HBVdb

Dataset for protein Pol of genotype G

[Download (right click)] [Alignment] [Repertoires]

48 sequence(s)

>gnl|hbvpro|AB056513_Pol_P-G Product feature CHAIN AB056513_Pol_P-G of FT:mat_peptide AB056513_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEYHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB056515_Pol_P-G Product feature CHAIN AB056515_Pol_P-G of FT:mat_peptide AB056515_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEETGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTSKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB064310_Pol_P-G Product feature CHAIN AB064310_Pol_P-G of FT:mat_peptide AB064310_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGPAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB064311_Pol_P-G Product feature CHAIN AB064311_Pol_P-G of FT:mat_peptide AB064311_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSAHCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB064312_Pol_P-G Product feature CHAIN AB064312_Pol_P-G of FT:mat_peptide AB064312_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSHSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPDKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB064313_Pol_C-G Product feature CHAIN AB064313_Pol_C-G of FT:mat_peptide AB064313_Pol_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSPDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITKKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB375165_Pol_P-G Product feature CHAIN AB375165_Pol_P-G of FT:mat_peptide AB375165_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLXFMGYVIGSWGTLPQEHITQKIKXCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB375166_Pol_P-G Product feature CHAIN AB375166_Pol_P-G of FT:mat_peptide AB375166_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDFRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB375167_Pol_P-G Product feature CHAIN AB375167_Pol_P-G of FT:mat_peptide AB375167_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDFRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB375168_Pol_P-G Product feature CHAIN AB375168_Pol_P-G of FT:mat_peptide AB375168_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDFRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB375169_Pol_P-G Product feature CHAIN AB375169_Pol_P-G of FT:mat_peptide AB375169_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDFRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AB375170_Pol_P-G Product feature CHAIN AB375170_Pol_P-G of FT:mat_peptide AB375170_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDFRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AF160501_Pol_C-G Product feature CHAIN AF160501_Pol_C-G of FT:mat_peptide AF160501_Pol_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFRQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|AF405706_Pol_P-G Product feature CHAIN AF405706_Pol_P-G of FT:mat_peptide AF405706_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 235/01). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|EF464097_Pol_P-G Product feature CHAIN EF464097_Pol_P-G of FT:mat_peptide EF464097_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 06hac). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELHPVPPSSTKSQSQGPVF
SCWWLQFRDTEPCSDYCLSHIINLLEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIAQKIKQCFGKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQVKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAAISTLSGTSFVYVPSALNPADDPSWGRLGICRPL
LRLPFLPTTGRTSLYAVSRSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|EF464098_Pol_P-G Product feature CHAIN EF464098_Pol_P-G of FT:mat_peptide EF464098_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 09hgg). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELHPVPPSSTKSQSQGPVF
SCWWLQFRDSRTCSDYCLSHIINLLEDWGPCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELIAACFARSRSGAKLIGTDNSVVLSRKYTSFPWQLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|EF634480_Pol_P-G Product feature CHAIN EF634480_Pol_P-G of FT:mat_peptide EF634480_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPSGVEPSVSGHTNNFTSRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILHHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLSFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|FJ023674_Pol_P-G Product feature CHAIN FJ023674_Pol_P-G of FT:mat_peptide FJ023674_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate I2/C2_C04-0790). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLHEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHAVNHYFKARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRVDIHPSERHGDESFCTQSSGISSRSSVGSCVRSQLKQSRLGLQPQQGPLATSPSGRS
GSIRARVHPSTRRSVGVEPSGSGHINKCASSSSSCLNQSAVRTAAHSHLSTSERQXSSGHAVELHNLPPSSSXSQSQGPV
FSCWWLQFRNSKPCSEYCLSHLINLRKDWGPCTEHGEHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGNN
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSXYVARLSSNSRILDHQYGTLQNLHD
SCSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
XHLESIYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIRQCFRKLPVNRPVDWKVCQRISGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVVRQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPYRPXTGRTSLYADSPSVPFHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FR714503_Pol_P-G Product feature CHAIN FR714503_Pol_P-G of FT:mat_peptide FR714503_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate TZ306). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLHEDIINRCQQFVGPLTVNEKRRLNLIMPARFYPNRTKYLPLDKGIKPYYPEQAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYYREQEPQHGRLVFQTSKRHGDESFCSQSSGISSRSSVGPCVRSQLKQSRLGLQPQQGPLATSPSGRS
GSIRARVHPSSRRSFGVEPSGSGHINKRASSSSSCLHQSAVRKAANSHISTSKRQSSSGHAVELHHLPPSSTRSQNQGPV
SSCWWLQFRNSKPCSEYCLSHLINLHEDWGPCNEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILDHQYGTMQNLHD
SCSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEAIYTAVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKQCFRKLPVNRPIDWKVCQRISGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLHLPYRPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU563556_Pol_P-G Product feature CHAIN GU563556_Pol_P-G of FT:mat_peptide GU563556_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BV-55). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|GU565217_Pol_P-G Product feature CHAIN GU565217_Pol_P-G of FT:mat_peptide GU565217_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKTGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|HE981171_Pol_P-G Product feature CHAIN HE981171_Pol_P-G of FT:mat_peptide HE981171_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQSCWW
LQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSARVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQ
LYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLP
FLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|HE981172_Pol_P-G Product feature CHAIN HE981172_Pol_P-G of FT:mat_peptide HE981172_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQSCWW
LQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSARVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQ
LYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLP
FLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|HE981174_Pol_P-G Product feature CHAIN HE981174_Pol_P-G of FT:mat_peptide HE981174_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSISGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQHGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLSFLPTTGRTSIYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|HE981175_Pol_P-G Product feature CHAIN HE981175_Pol_P-G of FT:mat_peptide HE981175_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQHGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|HE981176_Pol_P-G Product feature CHAIN HE981176_Pol_P-G of FT:mat_peptide HE981176_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQHGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707657_Pol_P-G Product feature CHAIN JQ707657_Pol_P-G of FT:mat_peptide JQ707657_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707660_Pol_P-G Product feature CHAIN JQ707660_Pol_P-G of FT:mat_peptide JQ707660_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_17). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707666_Pol_P-G Product feature CHAIN JQ707666_Pol_P-G of FT:mat_peptide JQ707666_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_22). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAATWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707668_Pol_P-G Product feature CHAIN JQ707668_Pol_P-G of FT:mat_peptide JQ707668_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_26-5). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707671_Pol_P-G Product feature CHAIN JQ707671_Pol_P-G of FT:mat_peptide JQ707671_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_3). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707673_Pol_P-G Product feature CHAIN JQ707673_Pol_P-G of FT:mat_peptide JQ707673_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_33). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707677_Pol_P-G Product feature CHAIN JQ707677_Pol_P-G of FT:mat_peptide JQ707677_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_45). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPTALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707678_Pol_P-G Product feature CHAIN JQ707678_Pol_P-G of FT:mat_peptide JQ707678_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_47). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVFAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707679_Pol_P-G Product feature CHAIN JQ707679_Pol_P-G of FT:mat_peptide JQ707679_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_48). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVFAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|JQ707680_Pol_P-G Product feature CHAIN JQ707680_Pol_P-G of FT:mat_peptide JQ707680_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_6). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQ
HLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KF414679_Pol_P-G Product feature CHAIN KF414679_Pol_P-G of FT:mat_peptide KF414679_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate B213). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVAAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KF767450_Pol_P-G Product feature CHAIN KF767450_Pol_P-G of FT:mat_peptide KF767450_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_23). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KF767452_Pol_P-G Product feature CHAIN KF767452_Pol_P-G of FT:mat_peptide KF767452_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_7). Non-functional genomic sequence. [Hepadnaviridae] (length=841 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSR
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVLYSIPPSSTKSQSQGPVSS
CWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSARV
SWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHVSC
SRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQH
LESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGF
AAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAP
LPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLL
RLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KF779233_Pol_P-G Product feature CHAIN KF779233_Pol_P-G of FT:mat_peptide KF779233_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6090). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITKKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KF779235_Pol_P-G Product feature CHAIN KF779235_Pol_P-G of FT:mat_peptide KF779235_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6106). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLRTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITKKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KF779267_Pol_P-G Product feature CHAIN KF779267_Pol_P-G of FT:mat_peptide KF779267_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate JFA3956). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGLLEEELPRLAEPSPNSRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSGILSRSPVGPSLQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYRNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPSHVTWKPP
>gnl|hbvpro|KF779357_Pol_P-G Product feature CHAIN KF779357_Pol_P-G of FT:mat_peptide KF779357_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate PNF5187). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSEYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFRVDKILHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTADLRAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KJ194508_Pol_P-G Product feature CHAIN KJ194508_Pol_P-G of FT:mat_peptide KJ194508_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate HBV_Amsterdam_2_1994). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KM998716_Pol_P-G Product feature CHAIN KM998716_Pol_P-G of FT:mat_peptide KM998716_Pol_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVS
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KR230749_Pol_P-G Product feature CHAIN KR230749_Pol_P-G of FT:mat_peptide KR230749_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ENDV06GG). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKQLVMPARFFPNSTKYLPLDKGIKYYPENVVNHYFQTRHYLHTLWKAGILYKRETSR
SASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWT
RVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVFSCWW
LQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGGFLVDKNPHNTAESRLVVDFSQFSRGSARVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQ
LYVSLMLLYKTFGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYRNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLP
FLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KX264500_Pol_P-G Product feature CHAIN KX264500_Pol_P-G of FT:mat_peptide KX264500_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate G-aej). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
>gnl|hbvpro|KY004111_Pol_P-G Product feature CHAIN KY004111_Pol_P-G of FT:mat_peptide KY004111_Pol_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M-2015). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYTWEQDLQHGAFLDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSW
SLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPVF
SCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSAR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILDHQYGTLQNLHDS
CSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPL
LRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
© 1998-2019