HBVdb

Dataset for protein SHBs of genotype H

[Download (right click)] [Alignment] [Repertoires]

89 sequence(s)

>gnl|hbvpro|AB059659_SHBs_P-H Product feature CHAIN AB059659_SHBs_P-H of FT:mat_peptide AB059659_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLPVLQGVFFSLTKILTIPQSLDSWWTSLNFLEVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB059660_SHBs_P-H Product feature CHAIN AB059660_SHBs_P-H of FT:mat_peptide AB059660_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB059661_SHBs_P-H Product feature CHAIN AB059661_SHBs_P-H of FT:mat_peptide AB059661_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILRPFIPLLPIFCYLWASI
>gnl|hbvpro|AB064315_SHBs_P-H Product feature CHAIN AB064315_SHBs_P-H of FT:mat_peptide AB064315_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB179747_SHBs_P-H Product feature CHAIN AB179747_SHBs_P-H of FT:mat_peptide AB179747_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JBDH1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB205010_SHBs_P-H Product feature CHAIN AB205010_SHBs_P-H of FT:mat_peptide AB205010_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBV-IM806-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB266536_SHBs_P-H Product feature CHAIN AB266536_SHBs_P-H of FT:mat_peptide AB266536_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HB-JAIW05). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB275308_SHBs_P-H Product feature CHAIN AB275308_SHBs_P-H of FT:mat_peptide AB275308_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB353764_SHBs_P-H Product feature CHAIN AB353764_SHBs_P-H of FT:mat_peptide AB353764_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBDI03). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB353765_SHBs_P-H Product feature CHAIN AB353765_SHBs_P-H of FT:mat_peptide AB353765_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBDI01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB353766_SHBs_P-H Product feature CHAIN AB353766_SHBs_P-H of FT:mat_peptide AB353766_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate HBDI02). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375159_SHBs_P-H Product feature CHAIN AB375159_SHBs_P-H of FT:mat_peptide AB375159_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375160_SHBs_P-H Product feature CHAIN AB375160_SHBs_P-H of FT:mat_peptide AB375160_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRRMCLRRF
IIFLFILLLGLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLAQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375161_SHBs_P-H Product feature CHAIN AB375161_SHBs_P-H of FT:mat_peptide AB375161_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=227 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASIX
>gnl|hbvpro|AB375162_SHBs_P-H Product feature CHAIN AB375162_SHBs_P-H of FT:mat_peptide AB375162_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375163_SHBs_P-H Product feature CHAIN AB375163_SHBs_P-H of FT:mat_peptide AB375163_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSAIWMMWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB375164_SHBs_P-H Product feature CHAIN AB375164_SHBs_P-H of FT:mat_peptide AB375164_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AB818694_SHBs_P-H Product feature CHAIN AB818694_SHBs_P-H of FT:mat_peptide AB818694_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AF369531_SHBs_P-H Product feature CHAIN AF369531_SHBs_P-H of FT:mat_peptide AF369531_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX210). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AF369535_SHBs_P-H Product feature CHAIN AF369535_SHBs_P-H of FT:mat_peptide AF369535_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX3c). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AF369536_SHBs_P-H Product feature CHAIN AF369536_SHBs_P-H of FT:mat_peptide AF369536_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX182). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSRNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFILLLPIFCYLWASI
>gnl|hbvpro|AF369537_SHBs_P-H Product feature CHAIN AF369537_SHBs_P-H of FT:mat_peptide AF369537_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX261). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AF369538_SHBs_P-H Product feature CHAIN AF369538_SHBs_P-H of FT:mat_peptide AF369538_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX2c). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AF369539_SHBs_P-H Product feature CHAIN AF369539_SHBs_P-H of FT:mat_peptide AF369539_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX567). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AF369540_SHBs_P-H Product feature CHAIN AF369540_SHBs_P-H of FT:mat_peptide AF369540_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX350). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPICCYLWASI
>gnl|hbvpro|AF369541_SHBs_P-H Product feature CHAIN AF369541_SHBs_P-H of FT:mat_peptide AF369541_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX571). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AF369542_SHBs_P-H Product feature CHAIN AF369542_SHBs_P-H of FT:mat_peptide AF369542_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX637). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AF369543_SHBs_P-H Product feature CHAIN AF369543_SHBs_P-H of FT:mat_peptide AF369543_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX562). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AY090454_SHBs_C-H Product feature CHAIN AY090454_SHBs_C-H of FT:mat_peptide AY090454_SHBs_C-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AY090457_SHBs_P-H Product feature CHAIN AY090457_SHBs_P-H of FT:mat_peptide AY090457_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|AY090460_SHBs_P-H Product feature CHAIN AY090460_SHBs_P-H of FT:mat_peptide AY090460_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LAS2523). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLRPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236101_SHBs_P-H Product feature CHAIN DQ236101_SHBs_P-H of FT:mat_peptide DQ236101_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236102_SHBs_P-H Product feature CHAIN DQ236102_SHBs_P-H of FT:mat_peptide DQ236102_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C02). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236106_SHBs_P-H Product feature CHAIN DQ236106_SHBs_P-H of FT:mat_peptide DQ236106_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C06). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPICCYLWASI
>gnl|hbvpro|DQ236109_SHBs_P-H Product feature CHAIN DQ236109_SHBs_P-H of FT:mat_peptide DQ236109_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C09). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSWCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLAIWMMWYWGPSLCSILSPFIPLLPIFCCLWAYI
>gnl|hbvpro|DQ236111_SHBs_P-H Product feature CHAIN DQ236111_SHBs_P-H of FT:mat_peptide DQ236111_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQSSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236112_SHBs_P-H Product feature CHAIN DQ236112_SHBs_P-H of FT:mat_peptide DQ236112_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQSSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFVK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236113_SHBs_P-H Product feature CHAIN DQ236113_SHBs_P-H of FT:mat_peptide DQ236113_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFRK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236114_SHBs_P-H Product feature CHAIN DQ236114_SHBs_P-H of FT:mat_peptide DQ236114_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMLPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASVRFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236115_SHBs_P-H Product feature CHAIN DQ236115_SHBs_P-H of FT:mat_peptide DQ236115_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRRMCLRRF
IIFLFILLLGLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLAQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236118_SHBs_P-H Product feature CHAIN DQ236118_SHBs_P-H of FT:mat_peptide DQ236118_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX C18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSAIWMMWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236120_SHBs_P-H Product feature CHAIN DQ236120_SHBs_P-H of FT:mat_peptide DQ236120_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236121_SHBs_P-H Product feature CHAIN DQ236121_SHBs_P-H of FT:mat_peptide DQ236121_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B02). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236122_SHBs_P-H Product feature CHAIN DQ236122_SHBs_P-H of FT:mat_peptide DQ236122_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B03). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236123_SHBs_P-H Product feature CHAIN DQ236123_SHBs_P-H of FT:mat_peptide DQ236123_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B04). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236124_SHBs_P-H Product feature CHAIN DQ236124_SHBs_P-H of FT:mat_peptide DQ236124_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B05). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCSLLTKIRTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLFSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236125_SHBs_P-H Product feature CHAIN DQ236125_SHBs_P-H of FT:mat_peptide DQ236125_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B06). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236126_SHBs_P-H Product feature CHAIN DQ236126_SHBs_P-H of FT:mat_peptide DQ236126_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B07). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLGVPPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFTLLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTAWLSVIWMIWYWGPNLHTILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236127_SHBs_P-H Product feature CHAIN DQ236127_SHBs_P-H of FT:mat_peptide DQ236127_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B08). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQGVFFSLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236129_SHBs_P-H Product feature CHAIN DQ236129_SHBs_P-H of FT:mat_peptide DQ236129_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLPVLQAVCSLLIKILTIPQSLDSWWTSLSFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMVPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCNIWSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236130_SHBs_P-H Product feature CHAIN DQ236130_SHBs_P-H of FT:mat_peptide DQ236130_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTSLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236131_SHBs_P-H Product feature CHAIN DQ236131_SHBs_P-H of FT:mat_peptide DQ236131_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|DQ236132_SHBs_P-H Product feature CHAIN DQ236132_SHBs_P-H of FT:mat_peptide DQ236132_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX B13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPGCPGQNSQSPISNHLPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|EF157291_SHBs_P-H Product feature CHAIN EF157291_SHBs_P-H of FT:mat_peptide EF157291_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate B3586-YKH94). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|EU159675_SHBs_P-H Product feature CHAIN EU159675_SHBs_P-H of FT:mat_peptide EU159675_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate Irish-17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|EU498228_SHBs_P-H Product feature CHAIN EU498228_SHBs_P-H of FT:mat_peptide EU498228_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 141). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|FJ356715_SHBs_P-H Product feature CHAIN FJ356715_SHBs_P-H of FT:mat_peptide FJ356715_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate LL010169). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVFFLLTKVLTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|FJ356716_SHBs_C-H Product feature CHAIN FJ356716_SHBs_C-H of FT:mat_peptide FJ356716_SHBs_C-H of [Viruses] Hepatitis B Virus genotype H (isolate CL150171). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|GQ486268_SHBs_P-H Product feature CHAIN GQ486268_SHBs_P-H of FT:mat_peptide GQ486268_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate GS233). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVSFLLTKILTIPRSLDSWWTSLSFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLYSTLSPFIPLLPIFCYLWASI
>gnl|hbvpro|GQ486375_SHBs_P-H Product feature CHAIN GQ486375_SHBs_P-H of FT:mat_peptide GQ486375_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate GS340). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLSFLGVPPXCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCXILSPFIPLLPIFCYLWASI
>gnl|hbvpro|GQ486592_SHBs_P-H Product feature CHAIN GQ486592_SHBs_P-H of FT:mat_peptide GQ486592_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate GS557). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|HM066946_SHBs_P-H Product feature CHAIN HM066946_SHBs_P-H of FT:mat_peptide HM066946_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0114). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|HM117850_SHBs_P-H Product feature CHAIN HM117850_SHBs_P-H of FT:mat_peptide HM117850_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0153). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|HM117851_SHBs_P-H Product feature CHAIN HM117851_SHBs_P-H of FT:mat_peptide HM117851_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MX-HBV-0201). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCIKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|HQ285946_SHBs_P-H Product feature CHAIN HQ285946_SHBs_P-H of FT:mat_peptide HQ285946_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MXHBV102). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|JN604202_SHBs_P-H Product feature CHAIN JN604202_SHBs_P-H of FT:mat_peptide JN604202_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 479-0567-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MKNITSGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNXQSPISNHLPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGN
YLWEWASARFSWLSLLVQFVQWCVGLSPIVWPLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWASI
>gnl|hbvpro|JN604203_SHBs_P-H Product feature CHAIN JN604203_SHBs_P-H of FT:mat_peptide JN604203_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 479-2619-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKIXTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLQTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLYSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|JN604310_SHBs_P-H Product feature CHAIN JN604310_SHBs_P-H of FT:mat_peptide JN604310_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 479-5454-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KC836829_SHBs_P-H Product feature CHAIN KC836829_SHBs_P-H of FT:mat_peptide KC836829_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate AH51). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KM606705_SHBs_P-H Product feature CHAIN KM606705_SHBs_P-H of FT:mat_peptide KM606705_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate Cuba51a). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGEPPGCPGQNSQSPISNHLPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILRPFIPLLPIFCYLWASI
>gnl|hbvpro|KM606937_SHBs_P-H Product feature CHAIN KM606937_SHBs_P-H of FT:mat_peptide KM606937_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate Cuba114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGEPPGCPGQNSQSPISNHLPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILRPFIPLLPICCYLWASI
>gnl|hbvpro|KM998717_SHBs_P-H Product feature CHAIN KM998717_SHBs_P-H of FT:mat_peptide KM998717_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCXPIPSSWAFGK
YLWGWASARFFWLSLLVPFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILRPFIPLLPIFCYLWASI
>gnl|hbvpro|KM998718_SHBs_P-H Product feature CHAIN KM998718_SHBs_P-H of FT:mat_peptide KM998718_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KM998719_SHBs_P-H Product feature CHAIN KM998719_SHBs_P-H of FT:mat_peptide KM998719_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KM998720_SHBs_P-H Product feature CHAIN KM998720_SHBs_P-H of FT:mat_peptide KM998720_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KM998721_SHBs_P-H Product feature CHAIN KM998721_SHBs_P-H of FT:mat_peptide KM998721_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KM998722_SHBs_P-H Product feature CHAIN KM998722_SHBs_P-H of FT:mat_peptide KM998722_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCTKPSEGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KM998723_SHBs_P-H Product feature CHAIN KM998723_SHBs_P-H of FT:mat_peptide KM998723_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KP997512_SHBs_P-H Product feature CHAIN KP997512_SHBs_P-H of FT:mat_peptide KP997512_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 214_B). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KX264501_SHBs_P-H Product feature CHAIN KX264501_SHBs_P-H of FT:mat_peptide KX264501_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate H-ajt). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KX372218_SHBs_P-H Product feature CHAIN KX372218_SHBs_P-H of FT:mat_peptide KX372218_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate B158_2013_H). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLWRILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KY458059_SHBs_P-H Product feature CHAIN KY458059_SHBs_P-H of FT:mat_peptide KY458059_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|KY458060_SHBs_P-H Product feature CHAIN KY458060_SHBs_P-H of FT:mat_peptide KY458060_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|MF150691_SHBs_P-H Product feature CHAIN MF150691_SHBs_P-H of FT:mat_peptide MF150691_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX932M). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPECPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSTLRPFIPLLPIFCYLWASI
>gnl|hbvpro|MF150692_SHBs_P-H Product feature CHAIN MF150692_SHBs_P-H of FT:mat_peptide MF150692_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX931M). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPECPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGLNLWSTLRPFIPLLPIFCYLWASI
>gnl|hbvpro|MF150695_SHBs_P-H Product feature CHAIN MF150695_SHBs_P-H of FT:mat_peptide MF150695_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX023N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLSNTLSPFIPLLPIFCYLWASI
>gnl|hbvpro|MF150696_SHBs_P-H Product feature CHAIN MF150696_SHBs_P-H of FT:mat_peptide MF150696_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate MEX019N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|U91819_SHBs_P-H Product feature CHAIN U91819_SHBs_P-H of FT:mat_peptide U91819_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 2928NIC Nicaragua). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
>gnl|hbvpro|U91827_SHBs_P-H Product feature CHAIN U91827_SHBs_P-H of FT:mat_peptide U91827_SHBs_P-H of [Viruses] Hepatitis B Virus genotype H (isolate 1853NIC Nicaragua). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
© 1998-2019