBs_P-F Product feature CHAIN KC113364_SHBs_P-F of FT:mat_peptide KC113364_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI07). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113368_SHBs_P-F Product feature CHAIN KC113368_SHBs_P-F of FT:mat_peptide KC113368_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI55-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113381_SHBs_P-F Product feature CHAIN KC113381_SHBs_P-F of FT:mat_peptide KC113381_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI239-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTGTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KC113383_SHBs_P-F Product feature CHAIN KC113383_SHBs_P-F of FT:mat_peptide KC113383_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI291-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMLPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGQNLCSILSPFIPLLPIFCYLWVSS
>gnl|hbvpro|KC113386_SHBs_P-F Product feature CHAIN KC113386_SHBs_P-F of FT:mat_peptide KC113386_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI349-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113389_SHBs_P-F Product feature CHAIN KC113389_SHBs_P-F of FT:mat_peptide KC113389_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI390-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILRPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113393_SHBs_P-F Product feature CHAIN KC113393_SHBs_P-F of FT:mat_peptide KC113393_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI459-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113394_SHBs_P-F Product feature CHAIN KC113394_SHBs_P-F of FT:mat_peptide KC113394_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI481-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113395_SHBs_P-F Product feature CHAIN KC113395_SHBs_P-F of FT:mat_peptide KC113395_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI501-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113399_SHBs_P-F Product feature CHAIN KC113399_SHBs_P-F of FT:mat_peptide KC113399_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI642-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTATSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC113400_SHBs_P-F Product feature CHAIN KC113400_SHBs_P-F of FT:mat_peptide KC113400_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PI650-HBVHIV). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494394_SHBs_P-F Product feature CHAIN KC494394_SHBs_P-F of FT:mat_peptide KC494394_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR12-NORTH). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494395_SHBs_P-F Product feature CHAIN KC494395_SHBs_P-F of FT:mat_peptide KC494395_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR11-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494396_SHBs_P-F Product feature CHAIN KC494396_SHBs_P-F of FT:mat_peptide KC494396_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR10-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLHAVCFLLTKILTMPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494397_SHBs_P-F Product feature CHAIN KC494397_SHBs_P-F of FT:mat_peptide KC494397_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR9-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNTYSGLLRPLLVSQAVCSLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMVPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494398_SHBs_P-F Product feature CHAIN KC494398_SHBs_P-F of FT:mat_peptide KC494398_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR8-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494399_SHBs_P-F Product feature CHAIN KC494399_SHBs_P-F of FT:mat_peptide KC494399_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR7-CENTRAL). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVYFLLIKILIMPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494400_SHBs_P-F Product feature CHAIN KC494400_SHBs_P-F of FT:mat_peptide KC494400_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR6-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGRTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494401_SHBs_P-F Product feature CHAIN KC494401_SHBs_P-F of FT:mat_peptide KC494401_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR5-SOUTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494402_SHBs_P-F Product feature CHAIN KC494402_SHBs_P-F of FT:mat_peptide KC494402_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR4-NORTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494403_SHBs_P-F Product feature CHAIN KC494403_SHBs_P-F of FT:mat_peptide KC494403_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR3-NORTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494404_SHBs_P-F Product feature CHAIN KC494404_SHBs_P-F of FT:mat_peptide KC494404_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR2-NORTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KC494405_SHBs_P-F Product feature CHAIN KC494405_SHBs_P-F of FT:mat_peptide KC494405_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate BR1-NORTHEAST). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF199901_SHBs_P-F Product feature CHAIN KF199901_SHBs_P-F of FT:mat_peptide KF199901_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RVLA). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASVRFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414649_SHBs_P-F Product feature CHAIN KF414649_SHBs_P-F of FT:mat_peptide KF414649_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B412). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414650_SHBs_P-F Product feature CHAIN KF414650_SHBs_P-F of FT:mat_peptide KF414650_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B413). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414654_SHBs_P-F Product feature CHAIN KF414654_SHBs_P-F of FT:mat_peptide KF414654_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B2106). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGIPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414655_SHBs_P-F Product feature CHAIN KF414655_SHBs_P-F of FT:mat_peptide KF414655_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B2175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414656_SHBs_P-F Product feature CHAIN KF414656_SHBs_P-F of FT:mat_peptide KF414656_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B2176). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTNILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILPLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWDWASARFPWLSSLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414658_SHBs_P-F Product feature CHAIN KF414658_SHBs_P-F of FT:mat_peptide KF414658_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B2292). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414659_SHBs_P-F Product feature CHAIN KF414659_SHBs_P-F of FT:mat_peptide KF414659_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B2337). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414662_SHBs_P-F Product feature CHAIN KF414662_SHBs_P-F of FT:mat_peptide KF414662_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B2517). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYHGILPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWGWASARFSWLSLLVQFVQWCVELSPTVWLLVILMIWYWGPNLCSILSHFIPLLPIFWYLWVYI
>gnl|hbvpro|KF414664_SHBs_P-F Product feature CHAIN KF414664_SHBs_P-F of FT:mat_peptide KF414664_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B70r). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWFWGPNLYNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414666_SHBs_P-F Product feature CHAIN KF414666_SHBs_P-F of FT:mat_peptide KF414666_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B112r). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414669_SHBs_P-F Product feature CHAIN KF414669_SHBs_P-F of FT:mat_peptide KF414669_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B140r). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414670_SHBs_P-F Product feature CHAIN KF414670_SHBs_P-F of FT:mat_peptide KF414670_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B159r). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVLLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414671_SHBs_P-F Product feature CHAIN KF414671_SHBs_P-F of FT:mat_peptide KF414671_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B233). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGPSMFPSCCCSKPLDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414672_SHBs_P-F Product feature CHAIN KF414672_SHBs_P-F of FT:mat_peptide KF414672_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B266). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414673_SHBs_P-F Product feature CHAIN KF414673_SHBs_P-F of FT:mat_peptide KF414673_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B409). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414674_SHBs_P-F Product feature CHAIN KF414674_SHBs_P-F of FT:mat_peptide KF414674_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B1528). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=223 residues).
ITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIF
LFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLW
EWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCITLSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414675_SHBs_P-F Product feature CHAIN KF414675_SHBs_P-F of FT:mat_peptide KF414675_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B1646). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KF414676_SHBs_P-F Product feature CHAIN KF414676_SHBs_P-F of FT:mat_peptide KF414676_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B1788). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF414677_SHBs_P-F Product feature CHAIN KF414677_SHBs_P-F of FT:mat_peptide KF414677_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B1807). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KF779236_SHBs_P-F Product feature CHAIN KF779236_SHBs_P-F of FT:mat_peptide KF779236_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate DEN6107). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ586805_SHBs_P-F Product feature CHAIN KJ586805_SHBs_P-F of FT:mat_peptide KJ586805_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ586806_SHBs_P-F Product feature CHAIN KJ586806_SHBs_P-F of FT:mat_peptide KJ586806_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ586807_SHBs_P-F Product feature CHAIN KJ586807_SHBs_P-F of FT:mat_peptide KJ586807_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLNSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFMPLLPIFCYLWVSI
>gnl|hbvpro|KJ586808_SHBs_P-F Product feature CHAIN KJ586808_SHBs_P-F of FT:mat_peptide KJ586808_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638656_SHBs_P-F Product feature CHAIN KJ638656_SHBs_P-F of FT:mat_peptide KJ638656_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT004). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNTTSGHLGLLLVLQAVCFLLTKILKIPQNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSRPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLGSILSHFIPLLPIFCYLWGSI
>gnl|hbvpro|KJ638657_SHBs_P-F Product feature CHAIN KJ638657_SHBs_P-F of FT:mat_peptide KJ638657_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT013). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPXSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638659_SHBs_P-F Product feature CHAIN KJ638659_SHBs_P-F of FT:mat_peptide KJ638659_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT025). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLXKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638660_SHBs_P-F Product feature CHAIN KJ638660_SHBs_P-F of FT:mat_peptide KJ638660_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT030). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPXLCXILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638662_SHBs_P-F Product feature CHAIN KJ638662_SHBs_P-F of FT:mat_peptide KJ638662_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT040). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSRNFLGEIPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ638664_SHBs_P-F Product feature CHAIN KJ638664_SHBs_P-F of FT:mat_peptide KJ638664_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT049). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVSFLLTKILTIPQSLDSWWTSLNFLGGPPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KJ676694_SHBs_P-F Product feature CHAIN KJ676694_SHBs_P-F of FT:mat_peptide KJ676694_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4_03). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVSFLLIKILTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843163_SHBs_P-F Product feature CHAIN KJ843163_SHBs_P-F of FT:mat_peptide KJ843163_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag01). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVRFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843164_SHBs_P-F Product feature CHAIN KJ843164_SHBs_P-F of FT:mat_peptide KJ843164_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag02). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843167_SHBs_P-F Product feature CHAIN KJ843167_SHBs_P-F of FT:mat_peptide KJ843167_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag05). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843168_SHBs_P-F Product feature CHAIN KJ843168_SHBs_P-F of FT:mat_peptide KJ843168_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag06). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843169_SHBs_P-F Product feature CHAIN KJ843169_SHBs_P-F of FT:mat_peptide KJ843169_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag07). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843170_SHBs_P-F Product feature CHAIN KJ843170_SHBs_P-F of FT:mat_peptide KJ843170_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag08). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843171_SHBs_P-F Product feature CHAIN KJ843171_SHBs_P-F of FT:mat_peptide KJ843171_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag09). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843174_SHBs_P-F Product feature CHAIN KJ843174_SHBs_P-F of FT:mat_peptide KJ843174_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag12). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843175_SHBs_P-F Product feature CHAIN KJ843175_SHBs_P-F of FT:mat_peptide KJ843175_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag13). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843176_SHBs_P-F Product feature CHAIN KJ843176_SHBs_P-F of FT:mat_peptide KJ843176_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag14). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843177_SHBs_P-F Product feature CHAIN KJ843177_SHBs_P-F of FT:mat_peptide KJ843177_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag15). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843178_SHBs_P-F Product feature CHAIN KJ843178_SHBs_P-F of FT:mat_peptide KJ843178_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag16). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843179_SHBs_P-F Product feature CHAIN KJ843179_SHBs_P-F of FT:mat_peptide KJ843179_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag17). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843180_SHBs_P-F Product feature CHAIN KJ843180_SHBs_P-F of FT:mat_peptide KJ843180_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag18). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843181_SHBs_P-F Product feature CHAIN KJ843181_SHBs_P-F of FT:mat_peptide KJ843181_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag20). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843185_SHBs_P-F Product feature CHAIN KJ843185_SHBs_P-F of FT:mat_peptide KJ843185_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag24). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843189_SHBs_P-F Product feature CHAIN KJ843189_SHBs_P-F of FT:mat_peptide KJ843189_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag28). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843190_SHBs_P-F Product feature CHAIN KJ843190_SHBs_P-F of FT:mat_peptide KJ843190_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag29). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843191_SHBs_P-F Product feature CHAIN KJ843191_SHBs_P-F of FT:mat_peptide KJ843191_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag30). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843193_SHBs_P-F Product feature CHAIN KJ843193_SHBs_P-F of FT:mat_peptide KJ843193_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag32). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843194_SHBs_P-F Product feature CHAIN KJ843194_SHBs_P-F of FT:mat_peptide KJ843194_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag33). