HBVdb

Dataset for protein SHBs of genotype G

[Download (right click)] [Alignment] [Repertoires]

146 sequence(s)

>gnl|hbvpro|AB056513_SHBs_P-G Product feature CHAIN AB056513_SHBs_P-G of FT:mat_peptide AB056513_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB056514_SHBs_P-G Product feature CHAIN AB056514_SHBs_P-G of FT:mat_peptide AB056514_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB056515_SHBs_P-G Product feature CHAIN AB056515_SHBs_P-G of FT:mat_peptide AB056515_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCIKPSEGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB056516_SHBs_P-G Product feature CHAIN AB056516_SHBs_P-G of FT:mat_peptide AB056516_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: HBx, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB064310_SHBs_P-G Product feature CHAIN AB064310_SHBs_P-G of FT:mat_peptide AB064310_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB064311_SHBs_P-G Product feature CHAIN AB064311_SHBs_P-G of FT:mat_peptide AB064311_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB064312_SHBs_P-G Product feature CHAIN AB064312_SHBs_P-G of FT:mat_peptide AB064312_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB064313_SHBs_C-G Product feature CHAIN AB064313_SHBs_C-G of FT:mat_peptide AB064313_SHBs_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB375165_SHBs_P-G Product feature CHAIN AB375165_SHBs_P-G of FT:mat_peptide AB375165_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB375166_SHBs_P-G Product feature CHAIN AB375166_SHBs_P-G of FT:mat_peptide AB375166_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB375167_SHBs_P-G Product feature CHAIN AB375167_SHBs_P-G of FT:mat_peptide AB375167_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB375168_SHBs_P-G Product feature CHAIN AB375168_SHBs_P-G of FT:mat_peptide AB375168_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB375169_SHBs_P-G Product feature CHAIN AB375169_SHBs_P-G of FT:mat_peptide AB375169_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB375170_SHBs_P-G Product feature CHAIN AB375170_SHBs_P-G of FT:mat_peptide AB375170_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF160501_SHBs_C-G Product feature CHAIN AF160501_SHBs_C-G of FT:mat_peptide AF160501_SHBs_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF369533_SHBs_P-G Product feature CHAIN AF369533_SHBs_P-G of FT:mat_peptide AF369533_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MEX8c). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF405706_SHBs_P-G Product feature CHAIN AF405706_SHBs_P-G of FT:mat_peptide AF405706_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 235/01). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY168428_SHBs_P-G Product feature CHAIN AY168428_SHBs_P-G of FT:mat_peptide AY168428_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ST81). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ207798_SHBs_P-G Product feature CHAIN DQ207798_SHBs_P-G of FT:mat_peptide DQ207798_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ236116_SHBs_P-G Product feature CHAIN DQ236116_SHBs_P-G of FT:mat_peptide DQ236116_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MEX C16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ236117_SHBs_P-G Product feature CHAIN DQ236117_SHBs_P-G of FT:mat_peptide DQ236117_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MEX C17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ236119_SHBs_P-G Product feature CHAIN DQ236119_SHBs_P-G of FT:mat_peptide DQ236119_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MEX C19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ403176_SHBs_P-G Product feature CHAIN DQ403176_SHBs_P-G of FT:mat_peptide DQ403176_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate s04004677). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF464097_SHBs_P-G Product feature CHAIN EF464097_SHBs_P-G of FT:mat_peptide EF464097_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 06hac). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF464098_SHBs_P-G Product feature CHAIN EF464098_SHBs_P-G of FT:mat_peptide EF464098_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 09hgg). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTRILTIPQSLDSWWTSLNFLGEVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF634480_SHBs_P-G Product feature CHAIN EF634480_SHBs_P-G of FT:mat_peptide EF634480_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU366207_SHBs_P-G Product feature CHAIN EU366207_SHBs_P-G of FT:mat_peptide EU366207_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DIB30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU366208_SHBs_P-G Product feature CHAIN EU366208_SHBs_P-G of FT:mat_peptide EU366208_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DIB118). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU366209_SHBs_P-G Product feature CHAIN EU366209_SHBs_P-G of FT:mat_peptide EU366209_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DIB24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023674_SHBs_P-G Product feature CHAIN FJ023674_SHBs_P-G of FT:mat_peptide FJ023674_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate I2/C2_C04-0790). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPNLYXTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023700_SHBs_P-G Product feature CHAIN FJ023700_SHBs_P-G of FT:mat_peptide FJ023700_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate C04-0790). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNTLSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ023701_SHBs_P-G Product feature CHAIN FJ023701_SHBs_P-G of FT:mat_peptide FJ023701_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate C04-0790). