HBVdb

Dataset for protein HBx of genotype G

[Download (right click)] [Alignment] [Repertoires]

83 sequence(s)

>gnl|hbvpro|AB056513_HBx_P-G Product feature CHAIN AB056513_HBx_P-G of FT:mat_peptide AB056513_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB056514_HBx_P-G Product feature CHAIN AB056514_HBx_P-G of FT:mat_peptide AB056514_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSTPSPFAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB056515_HBx_P-G Product feature CHAIN AB056515_HBx_P-G of FT:mat_peptide AB056515_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB056516_HBx_P-G Product feature CHAIN AB056516_HBx_P-G of FT:mat_peptide AB056516_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB064310_HBx_P-G Product feature CHAIN AB064310_HBx_P-G of FT:mat_peptide AB064310_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB064311_HBx_P-G Product feature CHAIN AB064311_HBx_P-G of FT:mat_peptide AB064311_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTYHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB064312_HBx_P-G Product feature CHAIN AB064312_HBx_P-G of FT:mat_peptide AB064312_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB064313_HBx_C-G Product feature CHAIN AB064313_HBx_C-G of FT:mat_peptide AB064313_HBx_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB375165_HBx_P-G Product feature CHAIN AB375165_HBx_P-G of FT:mat_peptide AB375165_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB375166_HBx_P-G Product feature CHAIN AB375166_HBx_P-G of FT:mat_peptide AB375166_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB375167_HBx_P-G Product feature CHAIN AB375167_HBx_P-G of FT:mat_peptide AB375167_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB375168_HBx_P-G Product feature CHAIN AB375168_HBx_P-G of FT:mat_peptide AB375168_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYLKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB375169_HBx_P-G Product feature CHAIN AB375169_HBx_P-G of FT:mat_peptide AB375169_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB375170_HBx_P-G Product feature CHAIN AB375170_HBx_P-G of FT:mat_peptide AB375170_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF160501_HBx_C-G Product feature CHAIN AF160501_HBx_C-G of FT:mat_peptide AF160501_HBx_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKWTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF405706_HBx_P-G Product feature CHAIN AF405706_HBx_P-G of FT:mat_peptide AF405706_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 235/01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ207798_HBx_P-G Product feature CHAIN DQ207798_HBx_P-G of FT:mat_peptide DQ207798_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHPLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF464097_HBx_P-G Product feature CHAIN EF464097_HBx_P-G of FT:mat_peptide EF464097_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 06hac). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCHIDPFRDVLCLRPVSVESSGRPLLGSFGDLSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALCFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF464098_HBx_P-G Product feature CHAIN EF464098_HBx_P-G of FT:mat_peptide EF464098_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 09hgg). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALCFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF634480_HBx_P-G Product feature CHAIN EF634480_HBx_P-G of FT:mat_peptide EF634480_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ023674_HBx_P-G Product feature CHAIN FJ023674_HBx_P-G of FT:mat_peptide FJ023674_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate I2/C2_C04-0790). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPVGDLPSPSPSAVPAXHGAHLSLRGLPECAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|FR714503_HBx_P-G Product feature CHAIN FR714503_HBx_P-G of FT:mat_peptide FR714503_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate TZ306). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLSLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU563556_HBx_P-G Product feature CHAIN GU563556_HBx_P-G of FT:mat_peptide GU563556_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BV-55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKWVCAPAPCNFFTSA
>gnl|hbvpro|GU565217_HBx_P-G Product feature CHAIN GU565217_HBx_P-G of FT:mat_peptide GU565217_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTIGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPWNFFTSA
>gnl|hbvpro|HE981171_HBx_P-G Product feature CHAIN HE981171_HBx_P-G of FT:mat_peptide HE981171_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE981172_HBx_P-G Product feature CHAIN HE981172_HBx_P-G of FT:mat_peptide HE981172_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE981174_HBx_P-G Product feature CHAIN HE981174_HBx_P-G of FT:mat_peptide HE981174_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHGAHLYLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE981175_HBx_P-G Product feature CHAIN HE981175_HBx_P-G of FT:mat_peptide HE981175_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE981176_HBx_P-G Product feature CHAIN HE981176_HBx_P-G of FT:mat_peptide HE981176_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707436_HBx_P-G Product feature CHAIN JQ707436_HBx_P-G of FT:mat_peptide JQ707436_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MC1_C27). