HBVdb

Dataset for protein HBSP of genotype G

[Download (right click)] [Alignment] [Repertoires]

88 sequence(s)

>gnl|hbvpro|AB056513_HBSP_P-G Product feature CHAIN AB056513_HBSP_P-G of FT:mat_peptide AB056513_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB056514_HBSP_P-G Product feature CHAIN AB056514_HBSP_P-G of FT:mat_peptide AB056514_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB064310_HBSP_P-G Product feature CHAIN AB064310_HBSP_P-G of FT:mat_peptide AB064310_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB064311_HBSP_P-G Product feature CHAIN AB064311_HBSP_P-G of FT:mat_peptide AB064311_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB064312_HBSP_P-G Product feature CHAIN AB064312_HBSP_P-G of FT:mat_peptide AB064312_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB064313_HBSP_C-G Product feature CHAIN AB064313_HBSP_C-G of FT:mat_peptide AB064313_HBSP_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB375165_HBSP_P-G Product feature CHAIN AB375165_HBSP_P-G of FT:mat_peptide AB375165_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB375166_HBSP_P-G Product feature CHAIN AB375166_HBSP_P-G of FT:mat_peptide AB375166_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB375167_HBSP_P-G Product feature CHAIN AB375167_HBSP_P-G of FT:mat_peptide AB375167_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB375168_HBSP_P-G Product feature CHAIN AB375168_HBSP_P-G of FT:mat_peptide AB375168_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB375169_HBSP_P-G Product feature CHAIN AB375169_HBSP_P-G of FT:mat_peptide AB375169_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB375170_HBSP_P-G Product feature CHAIN AB375170_HBSP_P-G of FT:mat_peptide AB375170_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF160501_HBSP_C-G Product feature CHAIN AF160501_HBSP_C-G of FT:mat_peptide AF160501_HBSP_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF405706_HBSP_P-G Product feature CHAIN AF405706_HBSP_P-G of FT:mat_peptide AF405706_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 235/01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ207798_HBSP_P-G Product feature CHAIN DQ207798_HBSP_P-G of FT:mat_peptide DQ207798_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF464097_HBSP_P-G Product feature CHAIN EF464097_HBSP_P-G of FT:mat_peptide EF464097_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 06hac). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EF464098_HBSP_P-G Product feature CHAIN EF464098_HBSP_P-G of FT:mat_peptide EF464098_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 09hgg). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EF634480_HBSP_P-G Product feature CHAIN EF634480_HBSP_P-G of FT:mat_peptide EF634480_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPPPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023674_HBSP_P-G Product feature CHAIN FJ023674_HBSP_P-G of FT:mat_peptide FJ023674_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate I2/C2_C04-0790). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPRPPVRDPAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FR714503_HBSP_P-G Product feature CHAIN FR714503_HBSP_P-G of FT:mat_peptide FR714503_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate TZ306). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|GU563556_HBSP_P-G Product feature CHAIN GU563556_HBSP_P-G of FT:mat_peptide GU563556_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BV-55). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU565217_HBSP_P-G Product feature CHAIN GU565217_HBSP_P-G of FT:mat_peptide GU565217_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|HE981171_HBSP_P-G Product feature CHAIN HE981171_HBSP_P-G of FT:mat_peptide HE981171_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGSQSVSHGSVY
>gnl|hbvpro|HE981172_HBSP_P-G Product feature CHAIN HE981172_HBSP_P-G of FT:mat_peptide HE981172_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|HE981174_HBSP_P-G Product feature CHAIN HE981174_HBSP_P-G of FT:mat_peptide HE981174_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPARDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HE981175_HBSP_P-G Product feature CHAIN HE981175_HBSP_P-G of FT:mat_peptide HE981175_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPARDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HE981176_HBSP_P-G Product feature CHAIN HE981176_HBSP_P-G of FT:mat_peptide HE981176_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPARDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439779_HBSP_P-G Product feature CHAIN JF439779_HBSP_P-G of FT:mat_peptide JF439779_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03D1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439780_HBSP_P-G Product feature CHAIN JF439780_HBSP_P-G of FT:mat_peptide JF439780_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03D4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439781_HBSP_P-G