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWGWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023702_SHBs_P-G Product feature CHAIN FJ023702_SHBs_P-G of FT:mat_peptide FJ023702_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate C04-0790). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLLILLLCPIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSIIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023703_SHBs_P-G Product feature CHAIN FJ023703_SHBs_P-G of FT:mat_peptide FJ023703_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate C04-0790). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023704_SHBs_P-G Product feature CHAIN FJ023704_SHBs_P-G of FT:mat_peptide FJ023704_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate C04-0790). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPNLHNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023705_SHBs_P-G Product feature CHAIN FJ023705_SHBs_P-G of FT:mat_peptide FJ023705_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate C04-0790). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLAPFVQWFVGLSPTVWLLVIWMMWYWGPNLYTTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023706_SHBs_P-G Product feature CHAIN FJ023706_SHBs_P-G of FT:mat_peptide FJ023706_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate C04-0790). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLPAPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023707_SHBs_P-G Product feature CHAIN FJ023707_SHBs_P-G of FT:mat_peptide FJ023707_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate C04-0790). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNTLSPFIPLLPILFCLWVYI
>gnl|hbvpro|FJ023854_SHBs_P-G Product feature CHAIN FJ023854_SHBs_P-G of FT:mat_peptide FJ023854_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3233). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGXXVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWXSARFSWLSLLVPFVQWFVGLSPTVWLSVXWMMWYWGPNLYNTLKPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023878_SHBs_P-G Product feature CHAIN FJ023878_SHBs_P-G of FT:mat_peptide FJ023878_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023879_SHBs_P-G Product feature CHAIN FJ023879_SHBs_P-G of FT:mat_peptide FJ023879_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHPPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YPWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023880_SHBs_P-G Product feature CHAIN FJ023880_SHBs_P-G of FT:mat_peptide FJ023880_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023881_SHBs_P-G Product feature CHAIN FJ023881_SHBs_P-G of FT:mat_peptide FJ023881_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023882_SHBs_P-G Product feature CHAIN FJ023882_SHBs_P-G of FT:mat_peptide FJ023882_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023883_SHBs_P-G Product feature CHAIN FJ023883_SHBs_P-G of FT:mat_peptide FJ023883_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023884_SHBs_P-G Product feature CHAIN FJ023884_SHBs_P-G of FT:mat_peptide FJ023884_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|FJ023885_SHBs_P-G Product feature CHAIN FJ023885_SHBs_P-G of FT:mat_peptide FJ023885_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-3692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPLICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023936_SHBs_P-G Product feature CHAIN FJ023936_SHBs_P-G of FT:mat_peptide FJ023936_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-4750). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGESTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ023968_SHBs_P-G Product feature CHAIN FJ023968_SHBs_P-G of FT:mat_peptide FJ023968_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M05-1819). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ358587_SHBs_P-G Product feature CHAIN FJ358587_SHBs_P-G of FT:mat_peptide FJ358587_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M05-0659). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLVPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLQVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ358594_SHBs_P-G Product feature CHAIN FJ358594_SHBs_P-G of FT:mat_peptide FJ358594_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M04-2769). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR714503_SHBs_P-G Product feature CHAIN FR714503_SHBs_P-G of FT:mat_peptide FR714503_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate TZ306). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR821982_SHBs_P-G Product feature CHAIN FR821982_SHBs_P-G of FT:mat_peptide FR821982_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLSILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR821983_SHBs_P-G Product feature CHAIN FR821983_SHBs_P-G of FT:mat_peptide FR821983_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MANITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSAGNCTCIPIPSSWAFAK
SLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR821984_SHBs_P-G Product feature CHAIN FR821984_SHBs_P-G of FT:mat_peptide FR821984_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFVLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR821987_SHBs_P-G Product feature CHAIN FR821987_SHBs_P-G of FT:mat_peptide FR821987_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSGAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR822067_SHBs_P-G Product feature CHAIN FR822067_SHBs_P-G of FT:mat_peptide FR822067_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR822110_SHBs_P-G Product feature CHAIN FR822110_SHBs_P-G of FT:mat_peptide FR822110_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FR822113_SHBs_P-G Product feature CHAIN FR822113_SHBs_P-G of FT:mat_peptide FR822113_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325762_SHBs_P-G Product feature CHAIN GQ325762_SHBs_P-G of FT:mat_peptide GQ325762_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 1284-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325763_SHBs_P-G Product feature CHAIN GQ325763_SHBs_P-G of FT:mat_peptide GQ325763_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 1284-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325769_SHBs_P-G Product feature CHAIN GQ325769_SHBs_P-G of FT:mat_peptide GQ325769_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 26278-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXVPVCPGLNSQSPTSNHSPXSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVXLDYXGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXXMXXYXGPNLYNILSPFIPLLPIFFCXWVYI
>gnl|hbvpro|GQ325770_SHBs_P-G Product feature CHAIN GQ325770_SHBs_P-G of FT:mat_peptide GQ325770_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 26278-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXVPVCPGLNSQSPTSNHSPXSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVXLDYXGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXXMXXYXGPNLYNILSPFIPLLPIFFCXWVYI
>gnl|hbvpro|GQ325771_SHBs_P-G Product feature CHAIN GQ325771_SHBs_P-G of FT:mat_peptide GQ325771_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 26278-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXVPVCPGLNSQSPTSNHSPXSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVXLDYXGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXXMXXYXGPNLYNILSPFIPLLPIFFCXWVYI
>gnl|hbvpro|GQ325774_SHBs_P-G Product feature CHAIN GQ325774_SHBs_P-G of FT:mat_peptide GQ325774_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 4089-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWSVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486349_SHBs_P-G Product feature CHAIN GQ486349_SHBs_P-G of FT:mat_peptide GQ486349_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate GS314). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPXCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPLDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNIXSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486843_SHBs_P-G Product feature CHAIN GQ486843_SHBs_P-G of FT:mat_peptide GQ486843_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate GS808). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563556_SHBs_P-G Product feature CHAIN GU563556_SHBs_P-G of FT:mat_peptide GU563556_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BV-55). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU565217_SHBs_P-G Product feature CHAIN GU565217_SHBs_P-G of FT:mat_peptide GU565217_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE981171_SHBs_P-G Product feature CHAIN HE981171_SHBs_P-G of FT:mat_peptide HE981171_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|HE981172_SHBs_P-G Product feature CHAIN HE981172_SHBs_P-G of FT:mat_peptide HE981172_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|HE981174_SHBs_P-G Product feature CHAIN HE981174_SHBs_P-G of FT:mat_peptide HE981174_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE981175_SHBs_P-G Product feature CHAIN HE981175_SHBs_P-G of FT:mat_peptide HE981175_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE981176_SHBs_P-G Product feature CHAIN HE981176_SHBs_P-G of FT:mat_peptide HE981176_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM467765_SHBs_P-G Product feature CHAIN HM467765_SHBs_P-G of FT:mat_peptide HM467765_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 1099_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM467769_SHBs_P-G Product feature CHAIN HM467769_SHBs_P-G of FT:mat_peptide HM467769_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 1104_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM467770_SHBs_P-G Product feature CHAIN HM467770_SHBs_P-G of FT:mat_peptide HM467770_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 1105_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTIPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM467773_SHBs_P-G Product feature CHAIN HM467773_SHBs_P-G of FT:mat_peptide HM467773_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 1110_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLLVYI
>gnl|hbvpro|JF439779_SHBs_P-G Product feature CHAIN JF439779_SHBs_P-G of FT:mat_peptide JF439779_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03D1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439780_SHBs_P-G Product feature CHAIN JF439780_SHBs_P-G of FT:mat_peptide JF439780_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03D4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439781_SHBs_P-G Product feature CHAIN JF439781_SHBs_P-G of FT:mat_peptide JF439781_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03G3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439782_SHBs_P-G Product feature CHAIN JF439782_SHBs_P-G of FT:mat_peptide JF439782_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03E10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439784_SHBs_P-G Product feature CHAIN JF439784_SHBs_P-G of FT:mat_peptide JF439784_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03E12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSHTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439785_SHBs_P-G Product feature CHAIN JF439785_SHBs_P-G of FT:mat_peptide JF439785_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439786_SHBs_P-G Product feature CHAIN JF439786_SHBs_P-G of FT:mat_peptide JF439786_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439787_SHBs_P-G Product feature CHAIN JF439787_SHBs_P-G of FT:mat_peptide JF439787_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439788_SHBs_P-G Product feature CHAIN JF439788_SHBs_P-G of FT:mat_peptide JF439788_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYIQ