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843195_SHBs_P-F Product feature CHAIN KJ843195_SHBs_P-F of FT:mat_peptide KJ843195_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag34). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843196_SHBs_P-F Product feature CHAIN KJ843196_SHBs_P-F of FT:mat_peptide KJ843196_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag35). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843197_SHBs_P-F Product feature CHAIN KJ843197_SHBs_P-F of FT:mat_peptide KJ843197_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag36). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843198_SHBs_P-F Product feature CHAIN KJ843198_SHBs_P-F of FT:mat_peptide KJ843198_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag37). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843199_SHBs_P-F Product feature CHAIN KJ843199_SHBs_P-F of FT:mat_peptide KJ843199_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag38). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843200_SHBs_P-F Product feature CHAIN KJ843200_SHBs_P-F of FT:mat_peptide KJ843200_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag39). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843201_SHBs_P-F Product feature CHAIN KJ843201_SHBs_P-F of FT:mat_peptide KJ843201_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag41). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843202_SHBs_P-F Product feature CHAIN KJ843202_SHBs_P-F of FT:mat_peptide KJ843202_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag42). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVELSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843203_SHBs_P-F Product feature CHAIN KJ843203_SHBs_P-F of FT:mat_peptide KJ843203_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag43). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLALGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843204_SHBs_P-F Product feature CHAIN KJ843204_SHBs_P-F of FT:mat_peptide KJ843204_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag44). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843205_SHBs_P-F Product feature CHAIN KJ843205_SHBs_P-F of FT:mat_peptide KJ843205_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag45). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843206_SHBs_P-F Product feature CHAIN KJ843206_SHBs_P-F of FT:mat_peptide KJ843206_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag46). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843207_SHBs_P-F Product feature CHAIN KJ843207_SHBs_P-F of FT:mat_peptide KJ843207_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag47). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843208_SHBs_P-F Product feature CHAIN KJ843208_SHBs_P-F of FT:mat_peptide KJ843208_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag48). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843209_SHBs_P-F Product feature CHAIN KJ843209_SHBs_P-F of FT:mat_peptide KJ843209_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag49). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843210_SHBs_P-F Product feature CHAIN KJ843210_SHBs_P-F of FT:mat_peptide KJ843210_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag50). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843211_SHBs_P-F Product feature CHAIN KJ843211_SHBs_P-F of FT:mat_peptide KJ843211_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag51). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843212_SHBs_P-F Product feature CHAIN KJ843212_SHBs_P-F of FT:mat_peptide KJ843212_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag52). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843213_SHBs_P-F Product feature CHAIN KJ843213_SHBs_P-F of FT:mat_peptide KJ843213_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Ag53). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843219_SHBs_P-F Product feature CHAIN KJ843219_SHBs_P-F of FT:mat_peptide KJ843219_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr01). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843220_SHBs_P-F Product feature CHAIN KJ843220_SHBs_P-F of FT:mat_peptide KJ843220_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr03). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843221_SHBs_P-F Product feature CHAIN KJ843221_SHBs_P-F of FT:mat_peptide KJ843221_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr04). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843222_SHBs_P-F Product feature CHAIN KJ843222_SHBs_P-F of FT:mat_peptide KJ843222_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr05). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843223_SHBs_P-F Product feature CHAIN KJ843223_SHBs_P-F of FT:mat_peptide KJ843223_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr06). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKIXTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSN
>gnl|hbvpro|KJ843224_SHBs_P-F Product feature CHAIN KJ843224_SHBs_P-F of FT:mat_peptide KJ843224_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr07). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843225_SHBs_P-F Product feature CHAIN KJ843225_SHBs_P-F of FT:mat_peptide KJ843225_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr08). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVYFLLIKILTIPQNLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KJ843226_SHBs_P-F Product feature CHAIN KJ843226_SHBs_P-F of FT:mat_peptide KJ843226_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Cr09). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKXCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KM233681_SHBs_P-F Product feature CHAIN KM233681_SHBs_P-F of FT:mat_peptide KM233681_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KM998715_SHBs_P-F Product feature CHAIN KM998715_SHBs_P-F of FT:mat_peptide KM998715_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718103_SHBs_P-F Product feature CHAIN KP718103_SHBs_P-F of FT:mat_peptide KP718103_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PA-01-1214). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718104_SHBs_P-F Product feature CHAIN KP718104_SHBs_P-F of FT:mat_peptide KP718104_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate CL0004). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718106_SHBs_P-F Product feature CHAIN KP718106_SHBs_P-F of FT:mat_peptide KP718106_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate PA-01-1650). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASAXFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718107_SHBs_P-F Product feature CHAIN KP718107_SHBs_P-F of FT:mat_peptide KP718107_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBNAT097). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLXTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718109_SHBs_P-F Product feature CHAIN KP718109_SHBs_P-F of FT:mat_peptide KP718109_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7555_HIV). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718110_SHBs_P-F Product feature CHAIN KP718110_SHBs_P-F of FT:mat_peptide KP718110_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8728_HIV). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718111_SHBs_P-F Product feature CHAIN KP718111_SHBs_P-F of FT:mat_peptide KP718111_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8827_HIV). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718112_SHBs_P-F Product feature CHAIN KP718112_SHBs_P-F of FT:mat_peptide KP718112_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GP10-4910). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP718113_SHBs_P-F Product feature CHAIN KP718113_SHBs_P-F of FT:mat_peptide KP718113_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate GP10-3634). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995085_SHBs_P-F Product feature CHAIN KP995085_SHBs_P-F of FT:mat_peptide KP995085_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 95-Chronic). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995086_SHBs_P-F Product feature CHAIN KP995086_SHBs_P-F of FT:mat_peptide KP995086_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 465-Cirrhosis). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTRILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995087_SHBs_P-F Product feature CHAIN KP995087_SHBs_P-F of FT:mat_peptide KP995087_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2515-Chronic). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFWYLWVSI
