HBVdb

Dataset for protein HBe of genotype H

[Download (right click)] [Alignment] [Repertoires]

40 sequence(s)

>gnl|hbvpro|AB059659_HBe_P-H Product feature CHAIN AB059659_HBe_P-H of FT:mat_peptide AB059659_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALHRDALESPEHCSPH
HTALRQAVSCWREVTDFGDWVGNNLQDQAARDLVVNYVNANIGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPSSKC
>gnl|hbvpro|AB059660_HBe_P-H Product feature CHAIN AB059660_HBe_P-H of FT:mat_peptide AB059660_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTPH
HTAIRQVILCWGELMTLASWVGNNLNDPAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPA
YRPPNAPILSTIPETCVIRQRGRAPRGRTPSPRRRRSKSPRRRRSPSPASQC
>gnl|hbvpro|AB059661_HBe_P-H Product feature CHAIN AB059661_HBe_P-H of FT:mat_peptide AB059661_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB064315_HBe_P-H Product feature CHAIN AB064315_HBe_P-H of FT:mat_peptide AB064315_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPECTVIRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB179747_HBe_P-H Product feature CHAIN AB179747_HBe_P-H of FT:mat_peptide AB179747_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JBDH1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205010_HBe_P-H Product feature CHAIN AB205010_HBe_P-H of FT:mat_peptide AB205010_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBV-IM806-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPS
HTALRQAILCWGELMTLASWVGNNLEDPGARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB266536_HBe_P-H Product feature CHAIN AB266536_HBe_P-H of FT:mat_peptide AB266536_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JAIW05). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB275308_HBe_P-H Product feature CHAIN AB275308_HBe_P-H of FT:mat_peptide AB275308_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB353764_HBe_P-H Product feature CHAIN AB353764_HBe_P-H of FT:mat_peptide AB353764_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBDI03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB375159_HBe_P-H Product feature CHAIN AB375159_HBe_P-H of FT:mat_peptide AB375159_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB375160_HBe_P-H Product feature CHAIN AB375160_HBe_P-H of FT:mat_peptide AB375160_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB375161_HBe_P-H Product feature CHAIN AB375161_HBe_P-H of FT:mat_peptide AB375161_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB375162_HBe_P-H Product feature CHAIN AB375162_HBe_P-H of FT:mat_peptide AB375162_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLXFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB375163_HBe_P-H Product feature CHAIN AB375163_HBe_P-H of FT:mat_peptide AB375163_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB375164_HBe_P-H Product feature CHAIN AB375164_HBe_P-H of FT:mat_peptide AB375164_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB818694_HBe_P-H Product feature CHAIN AB818694_HBe_P-H of FT:mat_peptide AB818694_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY090454_HBe_C-H Product feature CHAIN AY090454_HBe_C-H of FT:mat_peptide AY090454_HBe_C-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY090457_HBe_P-H Product feature CHAIN AY090457_HBe_P-H of FT:mat_peptide AY090457_HBe_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY090460_HBe_P-H Product feature CHAIN AY090460_HBe_P-H of FT:mat_peptide AY090460_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LAS2523). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EF157291_HBe_P-H Product feature CHAIN EF157291_HBe_P-H of FT:mat_peptide EF157291_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate B3586-YKH94). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU498228_HBe_P-H Product feature CHAIN EU498228_HBe_P-H of FT:mat_peptide EU498228_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 141). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ356715_HBe_P-H Product feature CHAIN FJ356715_HBe_P-H of FT:mat_peptide FJ356715_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LL010169). Complete genome. [Hepadnaviridae] (length=212 residues).
IQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPNDFFPSVRDLLDTASALHREALESPDHCTPN
HTALRQAISCWGELMTLASWVGNNLEDPAARDLVVNYVNANMGLKIRQFLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ356716_HBe_C-H Product feature CHAIN FJ356716_HBe_C-H of FT:mat_peptide FJ356716_HBe_C-H of [Viruses] Hepatitis B Virus genotype H (isolate CL150171). Complete genome. [Hepadnaviridae] (length=212 residues).
IQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALHRDALESPDHCTPN
HTALRQAISCWGELMNLASWVGNNLEDPAARDLVVNYVNANMGLKIRQFLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM066946_HBe_P-H Product feature CHAIN HM066946_HBe_P-H of FT:mat_peptide HM066946_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0114). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPS
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPPNAPILSTLPETTVIRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM117850_HBe_P-H Product feature CHAIN HM117850_HBe_P-H of FT:mat_peptide HM117850_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0153). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM117851_HBe_P-H Product feature CHAIN HM117851_HBe_P-H of FT:mat_peptide HM117851_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0201). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896124_HBe_P-H Product feature CHAIN JX896124_HBe_P-H of FT:mat_peptide JX896124_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-76). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896125_HBe_P-H Product feature CHAIN JX896125_HBe_P-H of FT:mat_peptide JX896125_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-92). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MXLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896126_HBe_P-H Product feature CHAIN JX896126_HBe_P-H of FT:mat_peptide JX896126_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-101). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIXCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVSTNMGLKIRQLLWFHISXLTFGRETVLEYLVXFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896127_HBe_P-H Product feature CHAIN JX896127_HBe_P-H of FT:mat_peptide JX896127_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-104). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEXLSFLPSDFFPSVRDLXDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896128_HBe_P-H Product feature CHAIN JX896128_HBe_P-H of FT:mat_peptide JX896128_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-117H). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNNNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896129_HBe_P-H Product feature CHAIN JX896129_HBe_P-H of FT:mat_peptide JX896129_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-121). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPN
HTAIRQAILCWGELMTLASWVGHNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896130_HBe_P-H Product feature CHAIN JX896130_HBe_P-H of FT:mat_peptide JX896130_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLXFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896131_HBe_P-H Product feature CHAIN JX896131_HBe_P-H of FT:mat_peptide JX896131_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-130). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWXHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896132_HBe_P-H Product feature CHAIN JX896132_HBe_P-H of FT:mat_peptide JX896132_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-143H). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
XTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX896133_HBe_P-H Product feature CHAIN JX896133_HBe_P-H of FT:mat_peptide JX896133_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-146). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGGWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSRASQC
>gnl|hbvpro|JX896134_HBe_P-H Product feature CHAIN JX896134_HBe_P-H of FT:mat_peptide JX896134_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-151). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JX915624_HBe_P-H Product feature CHAIN JX915624_HBe_P-H of FT:mat_peptide JX915624_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBcMX-133). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
FLLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KC836867_HBe_P-H Product feature CHAIN KC836867_HBe_P-H of FT:mat_peptide KC836867_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate AH51). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KX264501_HBe_P-H Product feature CHAIN KX264501_HBe_P-H of FT:mat_peptide KX264501_HBe_P-H of [Viruses] Hepatitis B Virus genotype H (isolate H-ajt). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
© 1998-2019