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707657_HBx_P-G Product feature CHAIN JQ707657_HBx_P-G of FT:mat_peptide JQ707657_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707660_HBx_P-G Product feature CHAIN JQ707660_HBx_P-G of FT:mat_peptide JQ707660_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707666_HBx_P-G Product feature CHAIN JQ707666_HBx_P-G of FT:mat_peptide JQ707666_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCHLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707668_HBx_P-G Product feature CHAIN JQ707668_HBx_P-G of FT:mat_peptide JQ707668_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_26-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707671_HBx_P-G Product feature CHAIN JQ707671_HBx_P-G of FT:mat_peptide JQ707671_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707673_HBx_P-G Product feature CHAIN JQ707673_HBx_P-G of FT:mat_peptide JQ707673_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707677_HBx_P-G Product feature CHAIN JQ707677_HBx_P-G of FT:mat_peptide JQ707677_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPDSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707678_HBx_P-G Product feature CHAIN JQ707678_HBx_P-G of FT:mat_peptide JQ707678_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707679_HBx_P-G Product feature CHAIN JQ707679_HBx_P-G of FT:mat_peptide JQ707679_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707680_HBx_P-G Product feature CHAIN JQ707680_HBx_P-G of FT:mat_peptide JQ707680_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPAAHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF414679_HBx_P-G Product feature CHAIN KF414679_HBx_P-G of FT:mat_peptide KF414679_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate B213). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHPLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF767450_HBx_P-G Product feature CHAIN KF767450_HBx_P-G of FT:mat_peptide KF767450_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF767451_HBx_P-G Product feature CHAIN KF767451_HBx_P-G of FT:mat_peptide KF767451_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_27). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF767452_HBx_P-G Product feature CHAIN KF767452_HBx_P-G of FT:mat_peptide KF767452_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHPLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ194508_HBx_P-G Product feature CHAIN KJ194508_HBx_P-G of FT:mat_peptide KJ194508_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate HBV_Amsterdam_2_1994). Complete genome. [Hepadnaviridae] (length=154 residues).
LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM998716_HBx_P-G Product feature CHAIN KM998716_HBx_P-G of FT:mat_peptide KM998716_HBx_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHPLPKQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR230749_HBx_P-G Product feature CHAIN KR230749_HBx_P-G of FT:mat_peptide KR230749_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ENDV06GG). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811460_HBx_P-G Product feature CHAIN KR811460_HBx_P-G of FT:mat_peptide KR811460_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811461_HBx_P-G Product feature CHAIN KR811461_HBx_P-G of FT:mat_peptide KR811461_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811765_HBx_P-G Product feature CHAIN KR811765_HBx_P-G of FT:mat_peptide KR811765_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.01). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811767_HBx_P-G Product feature CHAIN KR811767_HBx_P-G of FT:mat_peptide KR811767_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.03). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNNSHPPPRQLYKRTLGLFAMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811768_HBx_P-G Product feature CHAIN KR811768_HBx_P-G of FT:mat_peptide KR811768_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.04). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811770_HBx_P-G Product feature CHAIN KR811770_HBx_P-G of FT:mat_peptide KR811770_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.06). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811771_HBx_P-G Product feature CHAIN KR811771_HBx_P-G of FT:mat_peptide KR811771_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.10). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811772_HBx_P-G Product feature CHAIN KR811772_HBx_P-G of FT:mat_peptide KR811772_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.11). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811773_HBx_P-G Product feature CHAIN KR811773_HBx_P-G of FT:mat_peptide KR811773_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.13). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811774_HBx_P-G Product feature CHAIN KR811774_HBx_P-G of FT:mat_peptide KR811774_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.15). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
SAMNNSHPLPRQLYKGTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCTPKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811775_HBx_P-G Product feature CHAIN KR811775_HBx_P-G of FT:mat_peptide KR811775_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.16). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRSTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811776_HBx_P-G Product feature CHAIN KR811776_HBx_P-G of FT:mat_peptide KR811776_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.17). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811777_HBx_P-G Product feature CHAIN KR811777_HBx_P-G of FT:mat_peptide KR811777_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.18). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSTVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811780_HBx_P-G Product feature CHAIN KR811780_HBx_P-G of FT:mat_peptide KR811780_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.24). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNPHHLPRQLYKRTLGLFVVSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811781_HBx_P-G Product feature CHAIN KR811781_HBx_P-G of FT:mat_peptide KR811781_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.25). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811782_HBx_P-G Product feature CHAIN KR811782_HBx_P-G of FT:mat_peptide KR811782_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.26). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811783_HBx_P-G Product feature CHAIN KR811783_HBx_P-G of FT:mat_peptide KR811783_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.27). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSFRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFAMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811784_HBx_P-G Product feature CHAIN KR811784_HBx_P-G of FT:mat_peptide KR811784_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.28). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVPCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811785_HBx_P-G Product feature CHAIN KR811785_HBx_P-G of FT:mat_peptide KR811785_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2T.29). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTAARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCSFFTSA
>gnl|hbvpro|KR811786_HBx_P-G Product feature CHAIN KR811786_HBx_P-G of FT:mat_peptide KR811786_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.01). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811788_HBx_P-G Product feature CHAIN KR811788_HBx_P-G of FT:mat_peptide KR811788_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.03). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811789_HBx_P-G Product feature CHAIN KR811789_HBx_P-G of FT:mat_peptide KR811789_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.04). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811790_HBx_P-G Product feature CHAIN KR811790_HBx_P-G of FT:mat_peptide KR811790_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.05). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811791_HBx_P-G Product feature CHAIN KR811791_HBx_P-G of FT:mat_peptide KR811791_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.08). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALCFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIIVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811792_HBx_P-G Product feature CHAIN KR811792_HBx_P-G of FT:mat_peptide KR811792_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.09). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFAMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811793_HBx_P-G Product feature CHAIN KR811793_HBx_P-G of FT:mat_peptide KR811793_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.12). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVTSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811794_HBx_P-G Product feature CHAIN KR811794_HBx_P-G of FT:mat_peptide KR811794_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.13). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSSSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811795_HBx_P-G Product feature CHAIN KR811795_HBx_P-G of FT:mat_peptide KR811795_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.15). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811797_HBx_P-G Product feature CHAIN KR811797_HBx_P-G of FT:mat_peptide KR811797_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.17). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811800_HBx_P-G Product feature CHAIN KR811800_HBx_P-G of FT:mat_peptide KR811800_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.20). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLTIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811802_HBx_P-G Product feature CHAIN KR811802_HBx_P-G of FT:mat_peptide KR811802_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.24). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811804_HBx_P-G Product feature CHAIN KR811804_HBx_P-G of FT:mat_peptide KR811804_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.28). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811806_HBx_P-G Product feature CHAIN KR811806_HBx_P-G of FT:mat_peptide KR811806_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.30). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGANLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNRSRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811807_HBx_P-G Product feature CHAIN KR811807_HBx_P-G of FT:mat_peptide KR811807_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 2NT.31). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNNSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX264500_HBx_P-G Product feature CHAIN KX264500_HBx_P-G of FT:mat_peptide KX264500_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate G-aej). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY004111_HBx_P-G Product feature CHAIN KY004111_HBx_P-G of FT:mat_peptide KY004111_HBx_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M-2015). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
© 1998-2019