>gnl|hbvpro|KP995089_SHBs_P-F Product feature CHAIN KP995089_SHBs_P-F of FT:mat_peptide KP995089_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3009-HCC). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KP995090_SHBs_P-F Product feature CHAIN KP995090_SHBs_P-F of FT:mat_peptide KP995090_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 10958-HCC). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KP995097_SHBs_P-F Product feature CHAIN KP995097_SHBs_P-F of FT:mat_peptide KP995097_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 5-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTMPQSLDLWWTSLSFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995098_SHBs_P-F Product feature CHAIN KP995098_SHBs_P-F of FT:mat_peptide KP995098_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995101_SHBs_P-F Product feature CHAIN KP995101_SHBs_P-F of FT:mat_peptide KP995101_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 63-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995104_SHBs_P-F Product feature CHAIN KP995104_SHBs_P-F of FT:mat_peptide KP995104_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 81-Cirrhosis). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995105_SHBs_P-F Product feature CHAIN KP995105_SHBs_P-F of FT:mat_peptide KP995105_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 134-Cirrhosis). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995106_SHBs_P-F Product feature CHAIN KP995106_SHBs_P-F of FT:mat_peptide KP995106_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 143-Cirrhosis). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCLGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995107_SHBs_P-F Product feature CHAIN KP995107_SHBs_P-F of FT:mat_peptide KP995107_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 201-HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNTTSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995109_SHBs_P-F Product feature CHAIN KP995109_SHBs_P-F of FT:mat_peptide KP995109_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 209-Cirrhosis). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995110_SHBs_P-F Product feature CHAIN KP995110_SHBs_P-F of FT:mat_peptide KP995110_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 231-HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCLGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTALAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995111_SHBs_P-F Product feature CHAIN KP995111_SHBs_P-F of FT:mat_peptide KP995111_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 234-Cirrhosis). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDSQGMLPVCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWGSI
>gnl|hbvpro|KP995113_SHBs_P-F Product feature CHAIN KP995113_SHBs_P-F of FT:mat_peptide KP995113_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2351-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSKLLGPLLVLQGVFFSLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLFLIFCYLWVSI
>gnl|hbvpro|KP995114_SHBs_P-F Product feature CHAIN KP995114_SHBs_P-F of FT:mat_peptide KP995114_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2369-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLRPLLVLQAVSFLLTKIRTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWTCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPIVWLLAIWMIWYWGPNLFSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995115_SHBs_P-F Product feature CHAIN KP995115_SHBs_P-F of FT:mat_peptide KP995115_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2370-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPVCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995116_SHBs_P-F Product feature CHAIN KP995116_SHBs_P-F of FT:mat_peptide KP995116_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2503-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFWYLWVSI
>gnl|hbvpro|KP995117_SHBs_P-F Product feature CHAIN KP995117_SHBs_P-F of FT:mat_peptide KP995117_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2504-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILKIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTPLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVIWMIWYWGPNLHSILSPFIPLLPIFCYLWGSI
>gnl|hbvpro|KP995118_SHBs_P-F Product feature CHAIN KP995118_SHBs_P-F of FT:mat_peptide KP995118_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2517-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYHGILPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
FLWGWASARFSWLSLLVQFVQWCVELSPTVWLLVILMIWYWGPNLCSILSHFIPLLPIFWYLWVSI
>gnl|hbvpro|KP995119_SHBs_P-F Product feature CHAIN KP995119_SHBs_P-F of FT:mat_peptide KP995119_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2524-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995120_SHBs_P-F Product feature CHAIN KP995120_SHBs_P-F of FT:mat_peptide KP995120_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2579-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995123_SHBs_P-F Product feature CHAIN KP995123_SHBs_P-F of FT:mat_peptide KP995123_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X10-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995124_SHBs_P-F Product feature CHAIN KP995124_SHBs_P-F of FT:mat_peptide KP995124_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X11-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995125_SHBs_P-F Product feature CHAIN KP995125_SHBs_P-F of FT:mat_peptide KP995125_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X13-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP995126_SHBs_P-F Product feature CHAIN KP995126_SHBs_P-F of FT:mat_peptide KP995126_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate X14-Chronic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP997611_SHBs_P-F Product feature CHAIN KP997611_SHBs_P-F of FT:mat_peptide KP997611_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 285_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP997612_SHBs_P-F Product feature CHAIN KP997612_SHBs_P-F of FT:mat_peptide KP997612_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 285_B). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP997613_SHBs_P-F Product feature CHAIN KP997613_SHBs_P-F of FT:mat_peptide KP997613_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 285_C). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KP997649_SHBs_P-F Product feature CHAIN KP997649_SHBs_P-F of FT:mat_peptide KP997649_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 308). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KT630606_SHBs_P-F Product feature CHAIN KT630606_SHBs_P-F of FT:mat_peptide KT630606_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate V19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MXNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPRTXXFCYLWVSI
>gnl|hbvpro|KT630614_SHBs_P-F Product feature CHAIN KT630614_SHBs_P-F of FT:mat_peptide KT630614_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate V254). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KT630619_SHBs_P-F Product feature CHAIN KT630619_SHBs_P-F of FT:mat_peptide KT630619_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate V370). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KT630622_SHBs_P-F Product feature CHAIN KT630622_SHBs_P-F of FT:mat_peptide KT630622_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate V442). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMXWYWGPNLCSILSPFIPLLPIFCYLWVXI
>gnl|hbvpro|KT630623_SHBs_P-F Product feature CHAIN KT630623_SHBs_P-F of FT:mat_peptide KT630623_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate V443). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MXNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|KT630633_SHBs_P-F Product feature CHAIN KT630633_SHBs_P-F of FT:mat_peptide KT630633_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate V262). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MXNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPRITIFCYLWVSI
>gnl|hbvpro|KT630634_SHBs_P-F Product feature CHAIN KT630634_SHBs_P-F of FT:mat_peptide KT630634_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate V263). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KT896494_SHBs_P-F Product feature CHAIN KT896494_SHBs_P-F of FT:mat_peptide KT896494_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MAN183). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847477_SHBs_P-F Product feature CHAIN KU847477_SHBs_P-F of FT:mat_peptide KU847477_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1007.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
XLWEWVSXRFSWLSLLVQFVQWCVGLSPXVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847479_SHBs_P-F Product feature CHAIN KU847479_SHBs_P-F of FT:mat_peptide KU847479_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1015.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSELLGPPLGLQAVCSSLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGXSPTVWLLVIWMIWYWGPNLXRILSPFIPLXXIFCYLXVSI
>gnl|hbvpro|KU847480_SHBs_P-F Product feature CHAIN KU847480_SHBs_P-F of FT:mat_peptide KU847480_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1017.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLXDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847485_SHBs_P-F Product feature CHAIN KU847485_SHBs_P-F of FT:mat_peptide KU847485_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1028.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFFLLTKIXTXPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847492_SHBs_P-F Product feature CHAIN KU847492_SHBs_P-F of FT:mat_peptide KU847492_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1062.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTXLAQGTSMFPSCCCXKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847496_SHBs_P-F Product feature CHAIN KU847496_SHBs_P-F of FT:mat_peptide KU847496_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1077.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847498_SHBs_P-F Product feature CHAIN KU847498_SHBs_P-F of FT:mat_peptide KU847498_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1081.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVXFLLTKILTIPQSLDSWWTSLNFLGGLPXCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847502_SHBs_P-F Product feature CHAIN KU847502_SHBs_P-F of FT:mat_peptide KU847502_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1094.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSTLSPFIPLLPIFYYLWVSI
>gnl|hbvpro|KU847512_SHBs_P-F Product feature CHAIN KU847512_SHBs_P-F of FT:mat_peptide KU847512_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1131.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847515_SHBs_P-F Product feature CHAIN KU847515_SHBs_P-F of FT:mat_peptide KU847515_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1138.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847516_SHBs_P-F Product feature CHAIN KU847516_SHBs_P-F of FT:mat_peptide KU847516_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1152.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSRLPRPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASAPFSWSSLLVQIVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPSIPLLPIFCYLWVSI
>gnl|hbvpro|KU847522_SHBs_P-F Product feature CHAIN KU847522_SHBs_P-F of FT:mat_peptide KU847522_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1193.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGEKPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847524_SHBs_P-F Product feature CHAIN KU847524_SHBs_P-F of FT:mat_peptide KU847524_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1196.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSHSFLGELPGCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847525_SHBs_P-F Product feature CHAIN KU847525_SHBs_P-F of FT:mat_peptide KU847525_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1001.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLXKILTIPXSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847528_SHBs_P-F Product feature CHAIN KU847528_SHBs_P-F of FT:mat_peptide KU847528_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1005.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCAGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYQWVSI
>gnl|hbvpro|KU847536_SHBs_P-F Product feature CHAIN KU847536_SHBs_P-F of FT:mat_peptide KU847536_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1032.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQVVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLXLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKSCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KU847549_SHBs_P-F Product feature CHAIN KU847549_SHBs_P-F of FT:mat_peptide KU847549_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1055.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSIXSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847550_SHBs_P-F Product feature CHAIN KU847550_SHBs_P-F of FT:mat_peptide KU847550_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1056.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847562_SHBs_P-F Product feature CHAIN KU847562_SHBs_P-F of FT:mat_peptide KU847562_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1088.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNIVSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847566_SHBs_P-F Product feature CHAIN KU847566_SHBs_P-F of FT:mat_peptide KU847566_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1098.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847569_SHBs_P-F Product feature CHAIN KU847569_SHBs_P-F of FT:mat_peptide KU847569_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1111.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVXFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCIKPSEGNCTCIPIPSSWALGK
YLWEWVSARFSWLSLLVQFVQWCVGLSPIVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847576_SHBs_P-F Product feature CHAIN KU847576_SHBs_P-F of FT:mat_peptide KU847576_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1124.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847580_SHBs_P-F Product feature CHAIN KU847580_SHBs_P-F of FT:mat_peptide KU847580_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1133.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847586_SHBs_P-F Product feature CHAIN KU847586_SHBs_P-F of FT:mat_peptide KU847586_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1145.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGALPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLFSIWSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847590_SHBs_P-F Product feature CHAIN KU847590_SHBs_P-F of FT:mat_peptide KU847590_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1150.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQXVCXLLXKIXXIPQSLDSWWTSLXFLGXLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847600_SHBs_P-F Product feature CHAIN KU847600_SHBs_P-F of FT:mat_peptide KU847600_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1166.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLXLLDYQGMXPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLXXIWMXWYWGPNLXSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847606_SHBs_P-F Product feature CHAIN KU847606_SHBs_P-F of FT:mat_peptide KU847606_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1173.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