Product feature CHAIN JF439781_HBSP_P-G of FT:mat_peptide JF439781_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03G3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439782_HBSP_P-G Product feature CHAIN JF439782_HBSP_P-G of FT:mat_peptide JF439782_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03E10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439784_HBSP_P-G Product feature CHAIN JF439784_HBSP_P-G of FT:mat_peptide JF439784_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03E12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439785_HBSP_P-G Product feature CHAIN JF439785_HBSP_P-G of FT:mat_peptide JF439785_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439786_HBSP_P-G Product feature CHAIN JF439786_HBSP_P-G of FT:mat_peptide JF439786_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439787_HBSP_P-G Product feature CHAIN JF439787_HBSP_P-G of FT:mat_peptide JF439787_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439788_HBSP_P-G Product feature CHAIN JF439788_HBSP_P-G of FT:mat_peptide JF439788_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439789_HBSP_P-G Product feature CHAIN JF439789_HBSP_P-G of FT:mat_peptide JF439789_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439791_HBSP_P-G Product feature CHAIN JF439791_HBSP_P-G of FT:mat_peptide JF439791_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439792_HBSP_P-G Product feature CHAIN JF439792_HBSP_P-G of FT:mat_peptide JF439792_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2004G2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439793_HBSP_P-G Product feature CHAIN JF439793_HBSP_P-G of FT:mat_peptide JF439793_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2004G4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439794_HBSP_P-G Product feature CHAIN JF439794_HBSP_P-G of FT:mat_peptide JF439794_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H1). Partial genome (Contains: HBc, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNFRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439795_HBSP_P-G Product feature CHAIN JF439795_HBSP_P-G of FT:mat_peptide JF439795_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H2). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439796_HBSP_P-G Product feature CHAIN JF439796_HBSP_P-G of FT:mat_peptide JF439796_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H3). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439797_HBSP_P-G Product feature CHAIN JF439797_HBSP_P-G of FT:mat_peptide JF439797_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H4). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADKDLNRRVAKDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439799_HBSP_P-G Product feature CHAIN JF439799_HBSP_P-G of FT:mat_peptide JF439799_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H7). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439800_HBSP_P-G Product feature CHAIN JF439800_HBSP_P-G of FT:mat_peptide JF439800_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H8). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439801_HBSP_P-G Product feature CHAIN JF439801_HBSP_P-G of FT:mat_peptide JF439801_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H9). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439802_HBSP_P-G Product feature CHAIN JF439802_HBSP_P-G of FT:mat_peptide JF439802_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H10). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439803_HBSP_P-G Product feature CHAIN JF439803_HBSP_P-G of FT:mat_peptide JF439803_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439804_HBSP_P-G Product feature CHAIN JF439804_HBSP_P-G of FT:mat_peptide JF439804_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439805_HBSP_P-G Product feature CHAIN JF439805_HBSP_P-G of FT:mat_peptide JF439805_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439806_HBSP_P-G Product feature CHAIN JF439806_HBSP_P-G of FT:mat_peptide JF439806_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439807_HBSP_P-G Product feature CHAIN JF439807_HBSP_P-G of FT:mat_peptide JF439807_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439808_HBSP_P-G Product feature CHAIN JF439808_HBSP_P-G of FT:mat_peptide JF439808_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439809_HBSP_P-G Product feature CHAIN JF439809_HBSP_P-G of FT:mat_peptide JF439809_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439810_HBSP_P-G Product feature CHAIN JF439810_HBSP_P-G of FT:mat_peptide JF439810_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439811_HBSP_P-G Product feature CHAIN JF439811_HBSP_P-G of FT:mat_peptide JF439811_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439812_HBSP_P-G Product feature CHAIN JF439812_HBSP_P-G of FT:mat_peptide JF439812_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439813_HBSP_P-G Product feature CHAIN JF439813_HBSP_P-G of FT:mat_peptide JF439813_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439814_HBSP_P-G