HBVdb

Dataset for protein HBSP of genotype RF

[Download (right click)] [Alignment] [Repertoires]

875 sequence(s)

>gnl|hbvpro|AB014375_HBSP_P-RF-CB Product feature CHAIN AB014375_HBSP_P-RF-CB of FT:mat_peptide AB014375_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 16T01HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB033557_HBSP_P-RF-CB Product feature CHAIN AB033557_HBSP_P-RF-CB of FT:mat_peptide AB033557_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IWK146). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEPQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|AB033559_HBSP_P-RF-DE Product feature CHAIN AB033559_HBSP_P-RF-DE of FT:mat_peptide AB033559_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate PYW310). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AB048702_HBSP_P-RF-DE Product feature CHAIN AB048702_HBSP_P-RF-DE of FT:mat_peptide AB048702_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AB048703_HBSP_P-RF-DE Product feature CHAIN AB048703_HBSP_P-RF-DE of FT:mat_peptide AB048703_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AB049609_HBSP_P-RF-CB Product feature CHAIN AB049609_HBSP_P-RF-CB of FT:mat_peptide AB049609_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV AN28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQLPVRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB105172_HBSP_P-RF-CB Product feature CHAIN AB105172_HBSP_P-RF-CB of FT:mat_peptide AB105172_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hawaii 2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB188243_HBSP_P-RF-DE Product feature CHAIN AB188243_HBSP_P-RF-DE of FT:mat_peptide AB188243_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate KAMCHATKA27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEHARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB188245_HBSP_P-RF-DE Product feature CHAIN AB188245_HBSP_P-RF-DE of FT:mat_peptide AB188245_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ALTAY136). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB194949_HBSP_P-RF-AE Product feature CHAIN AB194949_HBSP_P-RF-AE of FT:mat_peptide AB194949_HBSP_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate CMR151). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDHAEPARLLLKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AB195939_HBSP_P-RF-CB Product feature CHAIN AB195939_HBSP_P-RF-CB of FT:mat_peptide AB195939_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB195940_HBSP_P-RF-CB Product feature CHAIN AB195940_HBSP_P-RF-CB of FT:mat_peptide AB195940_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|AB195941_HBSP_P-RF-CB Product feature CHAIN AB195941_HBSP_P-RF-CB of FT:mat_peptide AB195941_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|AB195950_HBSP_P-RF-CB Product feature CHAIN AB195950_HBSP_P-RF-CB of FT:mat_peptide AB195950_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|AB195951_HBSP_P-RF-CB Product feature CHAIN AB195951_HBSP_P-RF-CB of FT:mat_peptide AB195951_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|AB195955_HBSP_P-RF-CB Product feature CHAIN AB195955_HBSP_P-RF-CB of FT:mat_peptide AB195955_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB195956_HBSP_P-RF-CB Product feature CHAIN AB195956_HBSP_P-RF-CB of FT:mat_peptide AB195956_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|AB195957_HBSP_P-RF-CB Product feature CHAIN AB195957_HBSP_P-RF-CB of FT:mat_peptide AB195957_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|AB198084_HBSP_P-RF-CB Product feature CHAIN AB198084_HBSP_P-RF-CB of FT:mat_peptide AB198084_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB205152_HBSP_P-RF-CB Product feature CHAIN AB205152_HBSP_P-RF-CB of FT:mat_peptide AB205152_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HB-JFH7-99). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRT
ZTALVFPSHXPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB222708_HBSP_P-RF-AD Product feature CHAIN AB222708_HBSP_P-RF-AD of FT:mat_peptide AB222708_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate UZBV74). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AB241109_HBSP_P-RF-CB Product feature CHAIN AB241109_HBSP_P-RF-CB of FT:mat_peptide AB241109_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate PhCH24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHPQQARDHARPARLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB270535_HBSP_P-RF-DC Product feature CHAIN AB270535_HBSP_P-RF-DC of FT:mat_peptide AB270535_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate MGL50F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AB270538_HBSP_P-RF-DE Product feature CHAIN AB270538_HBSP_P-RF-DE of FT:mat_peptide AB270538_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MGL231F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARAHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB300369_HBSP_P-RF-CB Product feature CHAIN AB300369_HBSP_P-RF-CB of FT:mat_peptide AB300369_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEVGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB330368_HBSP_P-RF-DA Product feature CHAIN AB330368_HBSP_P-RF-DA of FT:mat_peptide AB330368_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate TAJ54HBV). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNL
RTEIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB367393_HBSP_P-RF-CB Product feature CHAIN AB367393_HBSP_P-RF-CB of FT:mat_peptide AB367393_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 2/Adefovir-treated Pt. 2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLKLGNLNEHQLPARDHARPARLLLKEPLCFPLAAVQNLRT
EIALVFPSHHPGLSQDSYGIGPQSVSHGSVY
>gnl|hbvpro|AB367400_HBSP_P-RF-CB Product feature CHAIN AB367400_HBSP_P-RF-CB of FT:mat_peptide AB367400_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQLPARDHARPARFLLKDPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|AB367419_HBSP_P-RF-CB Product feature CHAIN AB367419_HBSP_P-RF-CB of FT:mat_peptide AB367419_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|AB367800_HBSP_P-RF-CB Product feature CHAIN AB367800_HBSP_P-RF-CB of FT:mat_peptide AB367800_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ADVT Pt. 24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|AB453985_HBSP_P-RF-AC Product feature CHAIN AB453985_HBSP_P-RF-AC of FT:mat_peptide AB453985_HBSP_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate JPN_CH7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVQDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB493837_HBSP_P-RF-CB Product feature CHAIN AB493837_HBSP_P-RF-CB of FT:mat_peptide AB493837_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 03UC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB493838_HBSP_P-RF-CB Product feature CHAIN AB493838_HBSP_P-RF-CB of FT:mat_peptide AB493838_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 06UC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB493840_HBSP_P-RF-CB Product feature CHAIN AB493840_HBSP_P-RF-CB of FT:mat_peptide AB493840_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 16UC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNEPQLPARDLARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSLGSVY
