HBVdb

Dataset for protein MHBs of genotype H

[Download (right click)] [Alignment] [Repertoires]

31 sequence(s)

>gnl|hbvpro|AB059659_MHBs_P-H Product feature CHAIN AB059659_MHBs_P-H of FT:mat_peptide AB059659_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLPVLQGVFFSLTKI
LTIPQSLDSWWTSLNFLEVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB059660_MHBs_P-H Product feature CHAIN AB059660_MHBs_P-H of FT:mat_peptide AB059660_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYLPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB059661_MHBs_P-H Product feature CHAIN AB059661_MHBs_P-H of FT:mat_peptide AB059661_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILRPFIPLLPIFCYLWASI
>gnl|hbvpro|AB179747_MHBs_P-H Product feature CHAIN AB179747_MHBs_P-H of FT:mat_peptide AB179747_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JBDH1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB205010_MHBs_P-H Product feature CHAIN AB205010_MHBs_P-H of FT:mat_peptide AB205010_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBV-IM806-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYLPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB266536_MHBs_P-H Product feature CHAIN AB266536_MHBs_P-H of FT:mat_peptide AB266536_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JAIW05). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPVMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB275308_MHBs_P-H Product feature CHAIN AB275308_MHBs_P-H of FT:mat_peptide AB275308_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB353764_MHBs_P-H Product feature CHAIN AB353764_MHBs_P-H of FT:mat_peptide AB353764_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBDI03). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPVMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375159_MHBs_P-H Product feature CHAIN AB375159_MHBs_P-H of FT:mat_peptide AB375159_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375160_MHBs_P-H Product feature CHAIN AB375160_MHBs_P-H of FT:mat_peptide AB375160_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRRMCLRRFIIFLFILLLGLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLAQFAQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375161_MHBs_P-H Product feature CHAIN AB375161_MHBs_P-H of FT:mat_peptide AB375161_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=282 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIVSLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASIX
>gnl|hbvpro|AB375162_MHBs_P-H Product feature CHAIN AB375162_MHBs_P-H of FT:mat_peptide AB375162_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375163_MHBs_P-H Product feature CHAIN AB375163_MHBs_P-H of FT:mat_peptide AB375163_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIVSLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVPFVQWCVG
LSPTVWLSAIWMMWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375164_MHBs_P-H Product feature CHAIN AB375164_MHBs_P-H of FT:mat_peptide AB375164_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB818694_MHBs_P-H Product feature CHAIN AB818694_MHBs_P-H of FT:mat_peptide AB818694_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPVMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AY090454_MHBs_C-H Product feature CHAIN AY090454_MHBs_C-H of FT:mat_peptide AY090454_MHBs_C-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPVPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AY090457_MHBs_P-H Product feature CHAIN AY090457_MHBs_P-H of FT:mat_peptide AY090457_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYLPAGGSSSETQNPVPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AY090460_MHBs_P-H Product feature CHAIN AY090460_MHBs_P-H of FT:mat_peptide AY090460_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LAS2523). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLRPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|EF157291_MHBs_P-H Product feature CHAIN EF157291_MHBs_P-H of FT:mat_peptide EF157291_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate B3586-YKH94). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|EU159675_MHBs_P-H Product feature CHAIN EU159675_MHBs_P-H of FT:mat_peptide EU159675_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate Irish-17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|EU498228_MHBs_P-H Product feature CHAIN EU498228_MHBs_P-H of FT:mat_peptide EU498228_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 141). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPVMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|FJ356715_MHBs_P-H Product feature CHAIN FJ356715_MHBs_P-H of FT:mat_peptide FJ356715_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LL010169). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSIQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVFFLLTKV
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|FJ356716_MHBs_C-H Product feature CHAIN FJ356716_MHBs_C-H of FT:mat_peptide FJ356716_MHBs_C-H of [Viruses] Hepatitis B Virus genotype H (isolate CL150171). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
RTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|HM066946_MHBs_P-H Product feature CHAIN HM066946_MHBs_P-H of FT:mat_peptide HM066946_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0114). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|HM117850_MHBs_P-H Product feature CHAIN HM117850_MHBs_P-H of FT:mat_peptide HM117850_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0153). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVG
LSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|HM117851_MHBs_P-H Product feature CHAIN HM117851_MHBs_P-H of FT:mat_peptide HM117851_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0201). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCIKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|HQ285946_MHBs_P-H Product feature CHAIN HQ285946_MHBs_P-H of FT:mat_peptide HQ285946_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MXHBV102). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|JN604202_MHBs_P-H Product feature CHAIN JN604202_MHBs_P-H of FT:mat_peptide JN604202_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 479-0567-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPKVRGLYFPAGGSSSETQNPAPTIVSLTSSIFSKTGDPAMNMKNITSGLLGPLLVLQAVFFSLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNXQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGNYLWEWASARFSWLSLLVQFVQWCVG
LSPIVWPLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWASI
>gnl|hbvpro|JN604203_MHBs_P-H Product feature CHAIN JN604203_MHBs_P-H of FT:mat_peptide JN604203_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 479-2619-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
XTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLYSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|JN604310_MHBs_P-H Product feature CHAIN JN604310_MHBs_P-H of FT:mat_peptide JN604310_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 479-5454-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIVSLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KX264501_MHBs_P-H Product feature CHAIN KX264501_MHBs_P-H of FT:mat_peptide KX264501_MHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate H-ajt). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
LTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
© 1998-2019