Product feature CHAIN JF439814_HBSP_P-G of FT:mat_peptide JF439814_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439815_HBSP_P-G Product feature CHAIN JF439815_HBSP_P-G of FT:mat_peptide JF439815_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439816_HBSP_P-G Product feature CHAIN JF439816_HBSP_P-G of FT:mat_peptide JF439816_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439817_HBSP_P-G Product feature CHAIN JF439817_HBSP_P-G of FT:mat_peptide JF439817_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439818_HBSP_P-G Product feature CHAIN JF439818_HBSP_P-G of FT:mat_peptide JF439818_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707436_HBSP_P-G Product feature CHAIN JQ707436_HBSP_P-G of FT:mat_peptide JQ707436_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MC1_C27). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707657_HBSP_P-G Product feature CHAIN JQ707657_HBSP_P-G of FT:mat_peptide JQ707657_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707660_HBSP_P-G Product feature CHAIN JQ707660_HBSP_P-G of FT:mat_peptide JQ707660_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707666_HBSP_P-G Product feature CHAIN JQ707666_HBSP_P-G of FT:mat_peptide JQ707666_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707668_HBSP_P-G Product feature CHAIN JQ707668_HBSP_P-G of FT:mat_peptide JQ707668_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_26-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707671_HBSP_P-G Product feature CHAIN JQ707671_HBSP_P-G of FT:mat_peptide JQ707671_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNFRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707673_HBSP_P-G Product feature CHAIN JQ707673_HBSP_P-G of FT:mat_peptide JQ707673_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_33). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707677_HBSP_P-G Product feature CHAIN JQ707677_HBSP_P-G of FT:mat_peptide JQ707677_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707678_HBSP_P-G Product feature CHAIN JQ707678_HBSP_P-G of FT:mat_peptide JQ707678_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707679_HBSP_P-G Product feature CHAIN JQ707679_HBSP_P-G of FT:mat_peptide JQ707679_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707680_HBSP_P-G Product feature CHAIN JQ707680_HBSP_P-G of FT:mat_peptide JQ707680_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF414679_HBSP_P-G Product feature CHAIN KF414679_HBSP_P-G of FT:mat_peptide KF414679_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate B213). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|KF767450_HBSP_P-G Product feature CHAIN KF767450_HBSP_P-G of FT:mat_peptide KF767450_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF767451_HBSP_P-G Product feature CHAIN KF767451_HBSP_P-G of FT:mat_peptide KF767451_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_27). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|KF767452_HBSP_P-G Product feature CHAIN KF767452_HBSP_P-G of FT:mat_peptide KF767452_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|KF779233_HBSP_P-G Product feature CHAIN KF779233_HBSP_P-G of FT:mat_peptide KF779233_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6090). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779235_HBSP_P-G Product feature CHAIN KF779235_HBSP_P-G of FT:mat_peptide KF779235_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6106). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779267_HBSP_P-G Product feature CHAIN KF779267_HBSP_P-G of FT:mat_peptide KF779267_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate JFA3956). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGLLEEELPRLAEPSPNSRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779357_HBSP_P-G Product feature CHAIN KF779357_HBSP_P-G of FT:mat_peptide KF779357_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate PNF5187). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KJ194508_HBSP_P-G Product feature CHAIN KJ194508_HBSP_P-G of FT:mat_peptide KJ194508_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate HBV_Amsterdam_2_1994). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM998716_HBSP_P-G Product feature CHAIN KM998716_HBSP_P-G of FT:mat_peptide KM998716_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR230749_HBSP_P-G Product feature CHAIN KR230749_HBSP_P-G of FT:mat_peptide KR230749_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ENDV06GG). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX264500_HBSP_P-G Product feature CHAIN KX264500_HBSP_P-G of FT:mat_peptide KX264500_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate G-aej). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY004111_HBSP_P-G Product feature CHAIN KY004111_HBSP_P-G of FT:mat_peptide KY004111_HBSP_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M-2015). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
© 1998-2019