>gnl|hbvpro|JF439789_SHBs_P-G Product feature CHAIN JF439789_SHBs_P-G of FT:mat_peptide JF439789_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439791_SHBs_P-G Product feature CHAIN JF439791_SHBs_P-G of FT:mat_peptide JF439791_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439792_SHBs_P-G Product feature CHAIN JF439792_SHBs_P-G of FT:mat_peptide JF439792_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2004G2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSLISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439793_SHBs_P-G Product feature CHAIN JF439793_SHBs_P-G of FT:mat_peptide JF439793_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2004G4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSLISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439794_SHBs_P-G Product feature CHAIN JF439794_SHBs_P-G of FT:mat_peptide JF439794_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H1). Partial genome (Contains: HBc, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKLSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439803_SHBs_P-G Product feature CHAIN JF439803_SHBs_P-G of FT:mat_peptide JF439803_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439804_SHBs_P-G Product feature CHAIN JF439804_SHBs_P-G of FT:mat_peptide JF439804_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439805_SHBs_P-G Product feature CHAIN JF439805_SHBs_P-G of FT:mat_peptide JF439805_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439806_SHBs_P-G Product feature CHAIN JF439806_SHBs_P-G of FT:mat_peptide JF439806_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439807_SHBs_P-G Product feature CHAIN JF439807_SHBs_P-G of FT:mat_peptide JF439807_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439808_SHBs_P-G Product feature CHAIN JF439808_SHBs_P-G of FT:mat_peptide JF439808_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439809_SHBs_P-G Product feature CHAIN JF439809_SHBs_P-G of FT:mat_peptide JF439809_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439810_SHBs_P-G Product feature CHAIN JF439810_SHBs_P-G of FT:mat_peptide JF439810_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439811_SHBs_P-G Product feature CHAIN JF439811_SHBs_P-G of FT:mat_peptide JF439811_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439812_SHBs_P-G Product feature CHAIN JF439812_SHBs_P-G of FT:mat_peptide JF439812_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439813_SHBs_P-G Product feature CHAIN JF439813_SHBs_P-G of FT:mat_peptide JF439813_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439814_SHBs_P-G Product feature CHAIN JF439814_SHBs_P-G of FT:mat_peptide JF439814_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439815_SHBs_P-G Product feature CHAIN JF439815_SHBs_P-G of FT:mat_peptide JF439815_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439816_SHBs_P-G Product feature CHAIN JF439816_SHBs_P-G of FT:mat_peptide JF439816_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439817_SHBs_P-G Product feature CHAIN JF439817_SHBs_P-G of FT:mat_peptide JF439817_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439818_SHBs_P-G Product feature CHAIN JF439818_SHBs_P-G of FT:mat_peptide JF439818_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JN604208_SHBs_P-G Product feature CHAIN JN604208_SHBs_P-G of FT:mat_peptide JN604208_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 476-6039-6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707436_SHBs_P-G Product feature CHAIN JQ707436_SHBs_P-G of FT:mat_peptide JQ707436_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MC1_C27). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707657_SHBs_P-G Product feature CHAIN JQ707657_SHBs_P-G of FT:mat_peptide JQ707657_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707660_SHBs_P-G Product feature CHAIN JQ707660_SHBs_P-G of FT:mat_peptide JQ707660_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707666_SHBs_P-G Product feature CHAIN JQ707666_SHBs_P-G of FT:mat_peptide JQ707666_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707668_SHBs_P-G Product feature CHAIN JQ707668_SHBs_P-G of FT:mat_peptide JQ707668_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_26-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707671_SHBs_P-G Product feature CHAIN JQ707671_SHBs_P-G of FT:mat_peptide JQ707671_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKLSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707673_SHBs_P-G Product feature CHAIN JQ707673_SHBs_P-G of FT:mat_peptide JQ707673_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_33). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707677_SHBs_P-G Product feature CHAIN JQ707677_SHBs_P-G of FT:mat_peptide JQ707677_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_45). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707678_SHBs_P-G Product feature CHAIN JQ707678_SHBs_P-G of FT:mat_peptide JQ707678_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_47). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAISMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707679_SHBs_P-G Product feature CHAIN JQ707679_SHBs_P-G of FT:mat_peptide JQ707679_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707680_SHBs_P-G Product feature CHAIN JQ707680_SHBs_P-G of FT:mat_peptide JQ707680_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX849638_SHBs_P-G Product feature CHAIN JX849638_SHBs_P-G of FT:mat_peptide JX849638_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ICO003). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849639_SHBs_P-G Product feature CHAIN JX849639_SHBs_P-G of FT:mat_peptide JX849639_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ICO008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849641_SHBs_P-G Product feature CHAIN JX849641_SHBs_P-G of FT:mat_peptide JX849641_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ICO946). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPGCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849642_SHBs_P-G Product feature CHAIN JX849642_SHBs_P-G of FT:mat_peptide JX849642_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ICO354). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGGPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849643_SHBs_P-G Product feature CHAIN JX849643_SHBs_P-G of FT:mat_peptide JX849643_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ICO125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849644_SHBs_P-G Product feature CHAIN JX849644_SHBs_P-G of FT:mat_peptide JX849644_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 251_G). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQXGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFXLWVYI
>gnl|hbvpro|JX849646_SHBs_P-G Product feature CHAIN JX849646_SHBs_P-G of FT:mat_peptide JX849646_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 363_G). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC885585_SHBs_P-G Product feature CHAIN KC885585_SHBs_P-G of FT:mat_peptide KC885585_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MSM13-08). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF414679_SHBs_P-G Product feature CHAIN KF414679_SHBs_P-G of FT:mat_peptide KF414679_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate B213). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSLISCPPTCPGYRWMWLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF767450_SHBs_P-G Product feature CHAIN KF767450_SHBs_P-G of FT:mat_peptide KF767450_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF767451_SHBs_P-G Product feature CHAIN KF767451_SHBs_P-G of FT:mat_peptide KF767451_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_27). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF767452_SHBs_P-G Product feature CHAIN KF767452_SHBs_P-G of FT:mat_peptide KF767452_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_7). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTSPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF771917_SHBs_P-G Product feature CHAIN KF771917_SHBs_P-G of FT:mat_peptide KF771917_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ARC8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779233_SHBs_P-G Product feature CHAIN KF779233_SHBs_P-G of FT:mat_peptide KF779233_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6090). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779235_SHBs_P-G Product feature CHAIN KF779235_SHBs_P-G of FT:mat_peptide KF779235_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6106). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779267_SHBs_P-G Product feature CHAIN KF779267_SHBs_P-G of FT:mat_peptide KF779267_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate JFA3956). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF779357_SHBs_P-G Product feature CHAIN KF779357_SHBs_P-G of FT:mat_peptide KF779357_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate PNF5187). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGYFVLTRFFTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KJ194508_SHBs_P-G Product feature CHAIN KJ194508_SHBs_P-G of FT:mat_peptide KJ194508_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate HBV_Amsterdam_2_1994). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM455592_SHBs_P-G Product feature CHAIN KM455592_SHBs_P-G of FT:mat_peptide KM455592_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BY640). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM455685_SHBs_P-G Product feature CHAIN KM455685_SHBs_P-G of FT:mat_peptide KM455685_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BY782). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGTLLVLQAGFFLLTKILTIPQSLDSWWTSFNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM455794_SHBs_P-G Product feature CHAIN KM455794_SHBs_P-G of FT:mat_peptide KM455794_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate NP911). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCIKPSDGNCTCIPIPSSWAFVK
YLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|KM998716_SHBs_P-G Product feature CHAIN KM998716_SHBs_P-G of FT:mat_peptide KM998716_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KR230749_SHBs_P-G Product feature CHAIN KR230749_SHBs_P-G of FT:mat_peptide KR230749_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ENDV06GG). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGVFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX264500_SHBs_P-G Product feature CHAIN KX264500_SHBs_P-G of FT:mat_peptide KX264500_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate G-aej). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY004111_SHBs_P-G Product feature CHAIN KY004111_SHBs_P-G of FT:mat_peptide KY004111_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M-2015). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KY697840_SHBs_P-G Product feature CHAIN KY697840_SHBs_P-G of FT:mat_peptide KY697840_SHBs_P-G of [Viruses] Hepatitis B Virus genotype G (isolate HBV_Mrs_G_039915_2-9-2010). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
© 1998-2019