>gnl|hbvpro|AB493842_HBSP_P-RF-CB Product feature CHAIN AB493842_HBSP_P-RF-CB of FT:mat_peptide AB493842_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 31UC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNEHQLPVRGLARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB493847_HBSP_P-RF-CB Product feature CHAIN AB493847_HBSP_P-RF-CB of FT:mat_peptide AB493847_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 05UC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB583679_HBSP_P-RF-DE Product feature CHAIN AB583679_HBSP_P-RF-DE of FT:mat_peptide AB583679_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Pkst8134). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB642096_HBSP_P-RF-CB Product feature CHAIN AB642096_HBSP_P-RF-CB of FT:mat_peptide AB642096_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BFJT2000-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB670303_HBSP_P-RF-CB Product feature CHAIN AB670303_HBSP_P-RF-CB of FT:mat_peptide AB670303_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Non-HCC pt No.30). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AB674412_HBSP_P-RF-DE Product feature CHAIN AB674412_HBSP_P-RF-DE of FT:mat_peptide AB674412_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GaziantepHCCC6). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQRPARDHAEPARPLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674432_HBSP_P-RF-DE Product feature CHAIN AB674432_HBSP_P-RF-DE of FT:mat_peptide AB674432_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SamsunD90). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674433_HBSP_P-RF-DE Product feature CHAIN AB674433_HBSP_P-RF-DE of FT:mat_peptide AB674433_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SamsunD37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674434_HBSP_P-RF-DE Product feature CHAIN AB674434_HBSP_P-RF-DE of FT:mat_peptide AB674434_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GaziantepHCCC4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQRPAREHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674436_HBSP_P-RF-DE Product feature CHAIN AB674436_HBSP_P-RF-DE of FT:mat_peptide AB674436_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SamsunD5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLRPPARDHAEPARLLHKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674504_HBSP_P-RF-DC Product feature CHAIN AB674504_HBSP_P-RF-DC of FT:mat_peptide AB674504_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 11B18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AB933279_HBSP_P-RF-AG Product feature CHAIN AB933279_HBSP_P-RF-AG of FT:mat_peptide AB933279_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Os/JP/2008). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB933280_HBSP_P-RF-AG Product feature CHAIN AB933280_HBSP_P-RF-AG of FT:mat_peptide AB933280_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Tk/JP/2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB933281_HBSP_P-RF-AG Product feature CHAIN AB933281_HBSP_P-RF-AG of FT:mat_peptide AB933281_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Os/JP/2010). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB933282_HBSP_P-RF-AG Product feature CHAIN AB933282_HBSP_P-RF-AG of FT:mat_peptide AB933282_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Os/JP/2011). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB933283_HBSP_P-RF-AG Product feature CHAIN AB933283_HBSP_P-RF-AG of FT:mat_peptide AB933283_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Os/JP/2013). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDXTXAGPLEEELPRLADADLNRRVAZDLNLGNLNDQQQPVRDHAKPARLLLKATLCXPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF233236_HBSP_P-RF-CB Product feature CHAIN AF233236_HBSP_P-RF-CB of FT:mat_peptide AF233236_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV334). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEPQPPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|AF297619_HBSP_P-RF-DA Product feature CHAIN AF297619_HBSP_P-RF-DA of FT:mat_peptide AF297619_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate 41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF330110_HBSP_P-RF-CB Product feature CHAIN AF330110_HBSP_P-RF-CB of FT:mat_peptide AF330110_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 975484). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARXLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AF411409_HBSP_P-RF-CB Product feature CHAIN AF411409_HBSP_P-RF-CB of FT:mat_peptide AF411409_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AF461361_HBSP_P-RF-CB Product feature CHAIN AF461361_HBSP_P-RF-CB of FT:mat_peptide AF461361_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate FH3Q). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AJ627217_HBSP_P-RF-DE Product feature CHAIN AJ627217_HBSP_P-RF-DE of FT:mat_peptide AJ627217_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 20953). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AM494716_HBSP_P-RF-DE Product feature CHAIN AM494716_HBSP_P-RF-DE of FT:mat_peptide AM494716_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate CAR175). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAGDHAEPARLLLKEPLCIPLVAVQNFRM
ETAPVFPSHHPGLSETSYGCGPQPVSPGSVY
>gnl|hbvpro|AP011102_HBSP_P-RF-CB Product feature CHAIN AP011102_HBSP_P-RF-CB of FT:mat_peptide AP011102_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNEHQLPPQDLARPAQFLLKEPLCFPPVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AP011103_HBSP_P-RF-CB Product feature CHAIN AP011103_HBSP_P-RF-CB of FT:mat_peptide AP011103_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNEHQLPARDLARPAQFLHKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AP011104_HBSP_P-RF-CB Product feature CHAIN AP011104_HBSP_P-RF-CB of FT:mat_peptide AP011104_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AP011105_HBSP_P-RF-CB Product feature CHAIN AP011105_HBSP_P-RF-CB of FT:mat_peptide AP011105_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AP011108_HBSP_P-RF-CB Product feature CHAIN AP011108_HBSP_P-RF-CB of FT:mat_peptide AP011108_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPPVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AY040627_HBSP_P-RF-CB Product feature CHAIN AY040627_HBSP_P-RF-CB of FT:mat_peptide AY040627_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AY057948_HBSP_P-RF-DC Product feature CHAIN AY057948_HBSP_P-RF-DC of FT:mat_peptide AY057948_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet127). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY123041_HBSP_P-RF-CB Product feature CHAIN AY123041_HBSP_P-RF-CB of FT:mat_peptide AY123041_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AY123424_HBSP_P-RF-CB Product feature CHAIN AY123424_HBSP_P-RF-CB of FT:mat_peptide AY123424_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AY161140_HBSP_P-RF-AD Product feature CHAIN AY161140_HBSP_P-RF-AD of FT:mat_peptide AY161140_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDVETEAGSLEEELPRLADEDLNRRFAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161141_HBSP_P-RF-AD Product feature CHAIN AY161141_HBSP_P-RF-AD of FT:mat_peptide AY161141_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDVETEAGSLEEELPRLADEDLNRRFAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161145_HBSP_P-RF-AD Product feature CHAIN AY161145_HBSP_P-RF-AD of FT:mat_peptide AY161145_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AY161146_HBSP_P-RF-AD Product feature CHAIN AY161146_HBSP_P-RF-AD of FT:mat_peptide AY161146_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AY161147_HBSP_P-RF-DA Product feature CHAIN AY161147_HBSP_P-RF-DA of FT:mat_peptide AY161147_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=114 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVYL
>gnl|hbvpro|AY167095_HBSP_P-RF-CB Product feature CHAIN AY167095_HBSP_P-RF-CB of FT:mat_peptide AY167095_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IIc). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AY206374_HBSP_P-RF-CB Product feature CHAIN AY206374_HBSP_P-RF-CB of FT:mat_peptide AY206374_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQPPARGHARHARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AY233277_HBSP_P-RF-AC Product feature CHAIN AY233277_HBSP_P-RF-AC of FT:mat_peptide AY233277_HBSP_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate 1848). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233293_HBSP_P-RF-DE Product feature CHAIN AY233293_HBSP_P-RF-DE of FT:mat_peptide AY233293_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY233295_HBSP_P-RF-DE Product feature CHAIN AY233295_HBSP_P-RF-DE of FT:mat_peptide AY233295_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSHGSGPQPVSPGSVY
>gnl|hbvpro|AY236161_HBSP_P-RF-DA Product feature CHAIN AY236161_HBSP_P-RF-DA of FT:mat_peptide AY236161_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate 12A). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAKPARLLLKATLCFPPVAVQNLRM
EIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY247030_HBSP_P-RF-CB Product feature CHAIN AY247030_HBSP_P-RF-CB of FT:mat_peptide AY247030_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate KUHB81). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKDPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|AY373430_HBSP_P-RF-DE Product feature CHAIN AY373430_HBSP_P-RF-DE of FT:mat_peptide AY373430_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY800249_HBSP_P-RF-DC Product feature CHAIN AY800249_HBSP_P-RF-DC of FT:mat_peptide AY800249_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY817509_HBSP_P-RF-DC Product feature CHAIN AY817509_HBSP_P-RF-DC of FT:mat_peptide AY817509_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L28). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLDEELSRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIALVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY817510_HBSP_P-RF-DC Product feature CHAIN AY817510_HBSP_P-RF-DC of FT:mat_peptide AY817510_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKDPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY817511_HBSP_P-RF-DC Product feature CHAIN AY817511_HBSP_P-RF-DC of FT:mat_peptide AY817511_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L49). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY817512_HBSP_P-RF-DC Product feature CHAIN AY817512_HBSP_P-RF-DC of FT:mat_peptide AY817512_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY817513_HBSP_P-RF-DC Product feature CHAIN AY817513_HBSP_P-RF-DC of FT:mat_peptide AY817513_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L66). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAHVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY817515_HBSP_P-RF-DC Product feature CHAIN AY817515_HBSP_P-RF-DC of FT:mat_peptide AY817515_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L80). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY862864_HBSP_P-RF-DC Product feature CHAIN AY862864_HBSP_P-RF-DC of FT:mat_peptide AY862864_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSLGSVY
>gnl|hbvpro|AY862865_HBSP_P-RF-DC Product feature CHAIN AY862865_HBSP_P-RF-DC of FT:mat_peptide AY862865_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3-2nd). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPTAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSLGSVY
>gnl|hbvpro|AY862866_HBSP_P-RF-DC Product feature CHAIN AY862866_HBSP_P-RF-DC of FT:mat_peptide AY862866_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3-2nd). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLRNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSLGSVY
>gnl|hbvpro|DQ111987_HBSP_P-RF-DE Product feature CHAIN DQ111987_HBSP_P-RF-DE of FT:mat_peptide DQ111987_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MMU36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ315777_HBSP_P-RF-DE Product feature CHAIN DQ315777_HBSP_P-RF-DE of FT:mat_peptide DQ315777_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EI03194). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPDSVY
>gnl|hbvpro|DQ464164_HBSP_P-RF-DE Product feature CHAIN DQ464164_HBSP_P-RF-DE of FT:mat_peptide DQ464164_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVEEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ464165_HBSP_P-RF-DE Product feature CHAIN DQ464165_HBSP_P-RF-DE of FT:mat_peptide DQ464165_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ464166_HBSP_P-RF-DE Product feature CHAIN DQ464166_HBSP_P-RF-DE of FT:mat_peptide DQ464166_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ464167_HBSP_P-RF-DE Product feature CHAIN DQ464167_HBSP_P-RF-DE of FT:mat_peptide DQ464167_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLPDEDLNRRVPEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ478886_HBSP_P-RF-DC Product feature CHAIN DQ478886_HBSP_P-RF-DC of FT:mat_peptide DQ478886_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ478887_HBSP_P-RF-DC Product feature CHAIN DQ478887_HBSP_P-RF-DC of FT:mat_peptide DQ478887_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ478889_HBSP_P-RF-DC Product feature CHAIN DQ478889_HBSP_P-RF-DC of FT:mat_peptide DQ478889_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRHVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ478890_HBSP_P-RF-DC Product feature CHAIN DQ478890_HBSP_P-RF-DC of FT:mat_peptide DQ478890_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARRLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ478892_HBSP_P-RF-DC Product feature CHAIN DQ478892_HBSP_P-RF-DC of FT:mat_peptide DQ478892_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ478897_HBSP_P-RF-DC Product feature CHAIN DQ478897_HBSP_P-RF-DC of FT:mat_peptide DQ478897_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ478898_HBSP_P-RF-DC Product feature CHAIN DQ478898_HBSP_P-RF-DC of FT:mat_peptide DQ478898_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ991753_HBSP_P-RF-DE Product feature CHAIN DQ991753_HBSP_P-RF-DE of FT:mat_peptide DQ991753_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Irish-13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYHHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPLVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF103282_HBSP_P-RF-AD Product feature CHAIN EF103282_HBSP_P-RF-AD of FT:mat_peptide EF103282_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate Ran103). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPARDPAEPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF103283_HBSP_P-RF-AD Product feature CHAIN EF103283_HBSP_P-RF-AD of FT:mat_peptide EF103283_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate Ran105). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|EF103284_HBSP_P-RF-AD Product feature CHAIN EF103284_HBSP_P-RF-AD of FT:mat_peptide EF103284_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate Ran113). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLWM
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF103285_HBSP_P-RF-DE Product feature CHAIN EF103285_HBSP_P-RF-DE of FT:mat_peptide EF103285_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ran128). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF464099_HBSP_P-RF-AG Product feature CHAIN EF464099_HBSP_P-RF-AG of FT:mat_peptide EF464099_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate 05hgg). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EF494376_HBSP_P-RF-CA Product feature CHAIN EF494376_HBSP_P-RF-CA of FT:mat_peptide EF494376_HBSP_P-RF-CA of [Viruses] Hepatitis B Virus recombinant form CA (isolate TW706). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFWKLLLLDDGTEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNL
RTETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EF494378_HBSP_P-RF-CA Product feature CHAIN EF494378_HBSP_P-RF-CA of FT:mat_peptide EF494378_HBSP_P-RF-CA of [Viruses] Hepatitis B Virus recombinant form CA (isolate TW1244). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQYFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLSLGNLNEHQQQARDHARPARLLLKASLCFPLVAVQNLRM
ETAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|EU185780_HBSP_P-RF-AD Product feature CHAIN EU185780_HBSP_P-RF-AD of FT:mat_peptide EU185780_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate H-IDU7 (Rec.Arg-1)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|EU522070_HBSP_P-RF-CB Product feature CHAIN EU522070_HBSP_P-RF-CB of FT:mat_peptide EU522070_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient 7N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPVRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU589337_HBSP_P-RF-CB Product feature CHAIN EU589337_HBSP_P-RF-CB of FT:mat_peptide EU589337_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S710-2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDTGAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU589339_HBSP_P-RF-CB Product feature CHAIN EU589339_HBSP_P-RF-CB of FT:mat_peptide EU589339_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S1556-11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|EU594406_HBSP_P-RF-DE Product feature CHAIN EU594406_HBSP_P-RF-DE of FT:mat_peptide EU594406_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594435_HBSP_P-RF-DE Product feature CHAIN EU594435_HBSP_P-RF-DE of FT:mat_peptide EU594435_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594436_HBSP_P-RF-DE Product feature CHAIN EU594436_HBSP_P-RF-DE of FT:mat_peptide EU594436_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU660227_HBSP_P-RF-BC Product feature CHAIN EU660227_HBSP_P-RF-BC of FT:mat_peptide EU660227_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate HBV-14N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU717211_HBSP_P-RF-CB Product feature CHAIN EU717211_HBSP_P-RF-CB of FT:mat_peptide EU717211_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D23K-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNEHQLPARDPARPARVLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSAY
>gnl|hbvpro|EU787434_HBSP_P-RF-DC Product feature CHAIN EU787434_HBSP_P-RF-DC of FT:mat_peptide EU787434_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 92). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|EU787435_HBSP_P-RF-DC Product feature CHAIN EU787435_HBSP_P-RF-DC of FT:mat_peptide EU787435_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 114). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|EU787444_HBSP_P-RF-CB Product feature CHAIN EU787444_HBSP_P-RF-CB of FT:mat_peptide EU787444_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate W41). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLLHEGLLRRDEKDLNLGNLGEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU833889_HBSP_P-RF-GA Product feature CHAIN EU833889_HBSP_P-RF-GA of FT:mat_peptide EU833889_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate 5). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MHLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPSDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EU833890_HBSP_P-RF-GA Product feature CHAIN EU833890_HBSP_P-RF-GA of FT:mat_peptide EU833890_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate 6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPDDPRPPARDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EU833891_HBSP_P-RF-GC Product feature CHAIN EU833891_HBSP_P-RF-GC of FT:mat_peptide EU833891_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H4536/07). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|EU835240_HBSP_P-RF-GC Product feature CHAIN EU835240_HBSP_P-RF-GC of FT:mat_peptide EU835240_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate IND-DIB112). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPRPPVREHAEPARLLLKATLCIPYVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSIY
>gnl|hbvpro|EU871981_HBSP_P-RF-CB Product feature CHAIN EU871981_HBSP_P-RF-CB of FT:mat_peptide EU871981_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 318-95-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871983_HBSP_P-RF-CB Product feature CHAIN EU871983_HBSP_P-RF-CB of FT:mat_peptide EU871983_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 318-97-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871984_HBSP_P-RF-CB Product feature CHAIN EU871984_HBSP_P-RF-CB of FT:mat_peptide EU871984_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-00-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871985_HBSP_P-RF-CB Product feature CHAIN EU871985_HBSP_P-RF-CB of FT:mat_peptide EU871985_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-00-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871986_HBSP_P-RF-CB Product feature CHAIN EU871986_HBSP_P-RF-CB of FT:mat_peptide EU871986_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871987_HBSP_P-RF-CB Product feature CHAIN EU871987_HBSP_P-RF-CB of FT:mat_peptide EU871987_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-01-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871988_HBSP_P-RF-CB