HBVdb

Dataset for protein HBx of genotype H

[Download (right click)] [Alignment] [Repertoires]

34 sequence(s)

>gnl|hbvpro|AB059659_HBx_P-H Product feature CHAIN AB059659_HBx_P-H of FT:mat_peptide AB059659_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARHME
TTVNAPWNLPTTLYKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB059660_HBx_P-H Product feature CHAIN AB059660_HBx_P-H of FT:mat_peptide AB059660_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPRSLPTTLHKRTLGLSPRSTTWIEDYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB059661_HBx_P-H Product feature CHAIN AB059661_HBx_P-H of FT:mat_peptide AB059661_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPRSLPTTLHKRTLGLSPRSTTWIEDYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB064315_HBx_P-H Product feature CHAIN AB064315_HBx_P-H of FT:mat_peptide AB064315_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPANDGSHLSLRGLPACAFSSAGPCALRFTSARHME
TTVNAPRNLPTTLYKRTLGLSPRSMTWIEEYIKDCVFKGWEESGEELRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB179747_HBx_P-H Product feature CHAIN AB179747_HBx_P-H of FT:mat_peptide AB179747_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JBDH1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205010_HBx_P-H Product feature CHAIN AB205010_HBx_P-H of FT:mat_peptide AB205010_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBV-IM806-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPAVDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLMIFVLGGCRHKLVCSPAPCNFSTSA
>gnl|hbvpro|AB266536_HBx_P-H Product feature CHAIN AB266536_HBx_P-H of FT:mat_peptide AB266536_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JAIW05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB275308_HBx_P-H Product feature CHAIN AB275308_HBx_P-H of FT:mat_peptide AB275308_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MADRLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB353764_HBx_P-H Product feature CHAIN AB353764_HBx_P-H of FT:mat_peptide AB353764_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBDI03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPPSSPPVVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB375159_HBx_P-H Product feature CHAIN AB375159_HBx_P-H of FT:mat_peptide AB375159_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB375160_HBx_P-H Product feature CHAIN AB375160_HBx_P-H of FT:mat_peptide AB375160_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB375161_HBx_P-H Product feature CHAIN AB375161_HBx_P-H of FT:mat_peptide AB375161_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPXNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB375162_HBx_P-H Product feature CHAIN AB375162_HBx_P-H of FT:mat_peptide AB375162_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAHWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB375163_HBx_P-H Product feature CHAIN AB375163_HBx_P-H of FT:mat_peptide AB375163_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPQSLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB375164_HBx_P-H Product feature CHAIN AB375164_HBx_P-H of FT:mat_peptide AB375164_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TXVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB818694_HBx_P-H Product feature CHAIN AB818694_HBx_P-H of FT:mat_peptide AB818694_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY090454_HBx_C-H Product feature CHAIN AY090454_HBx_C-H of FT:mat_peptide AY090454_HBx_C-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDRAHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPQSLPTPLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY090457_HBx_P-H Product feature CHAIN AY090457_HBx_P-H of FT:mat_peptide AY090457_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPQSLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY090460_HBx_P-H Product feature CHAIN AY090460_HBx_P-H of FT:mat_peptide AY090460_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LAS2523). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF157291_HBx_P-H Product feature CHAIN EF157291_HBx_P-H of FT:mat_peptide EF157291_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate B3586-YKH94). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU498228_HBx_P-H Product feature CHAIN EU498228_HBx_P-H of FT:mat_peptide EU498228_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 141). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ356715_HBx_P-H Product feature CHAIN FJ356715_HBx_P-H of FT:mat_peptide FJ356715_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LL010169). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLYKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPFNFFTSA
>gnl|hbvpro|FJ356716_HBx_C-H Product feature CHAIN FJ356716_HBx_C-H of FT:mat_peptide FJ356716_HBx_C-H of [Viruses] Hepatitis B Virus genotype H (isolate CL150171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPFNFFTSA
>gnl|hbvpro|HM066946_HBx_P-H Product feature CHAIN HM066946_HBx_P-H of FT:mat_peptide HM066946_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPRSLPTTLHKRTLGLSPRSTTWIEDYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM117850_HBx_P-H Product feature CHAIN HM117850_HBx_P-H of FT:mat_peptide HM117850_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0153). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSFGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM117851_HBx_P-H Product feature CHAIN HM117851_HBx_P-H of FT:mat_peptide HM117851_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0201). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPQSTTWIEEYIKDCVFKDWEESGEESRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM998718_HBx_P-H Product feature CHAIN KM998718_HBx_P-H of FT:mat_peptide KM998718_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPQSLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|KM998719_HBx_P-H Product feature CHAIN KM998719_HBx_P-H of FT:mat_peptide KM998719_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPQSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHRLVCSPAPCNFFTSG
>gnl|hbvpro|KM998720_HBx_P-H Product feature CHAIN KM998720_HBx_P-H of FT:mat_peptide KM998720_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPTDDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM998721_HBx_P-H Product feature CHAIN KM998721_HBx_P-H of FT:mat_peptide KM998721_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM998723_HBx_P-H Product feature CHAIN KM998723_HBx_P-H of FT:mat_peptide KM998723_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPQSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX264501_HBx_P-H Product feature CHAIN KX264501_HBx_P-H of FT:mat_peptide KX264501_HBx_P-H of [Viruses] Hepatitis B Virus genotype H (isolate H-ajt). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY458059_HBx_P-H Product feature CHAIN KY458059_HBx_P-H of FT:mat_peptide KY458059_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY458060_HBx_P-H Product feature CHAIN KY458060_HBx_P-H of FT:mat_peptide KY458060_HBx_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDGSHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAPWNLPTTLHKRTLGLSPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
© 1998-2019