HBVdb

Dataset for protein HBSP of genotype H

[Download (right click)] [Alignment] [Repertoires]

27 sequence(s)

>gnl|hbvpro|AB059659_HBSP_P-H Product feature CHAIN AB059659_HBSP_P-H of FT:mat_peptide AB059659_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLHLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB059660_HBSP_P-H Product feature CHAIN AB059660_HBSP_P-H of FT:mat_peptide AB059660_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSCQQFRRLVLLDNEAGPLEEELPRLADEDLNHRVAEDLHLQLPNDLQPPARDPAKPAPLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB059661_HBSP_P-H Product feature CHAIN AB059661_HBSP_P-H of FT:mat_peptide AB059661_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB064315_HBSP_P-H Product feature CHAIN AB064315_HBSP_P-H of FT:mat_peptide AB064315_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQRFLSVLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB179747_HBSP_P-H Product feature CHAIN AB179747_HBSP_P-H of FT:mat_peptide AB179747_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JBDH1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDXQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB205010_HBSP_P-H Product feature CHAIN AB205010_HBSP_P-H of FT:mat_peptide AB205010_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBV-IM806-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB266536_HBSP_P-H Product feature CHAIN AB266536_HBSP_P-H of FT:mat_peptide AB266536_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JAIW05). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB275308_HBSP_P-H Product feature CHAIN AB275308_HBSP_P-H of FT:mat_peptide AB275308_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQPPARDPAKPAPLLLKDPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB353764_HBSP_P-H Product feature CHAIN AB353764_HBSP_P-H of FT:mat_peptide AB353764_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBDI03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGIGPQPVSHGSVY
>gnl|hbvpro|AB375159_HBSP_P-H Product feature CHAIN AB375159_HBSP_P-H of FT:mat_peptide AB375159_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB375160_HBSP_P-H Product feature CHAIN AB375160_HBSP_P-H of FT:mat_peptide AB375160_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB375161_HBSP_P-H Product feature CHAIN AB375161_HBSP_P-H of FT:mat_peptide AB375161_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB375162_HBSP_P-H Product feature CHAIN AB375162_HBSP_P-H of FT:mat_peptide AB375162_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB375163_HBSP_P-H Product feature CHAIN AB375163_HBSP_P-H of FT:mat_peptide AB375163_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDQQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB375164_HBSP_P-H Product feature CHAIN AB375164_HBSP_P-H of FT:mat_peptide AB375164_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AB818694_HBSP_P-H Product feature CHAIN AB818694_HBSP_P-H of FT:mat_peptide AB818694_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAVVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AY090454_HBSP_C-H Product feature CHAIN AY090454_HBSP_C-H of FT:mat_peptide AY090454_HBSP_C-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AY090457_HBSP_P-H Product feature CHAIN AY090457_HBSP_P-H of FT:mat_peptide AY090457_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARVPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|AY090460_HBSP_P-H Product feature CHAIN AY090460_HBSP_P-H of FT:mat_peptide AY090460_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LAS2523). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPLAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|EF157291_HBSP_P-H Product feature CHAIN EF157291_HBSP_P-H of FT:mat_peptide EF157291_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate B3586-YKH94). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHRLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|EU498228_HBSP_P-H Product feature CHAIN EU498228_HBSP_P-H of FT:mat_peptide EU498228_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 141). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|FJ356715_HBSP_P-H Product feature CHAIN FJ356715_HBSP_P-H of FT:mat_peptide FJ356715_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LL010169). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPLAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|FJ356716_HBSP_C-H Product feature CHAIN FJ356716_HBSP_C-H of FT:mat_peptide FJ356716_HBSP_C-H of [Viruses] Hepatitis B Virus genotype H (isolate CL150171). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDQQPPARDPAKPAPLLLKEPLCFPLAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|HM066946_HBSP_P-H Product feature CHAIN HM066946_HBSP_P-H of FT:mat_peptide HM066946_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0114). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPARPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|HM117850_HBSP_P-H Product feature CHAIN HM117850_HBSP_P-H of FT:mat_peptide HM117850_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0153). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGTGPQPVSHGSVY
>gnl|hbvpro|HQ285946_HBSP_P-H Product feature CHAIN HQ285946_HBSP_P-H of FT:mat_peptide HQ285946_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MXHBV102). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPARPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
>gnl|hbvpro|KX264501_HBSP_P-H Product feature CHAIN KX264501_HBSP_P-H of FT:mat_peptide KX264501_HBSP_P-H of [Viruses] Hepatitis B Virus genotype H (isolate H-ajt). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQPPARDPAKPAPLLLKEPLCFPPAAVPNLRT
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
© 1998-2019