XDNITSGLLGPLXVLQXVXSLLTKILTIPQSLDSWWTSLNFLGXTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRXF
IIFLFILLLCLIFLLVLXDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAXGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCXILSPFIXLLPIFCYLWVSI
>gnl|hbvpro|KU847608_SHBs_P-F Product feature CHAIN KU847608_SHBs_P-F of FT:mat_peptide KU847608_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1177.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNTTSGLLGPLLVLQAVCFLLTKIRTIPXSLDSWWTSLNFLGEIPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMLPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLYSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847612_SHBs_P-F Product feature CHAIN KU847612_SHBs_P-F of FT:mat_peptide KU847612_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1186.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLPVLQAVCSLLTKIRTIPKNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847613_SHBs_P-F Product feature CHAIN KU847613_SHBs_P-F of FT:mat_peptide KU847613_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1187.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVXFLLXKILTIPQSLDSWWTSLNFLGXLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCXILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847616_SHBs_P-F Product feature CHAIN KU847616_SHBs_P-F of FT:mat_peptide KU847616_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1197.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLXFLGGLPXCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847620_SHBs_P-F Product feature CHAIN KU847620_SHBs_P-F of FT:mat_peptide KU847620_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1202.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847627_SHBs_P-F Product feature CHAIN KU847627_SHBs_P-F of FT:mat_peptide KU847627_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1210.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGTPGCXGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847628_SHBs_P-F Product feature CHAIN KU847628_SHBs_P-F of FT:mat_peptide KU847628_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1211.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847653_SHBs_P-F Product feature CHAIN KU847653_SHBs_P-F of FT:mat_peptide KU847653_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 0123.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSXLSLLVQFVRWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847686_SHBs_P-F Product feature CHAIN KU847686_SHBs_P-F of FT:mat_peptide KU847686_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 0089.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQVXFFXLTKILTIPQRLDSWWTSLNFLEGIPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847689_SHBs_P-F Product feature CHAIN KU847689_SHBs_P-F of FT:mat_peptide KU847689_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 0123.2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847694_SHBs_P-F Product feature CHAIN KU847694_SHBs_P-F of FT:mat_peptide KU847694_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 0148.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGQNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847723_SHBs_P-F Product feature CHAIN KU847723_SHBs_P-F of FT:mat_peptide KU847723_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 0235.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KU847728_SHBs_P-F Product feature CHAIN KU847728_SHBs_P-F of FT:mat_peptide KU847728_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 0241.1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFFSLIKILTIPRSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCAGLSPTVWLLVIWMIWYWGPNLSGILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264496_SHBs_P-F Product feature CHAIN KX264496_SHBs_P-F of FT:mat_peptide KX264496_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1-ame). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264497_SHBs_P-F Product feature CHAIN KX264497_SHBs_P-F of FT:mat_peptide KX264497_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F2-ame). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264498_SHBs_P-F Product feature CHAIN KX264498_SHBs_P-F of FT:mat_peptide KX264498_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F3-ame). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264499_SHBs_P-F Product feature CHAIN KX264499_SHBs_P-F of FT:mat_peptide KX264499_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4-ame). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264660_SHBs_P-F Product feature CHAIN KX264660_SHBs_P-F of FT:mat_peptide KX264660_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Q69). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLXPXXVLXAVCXLLTKILTIPQSLDSWWXSLNFLGGLPGCPGQNSQSPTSNXLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264661_SHBs_P-F Product feature CHAIN KX264661_SHBs_P-F of FT:mat_peptide KX264661_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Q15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX264662_SHBs_P-F Product feature CHAIN KX264662_SHBs_P-F of FT:mat_peptide KX264662_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate AF75). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KX757665_SHBs_P-F Product feature CHAIN KX757665_SHBs_P-F of FT:mat_peptide KX757665_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate TH6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY382411_SHBs_P-F Product feature CHAIN KY382411_SHBs_P-F of FT:mat_peptide KY382411_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F4_wt). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY382415_SHBs_P-F Product feature CHAIN KY382415_SHBs_P-F of FT:mat_peptide KY382415_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_wt). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASXRFSWLXLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY382416_SHBs_P-F Product feature CHAIN KY382416_SHBs_P-F of FT:mat_peptide KY382416_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_double_mut). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASXRFSWLXLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY382417_SHBs_P-F Product feature CHAIN KY382417_SHBs_P-F of FT:mat_peptide KY382417_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate F1b_quadruple_mut). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASXRFSWLXLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY458061_SHBs_P-F Product feature CHAIN KY458061_SHBs_P-F of FT:mat_peptide KY458061_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY458062_SHBs_P-F Product feature CHAIN KY458062_SHBs_P-F of FT:mat_peptide KY458062_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY458063_SHBs_P-F Product feature CHAIN KY458063_SHBs_P-F of FT:mat_peptide KY458063_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476322_SHBs_P-F Product feature CHAIN KY476322_SHBs_P-F of FT:mat_peptide KY476322_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV01). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476323_SHBs_P-F Product feature CHAIN KY476323_SHBs_P-F of FT:mat_peptide KY476323_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV03). Complete genome. [Hepadnaviridae] (length=226 residues).
MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476324_SHBs_P-F Product feature CHAIN KY476324_SHBs_P-F of FT:mat_peptide KY476324_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV10). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVFFLLTKILTIPKSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476325_SHBs_P-F Product feature CHAIN KY476325_SHBs_P-F of FT:mat_peptide KY476325_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV14). Complete genome. [Hepadnaviridae] (length=226 residues).
MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTFCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSIWSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476326_SHBs_P-F Product feature CHAIN KY476326_SHBs_P-F of FT:mat_peptide KY476326_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV25). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLXAVCFWLTKIRKIPQSLDSWWTSLNFLGGPPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQETSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLSSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476327_SHBs_P-F Product feature CHAIN KY476327_SHBs_P-F of FT:mat_peptide KY476327_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV28). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476328_SHBs_P-F Product feature CHAIN KY476328_SHBs_P-F of FT:mat_peptide KY476328_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV29). Complete genome. [Hepadnaviridae] (length=226 residues).
MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476329_SHBs_P-F Product feature CHAIN KY476329_SHBs_P-F of FT:mat_peptide KY476329_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV33). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNISSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476330_SHBs_P-F Product feature CHAIN KY476330_SHBs_P-F of FT:mat_peptide KY476330_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV37). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFSLTKILTIPQSLDSWWTSRNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY476332_SHBs_P-F Product feature CHAIN KY476332_SHBs_P-F of FT:mat_peptide KY476332_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate HBV47). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY809938_SHBs_P-F Product feature CHAIN KY809938_SHBs_P-F of FT:mat_peptide KY809938_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RP_12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLEGPPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY809939_SHBs_P-F Product feature CHAIN KY809939_SHBs_P-F of FT:mat_peptide KY809939_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RP_24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY809940_SHBs_P-F Product feature CHAIN KY809940_SHBs_P-F of FT:mat_peptide KY809940_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RP_33). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLIKIRKIPQSLDLWWTSLNFLGALPECPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY809942_SHBs_P-F Product feature CHAIN KY809942_SHBs_P-F of FT:mat_peptide KY809942_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RP_163). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY809943_SHBs_P-F Product feature CHAIN KY809943_SHBs_P-F of FT:mat_peptide KY809943_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RP_175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLSSTLSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY809944_SHBs_P-F Product feature CHAIN KY809944_SHBs_P-F of FT:mat_peptide KY809944_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RP_176). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLSSTLSPFIPLLPIFCYLWVSI
>gnl|hbvpro|KY809945_SHBs_P-F Product feature CHAIN KY809945_SHBs_P-F of FT:mat_peptide KY809945_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RP_185). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFWLTKIRTIPQKLDSWWTSLSFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLYSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KY809946_SHBs_P-F Product feature CHAIN KY809946_SHBs_P-F of FT:mat_peptide KY809946_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate RP_85). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MF150688_SHBs_P-F Product feature CHAIN MF150688_SHBs_P-F of FT:mat_peptide MF150688_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MEX935M). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MF150689_SHBs_P-F Product feature CHAIN MF150689_SHBs_P-F of FT:mat_peptide MF150689_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MEX934M). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MF150690_SHBs_P-F Product feature CHAIN MF150690_SHBs_P-F of FT:mat_peptide MF150690_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MEX933M). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MF150693_SHBs_P-F Product feature CHAIN MF150693_SHBs_P-F of FT:mat_peptide MF150693_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MEX027N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MF150694_SHBs_P-F Product feature CHAIN MF150694_SHBs_P-F of FT:mat_peptide MF150694_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate MEX026N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MG839213_SHBs_P-F Product feature CHAIN MG839213_SHBs_P-F of FT:mat_peptide MG839213_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate FSW039). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MH051986_SHBs_P-F Product feature CHAIN MH051986_SHBs_P-F of FT:mat_peptide MH051986_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B106W). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MH051987_SHBs_P-F Product feature CHAIN MH051987_SHBs_P-F of FT:mat_peptide MH051987_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B127W). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|MH051988_SHBs_P-F Product feature CHAIN MH051988_SHBs_P-F of FT:mat_peptide MH051988_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B115W). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|MH051989_SHBs_P-F Product feature CHAIN MH051989_SHBs_P-F of FT:mat_peptide MH051989_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B117W). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|MH051990_SHBs_P-F Product feature CHAIN MH051990_SHBs_P-F of FT:mat_peptide MH051990_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B123W). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|MH051991_SHBs_P-F Product feature CHAIN MH051991_SHBs_P-F of FT:mat_peptide MH051991_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B134W). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=223 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPESTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLW
>gnl|hbvpro|MH051992_SHBs_P-F Product feature CHAIN MH051992_SHBs_P-F of FT:mat_peptide MH051992_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate B173W). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVYI
>gnl|hbvpro|MK058437_SHBs_P-F Product feature CHAIN MK058437_SHBs_P-F of FT:mat_peptide MK058437_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91803_SHBs_P-F Product feature CHAIN U91803_SHBs_P-F of FT:mat_peptide U91803_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate SC1214 Costa Rica). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91805_SHBs_P-F Product feature CHAIN U91805_SHBs_P-F of FT:mat_peptide U91805_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 8884H Costa Rica). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91806_SHBs_P-F Product feature CHAIN U91806_SHBs_P-F of FT:mat_peptide U91806_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7768H Costa Rica). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91807_SHBs_P-F Product feature CHAIN U91807_SHBs_P-F of FT:mat_peptide U91807_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 7242BSJ Costa Rica). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91808_SHBs_P-F Product feature CHAIN U91808_SHBs_P-F of FT:mat_peptide U91808_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 70H Costa Rica). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91811_SHBs_P-F Product feature CHAIN U91811_SHBs_P-F of FT:mat_peptide U91811_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 567TEG Honduras). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91812_SHBs_P-F Product feature CHAIN U91812_SHBs_P-F of FT:mat_peptide U91812_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 553TEG Honduras). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91813_SHBs_P-F Product feature CHAIN U91813_SHBs_P-F of FT:mat_peptide U91813_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 543TEG Honduras). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91814_SHBs_P-F Product feature CHAIN U91814_SHBs_P-F of FT:mat_peptide U91814_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 529TEG Honduras). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91815_SHBs_P-F Product feature CHAIN U91815_SHBs_P-F of FT:mat_peptide U91815_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 496TEG Honduras). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91817_SHBs_P-F Product feature CHAIN U91817_SHBs_P-F of FT:mat_peptide U91817_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3607PP Costa Rica). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91818_SHBs_P-F Product feature CHAIN U91818_SHBs_P-F of FT:mat_peptide U91818_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 3504G Guatemala). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91821_SHBs_P-F Product feature CHAIN U91821_SHBs_P-F of FT:mat_peptide U91821_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2187NIC Nicaragua). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCFLWVSI
>gnl|hbvpro|U91822_SHBs_P-F Product feature CHAIN U91822_SHBs_P-F of FT:mat_peptide U91822_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 2091NIC Nicaragua). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91823_SHBs_P-F Product feature CHAIN U91823_SHBs_P-F of FT:mat_peptide U91823_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1980NIC Nicaragua). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMLPSCCCTKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGQNLCSMLSPFIPLLPIFCYLWVSS
>gnl|hbvpro|U91825_SHBs_P-F Product feature CHAIN U91825_SHBs_P-F of FT:mat_peptide U91825_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1889NIC Nicaragua). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91826_SHBs_P-F Product feature CHAIN U91826_SHBs_P-F of FT:mat_peptide U91826_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1879SAL El Salvador). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91828_SHBs_P-F Product feature CHAIN U91828_SHBs_P-F of FT:mat_peptide U91828_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1575SAL El Salvador). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91829_SHBs_P-F Product feature CHAIN U91829_SHBs_P-F of FT:mat_peptide U91829_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1116SAL El Salvador). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91830_SHBs_P-F Product feature CHAIN U91830_SHBs_P-F of FT:mat_peptide U91830_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1073SAL El Salvador). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|U91831_SHBs_P-F Product feature CHAIN U91831_SHBs_P-F of FT:mat_peptide U91831_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 1024SAL El Salvador). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|X69798_SHBs_P-F Product feature CHAIN X69798_SHBs_P-F of FT:mat_peptide X69798_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|X75658_SHBs_C-F Product feature CHAIN X75658_SHBs_C-F of FT:mat_peptide X75658_SHBs_C-F of [Viruses] Hepatitis B Virus genotype F (isolate Fou). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWEPNLCSILSPFIPLLPIFCYLWVSI
>gnl|hbvpro|X75661_SHBs_P-F Product feature CHAIN X75661_SHBs_P-F of FT:mat_peptide X75661_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate Car). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCCLWVSI
>gnl|hbvpro|X75663_SHBs_P-F Product feature CHAIN X75663_SHBs_P-F of FT:mat_peptide X75663_SHBs_P-F of [Viruses] Hepatitis B Virus genotype F (isolate 9203). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLRVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPRCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTALAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
© 1998-2019