Product feature CHAIN EU871988_HBSP_P-RF-CB of FT:mat_peptide EU871988_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-01-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871989_HBSP_P-RF-CB Product feature CHAIN EU871989_HBSP_P-RF-CB of FT:mat_peptide EU871989_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-03-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871990_HBSP_P-RF-CB Product feature CHAIN EU871990_HBSP_P-RF-CB of FT:mat_peptide EU871990_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-04-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871991_HBSP_P-RF-CB Product feature CHAIN EU871991_HBSP_P-RF-CB of FT:mat_peptide EU871991_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-04-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871992_HBSP_P-RF-CB Product feature CHAIN EU871992_HBSP_P-RF-CB of FT:mat_peptide EU871992_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-99-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871993_HBSP_P-RF-CB Product feature CHAIN EU871993_HBSP_P-RF-CB of FT:mat_peptide EU871993_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-99-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871994_HBSP_P-RF-CB Product feature CHAIN EU871994_HBSP_P-RF-CB of FT:mat_peptide EU871994_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490A-3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871995_HBSP_P-RF-CB Product feature CHAIN EU871995_HBSP_P-RF-CB of FT:mat_peptide EU871995_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490A-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVRNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871996_HBSP_P-RF-CB Product feature CHAIN EU871996_HBSP_P-RF-CB of FT:mat_peptide EU871996_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490A-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871997_HBSP_P-RF-CB Product feature CHAIN EU871997_HBSP_P-RF-CB of FT:mat_peptide EU871997_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 530-00-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU871999_HBSP_P-RF-CB Product feature CHAIN EU871999_HBSP_P-RF-CB of FT:mat_peptide EU871999_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 530-00-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGPVY
>gnl|hbvpro|EU872014_HBSP_P-RF-CB Product feature CHAIN EU872014_HBSP_P-RF-CB of FT:mat_peptide EU872014_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-96-3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNHRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU872015_HBSP_P-RF-CB Product feature CHAIN EU872015_HBSP_P-RF-CB of FT:mat_peptide EU872015_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-96-1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU881995_HBSP_P-RF-CB Product feature CHAIN EU881995_HBSP_P-RF-CB of FT:mat_peptide EU881995_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNGRQPPARGHARPARFLLKEPLCFPLVAVQNLRT
EAALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU882006_HBSP_P-RF-CB Product feature CHAIN EU882006_HBSP_P-RF-CB of FT:mat_peptide EU882006_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHARPARLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU916228_HBSP_P-RF-CB Product feature CHAIN EU916228_HBSP_P-RF-CB of FT:mat_peptide EU916228_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S7.3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNGHQLPARDHARPARFLLKEPLCFPLVAVQNLRM
ETALVFPSHHPGLSQDSYGSWPQSVSHGSVY
>gnl|hbvpro|EU916232_HBSP_P-RF-CB Product feature CHAIN EU916232_HBSP_P-RF-CB of FT:mat_peptide EU916232_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S8.3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU916239_HBSP_P-RF-CB Product feature CHAIN EU916239_HBSP_P-RF-CB of FT:mat_peptide EU916239_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU916240_HBSP_P-RF-CB Product feature CHAIN EU916240_HBSP_P-RF-CB of FT:mat_peptide EU916240_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU916241_HBSP_P-RF-CB Product feature CHAIN EU916241_HBSP_P-RF-CB of FT:mat_peptide EU916241_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU919166_HBSP_P-RF-CB Product feature CHAIN EU919166_HBSP_P-RF-CB of FT:mat_peptide EU919166_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU919167_HBSP_P-RF-CB Product feature CHAIN EU919167_HBSP_P-RF-CB of FT:mat_peptide EU919167_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939547_HBSP_P-RF-CB Product feature CHAIN EU939547_HBSP_P-RF-CB of FT:mat_peptide EU939547_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHRLPARDHARPARLLPTEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939551_HBSP_P-RF-CB Product feature CHAIN EU939551_HBSP_P-RF-CB of FT:mat_peptide EU939551_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C56). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939581_HBSP_P-RF-CB Product feature CHAIN EU939581_HBSP_P-RF-CB of FT:mat_peptide EU939581_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate B16). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLRFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939589_HBSP_P-RF-CB Product feature CHAIN EU939589_HBSP_P-RF-CB of FT:mat_peptide EU939589_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C175). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939602_HBSP_P-RF-CB Product feature CHAIN EU939602_HBSP_P-RF-CB of FT:mat_peptide EU939602_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C179). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939606_HBSP_P-RF-CB Product feature CHAIN EU939606_HBSP_P-RF-CB of FT:mat_peptide EU939606_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C206). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939620_HBSP_P-RF-CB Product feature CHAIN EU939620_HBSP_P-RF-CB of FT:mat_peptide EU939620_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate B140). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPVRDHARPARFLLKEPLCFPLVAVQNLRT
ETAPVFPSHYPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939621_HBSP_P-RF-CB Product feature CHAIN EU939621_HBSP_P-RF-CB of FT:mat_peptide EU939621_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C94). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLSEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939623_HBSP_P-RF-CB Product feature CHAIN EU939623_HBSP_P-RF-CB of FT:mat_peptide EU939623_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C126). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939627_HBSP_P-RF-BC Product feature CHAIN EU939627_HBSP_P-RF-BC of FT:mat_peptide EU939627_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate C15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939630_HBSP_P-RF-CB Product feature CHAIN EU939630_HBSP_P-RF-CB of FT:mat_peptide EU939630_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C122). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|EU939631_HBSP_P-RF-BC Product feature CHAIN EU939631_HBSP_P-RF-BC of FT:mat_peptide EU939631_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate C123). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939668_HBSP_P-RF-CB Product feature CHAIN EU939668_HBSP_P-RF-CB of FT:mat_peptide EU939668_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C182). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQLPARDLARHARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ023659_HBSP_P-RF-BC Product feature CHAIN FJ023659_HBSP_P-RF-BC of FT:mat_peptide FJ023659_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate I1_M04-0469). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ023662_HBSP_P-RF-GC Product feature CHAIN FJ023662_HBSP_P-RF-GC of FT:mat_peptide FJ023662_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I1_M04-3718). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQQFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ023664_HBSP_P-RF-GC Product feature CHAIN FJ023664_HBSP_P-RF-GC of FT:mat_peptide FJ023664_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-0026). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ023665_HBSP_P-RF-GC Product feature CHAIN FJ023665_HBSP_P-RF-GC of FT:mat_peptide FJ023665_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-0033). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ023666_HBSP_P-RF-GC Product feature CHAIN FJ023666_HBSP_P-RF-GC of FT:mat_peptide FJ023666_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-1907). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ023667_HBSP_P-RF-GC Product feature CHAIN FJ023667_HBSP_P-RF-GC of FT:mat_peptide FJ023667_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-2742). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ023668_HBSP_P-RF-GC Product feature CHAIN FJ023668_HBSP_P-RF-GC of FT:mat_peptide FJ023668_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-3223). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ023670_HBSP_P-RF-GC Product feature CHAIN FJ023670_HBSP_P-RF-GC of FT:mat_peptide FJ023670_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-3724). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ023673_HBSP_P-RF-GC Product feature CHAIN FJ023673_HBSP_P-RF-GC of FT:mat_peptide FJ023673_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-4997). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ032337_HBSP_P-RF-CB Product feature CHAIN FJ032337_HBSP_P-RF-CB of FT:mat_peptide FJ032337_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S462-5). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ032343_HBSP_P-RF-CB Product feature CHAIN FJ032343_HBSP_P-RF-CB of FT:mat_peptide FJ032343_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S659-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ349207_HBSP_P-RF-DE Product feature CHAIN FJ349207_HBSP_P-RF-DE of FT:mat_peptide FJ349207_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate H22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349241_HBSP_P-RF-DC Product feature CHAIN FJ349241_HBSP_P-RF-DC of FT:mat_peptide FJ349241_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate C115). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAKPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|FJ361772_HBSP_P-RF-GC Product feature CHAIN FJ361772_HBSP_P-RF-GC of FT:mat_peptide FJ361772_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386578_HBSP_P-RF-CB Product feature CHAIN FJ386578_HBSP_P-RF-CB of FT:mat_peptide FJ386578_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1748). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPDSVY
>gnl|hbvpro|FJ386581_HBSP_P-RF-CB Product feature CHAIN FJ386581_HBSP_P-RF-CB of FT:mat_peptide FJ386581_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1764). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ386585_HBSP_P-RF-CB Product feature CHAIN FJ386585_HBSP_P-RF-CB of FT:mat_peptide FJ386585_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1800). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ386586_HBSP_P-RF-CB Product feature CHAIN FJ386586_HBSP_P-RF-CB of FT:mat_peptide FJ386586_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1811). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARAHARPAQYLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ386593_HBSP_P-RF-CB Product feature CHAIN FJ386593_HBSP_P-RF-CB of FT:mat_peptide FJ386593_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1877). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ386633_HBSP_P-RF-CB Product feature CHAIN FJ386633_HBSP_P-RF-CB of FT:mat_peptide FJ386633_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2372). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ386635_HBSP_P-RF-CB Product feature CHAIN FJ386635_HBSP_P-RF-CB of FT:mat_peptide FJ386635_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2399). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ386643_HBSP_P-RF-CB Product feature CHAIN FJ386643_HBSP_P-RF-CB of FT:mat_peptide FJ386643_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2493). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEPQLPARDLARPAQFLLKEPLYFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ386646_HBSP_P-RF-CB Product feature CHAIN FJ386646_HBSP_P-RF-CB of FT:mat_peptide FJ386646_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1716). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ386649_HBSP_P-RF-CB Product feature CHAIN FJ386649_HBSP_P-RF-CB of FT:mat_peptide FJ386649_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2422). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGIGPQSVSHGSVY
>gnl|hbvpro|FJ386674_HBSP_P-RF-BC Product feature CHAIN FJ386674_HBSP_P-RF-BC of FT:mat_peptide FJ386674_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate S659). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPARDHARPARLLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|FJ562223_HBSP_P-RF-CD Product feature CHAIN FJ562223_HBSP_P-RF-CD of FT:mat_peptide FJ562223_HBSP_P-RF-CD of [Viruses] Hepatitis B Virus recombinant form CD (isolate I15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYHHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLPARDHARPARILPTEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVS
>gnl|hbvpro|FJ562226_HBSP_P-RF-CB Product feature CHAIN FJ562226_HBSP_P-RF-CB of FT:mat_peptide FJ562226_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|FJ562227_HBSP_P-RF-CB Product feature CHAIN FJ562227_HBSP_P-RF-CB of FT:mat_peptide FJ562227_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562229_HBSP_P-RF-CB Product feature CHAIN FJ562229_HBSP_P-RF-CB of FT:mat_peptide FJ562229_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I36). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562247_HBSP_P-RF-CB Product feature CHAIN FJ562247_HBSP_P-RF-CB of FT:mat_peptide FJ562247_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I75). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562263_HBSP_P-RF-DC Product feature CHAIN FJ562263_HBSP_P-RF-DC of FT:mat_peptide FJ562263_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDNAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|FJ562267_HBSP_P-RF-CB Product feature CHAIN FJ562267_HBSP_P-RF-CB of FT:mat_peptide FJ562267_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I120). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562271_HBSP_P-RF-CB Product feature CHAIN FJ562271_HBSP_P-RF-CB of FT:mat_peptide FJ562271_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I124). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCIPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562277_HBSP_P-RF-CB Product feature CHAIN FJ562277_HBSP_P-RF-CB of FT:mat_peptide FJ562277_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I134). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562278_HBSP_P-RF-DC Product feature CHAIN FJ562278_HBSP_P-RF-DC of FT:mat_peptide FJ562278_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|FJ562287_HBSP_P-RF-CB Product feature CHAIN FJ562287_HBSP_P-RF-CB of FT:mat_peptide FJ562287_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I151). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHRPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562294_HBSP_P-RF-CB Product feature CHAIN FJ562294_HBSP_P-RF-CB of FT:mat_peptide FJ562294_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I168). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|FJ562302_HBSP_P-RF-CB Product feature CHAIN FJ562302_HBSP_P-RF-CB of FT:mat_peptide FJ562302_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I186). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPVRDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVH
>gnl|hbvpro|FJ562305_HBSP_P-RF-CB Product feature CHAIN FJ562305_HBSP_P-RF-CB of FT:mat_peptide FJ562305_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I191). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562314_HBSP_P-RF-CB Product feature CHAIN FJ562314_HBSP_P-RF-CB of FT:mat_peptide FJ562314_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I206). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562317_HBSP_P-RF-CB Product feature CHAIN FJ562317_HBSP_P-RF-CB of FT:mat_peptide FJ562317_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I209). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQQPARDHARPARLLLKTPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ562336_HBSP_P-RF-CB Product feature CHAIN FJ562336_HBSP_P-RF-CB of FT:mat_peptide FJ562336_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I115). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ692536_HBSP_P-RF-DE Product feature CHAIN FJ692536_HBSP_P-RF-DE of FT:mat_peptide FJ692536_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D4_50077). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLRNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHRPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|FJ715345_HBSP_P-RF-CB Product feature CHAIN FJ715345_HBSP_P-RF-CB of FT:mat_peptide FJ715345_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVC21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715346_HBSP_P-RF-CB Product feature CHAIN FJ715346_HBSP_P-RF-CB of FT:mat_peptide FJ715346_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVC22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715347_HBSP_P-RF-CB Product feature CHAIN FJ715347_HBSP_P-RF-CB of FT:mat_peptide FJ715347_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVC23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715384_HBSP_P-RF-CB Product feature CHAIN FJ715384_HBSP_P-RF-CB of FT:mat_peptide FJ715384_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVM51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715385_HBSP_P-RF-CB Product feature CHAIN FJ715385_HBSP_P-RF-CB of FT:mat_peptide FJ715385_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVM52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715387_HBSP_P-RF-CB Product feature CHAIN FJ715387_HBSP_P-RF-CB of FT:mat_peptide FJ715387_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVM54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715411_HBSP_P-RF-CB Product feature CHAIN FJ715411_HBSP_P-RF-CB of FT:mat_peptide FJ715411_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVN51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715412_HBSP_P-RF-CB Product feature CHAIN FJ715412_HBSP_P-RF-CB of FT:mat_peptide FJ715412_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVN52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715413_HBSP_P-RF-CB Product feature CHAIN FJ715413_HBSP_P-RF-CB of FT:mat_peptide FJ715413_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVN53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ715414_HBSP_P-RF-CB Product feature CHAIN FJ715414_HBSP_P-RF-CB of FT:mat_peptide FJ715414_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVN54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ787446_HBSP_P-RF-CB Product feature CHAIN FJ787446_HBSP_P-RF-CB of FT:mat_peptide FJ787446_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S425-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGIGPQSVSHGSVY
>gnl|hbvpro|FJ787480_HBSP_P-RF-CB Product feature CHAIN FJ787480_HBSP_P-RF-CB of FT:mat_peptide FJ787480_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S425-16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGIGPQSVSHGSVY
>gnl|hbvpro|FJ882610_HBSP_P-RF-GC Product feature CHAIN FJ882610_HBSP_P-RF-GC of FT:mat_peptide FJ882610_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H2252/01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ882611_HBSP_P-RF-GC Product feature CHAIN FJ882611_HBSP_P-RF-GC of FT:mat_peptide FJ882611_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H2072/03). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ882612_HBSP_P-RF-GC Product feature CHAIN FJ882612_HBSP_P-RF-GC of FT:mat_peptide FJ882612_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1886/07). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ882613_HBSP_P-RF-GC Product feature CHAIN FJ882613_HBSP_P-RF-GC of FT:mat_peptide FJ882613_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1357/05). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ882614_HBSP_P-RF-GC Product feature CHAIN FJ882614_HBSP_P-RF-GC of FT:mat_peptide FJ882614_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1099/02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ882617_HBSP_P-RF-GC Product feature CHAIN FJ882617_HBSP_P-RF-GC of FT:mat_peptide FJ882617_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H0645/08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ882618_HBSP_P-RF-GC Product feature CHAIN FJ882618_HBSP_P-RF-GC of FT:mat_peptide FJ882618_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H0035/08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904394_HBSP_P-RF-DE Product feature CHAIN FJ904394_HBSP_P-RF-DE of FT:mat_peptide FJ904394_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRXLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904396_HBSP_P-RF-DE Product feature CHAIN FJ904396_HBSP_P-RF-DE of FT:mat_peptide FJ904396_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904397_HBSP_P-RF-DE Product feature CHAIN FJ904397_HBSP_P-RF-DE of FT:mat_peptide FJ904397_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A13). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
EXAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904398_HBSP_P-RF-DE Product feature CHAIN FJ904398_HBSP_P-RF-DE of FT:mat_peptide FJ904398_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGXNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904400_HBSP_P-RF-DE Product feature CHAIN FJ904400_HBSP_P-RF-DE of FT:mat_peptide FJ904400_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQSFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|FJ904403_HBSP_P-RF-DE Product feature CHAIN FJ904403_HBSP_P-RF-DE of FT:mat_peptide FJ904403_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCFPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904404_HBSP_P-RF-DE Product feature CHAIN FJ904404_HBSP_P-RF-DE of FT:mat_peptide FJ904404_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904405_HBSP_P-RF-DE Product feature CHAIN FJ904405_HBSP_P-RF-DE of FT:mat_peptide FJ904405_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGVNRRVAEELNLGNLNDLQPPARDHAEPARHLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904406_HBSP_P-RF-DE Product feature CHAIN FJ904406_HBSP_P-RF-DE of FT:mat_peptide FJ904406_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904407_HBSP_P-RF-DE Product feature CHAIN FJ904407_HBSP_P-RF-DE of FT:mat_peptide FJ904407_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904408_HBSP_P-RF-DE Product feature CHAIN FJ904408_HBSP_P-RF-DE of FT:mat_peptide FJ904408_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904409_HBSP_P-RF-DE Product feature CHAIN FJ904409_HBSP_P-RF-DE of FT:mat_peptide FJ904409_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A54a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904414_HBSP_P-RF-DE Product feature CHAIN FJ904414_HBSP_P-RF-DE of FT:mat_peptide FJ904414_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A62). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLFLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904416_HBSP_P-RF-DE Product feature CHAIN FJ904416_HBSP_P-RF-DE of FT:mat_peptide FJ904416_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A66a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGXNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904417_HBSP_P-RF-DE Product feature CHAIN FJ904417_HBSP_P-RF-DE of FT:mat_peptide FJ904417_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A66b). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGXNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904425_HBSP_P-RF-DE Product feature CHAIN FJ904425_HBSP_P-RF-DE of FT:mat_peptide FJ904425_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904428_HBSP_P-RF-DE Product feature CHAIN FJ904428_HBSP_P-RF-DE of FT:mat_peptide FJ904428_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904430_HBSP_P-RF-DE Product feature CHAIN FJ904430_HBSP_P-RF-DE of FT:mat_peptide FJ904430_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAGLARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904436_HBSP_P-RF-DE Product feature CHAIN FJ904436_HBSP_P-RF-DE of FT:mat_peptide FJ904436_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARHLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904437_HBSP_P-RF-DE Product feature CHAIN FJ904437_HBSP_P-RF-DE of FT:mat_peptide FJ904437_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B30a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQQFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904440_HBSP_P-RF-DE Product feature CHAIN FJ904440_HBSP_P-RF-DE of FT:mat_peptide FJ904440_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904441_HBSP_P-RF-DE Product feature CHAIN FJ904441_HBSP_P-RF-DE of FT:mat_peptide FJ904441_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B42a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCFPPVAVQNLRM
ETAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904442_HBSP_P-RF-DE Product feature CHAIN FJ904442_HBSP_P-RF-DE of FT:mat_peptide FJ904442_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLKEELPRLADKGLNLRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904444_HBSP_P-RF-DE Product feature CHAIN FJ904444_HBSP_P-RF-DE of FT:mat_peptide FJ904444_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B61). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904447_HBSP_P-RF-DE Product feature CHAIN FJ904447_HBSP_P-RF-DE of FT:mat_peptide FJ904447_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FN594767_HBSP_P-RF-DE Product feature CHAIN FN594767_HBSP_P-RF-DE of FT:mat_peptide FN594767_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne127). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDRQLPARDPAEPARLLLKEPLCFPHVAVQNLRT
EIALVFPSHHHGLSENSYGSGPQPVSXXSVY
>gnl|hbvpro|FN594769_HBSP_P-RF-DE Product feature CHAIN FN594769_HBSP_P-RF-DE of FT:mat_peptide FN594769_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne281). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRM
ETAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FN594771_HBSP_P-RF-DE Product feature CHAIN FN594771_HBSP_P-RF-DE of FT:mat_peptide FN594771_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne442). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNSLQPPARDHAEPARLLLKEPLCIPPVAVQNLWM
ETAPVFPSHHHGLSENSYGSGPQPVSPGSVH
>gnl|hbvpro|FR714490_HBSP_P-RF-GB Product feature CHAIN FR714490_HBSP_P-RF-GB of FT:mat_peptide FR714490_HBSP_P-RF-GB of [Viruses] Hepatitis B Virus recombinant form GB (isolate DL706). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|FR714496_HBSP_P-RF-CB Product feature CHAIN FR714496_HBSP_P-RF-CB of FT:mat_peptide FR714496_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate QL523). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNEHQLPARDHARPARFLLKATLCFPLVAVQNLRT
EIAPVFPSHHLGLSQDSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ161754_HBSP_P-RF-DE Product feature CHAIN GQ161754_HBSP_P-RF-DE of FT:mat_peptide GQ161754_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GH16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ161767_HBSP_P-RF-AE Product feature CHAIN GQ161767_HBSP_P-RF-AE of FT:mat_peptide GQ161767_HBSP_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1616). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAEPARLLLKATLCFPHVVVQNLRT
EIAPVFPSHHHGLSQNTYGGGPQSVSPGSVY
>gnl|hbvpro|GQ161788_HBSP_P-RF-AE Product feature CHAIN GQ161788_HBSP_P-RF-AE of FT:mat_peptide GQ161788_HBSP_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1607). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRT
EIAPVFPSHHHGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ161806_HBSP_P-RF-EA Product feature CHAIN GQ161806_HBSP_P-RF-EA of FT:mat_peptide GQ161806_HBSP_P-RF-EA of [Viruses] Hepatitis B Virus recombinant form EA (isolate GU763). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRXLLLLDXEAGPLEEELPRLADEDLNRRVAEDLNLQLPDDHQPPVRDPAEPARLLLKEPLCFPHVVVQNLRT
EIALVFPSHHHGLSENSYGSGPQXVSPGSVY
>gnl|hbvpro|GQ161837_HBSP_P-RF-AE Product feature CHAIN GQ161837_HBSP_P-RF-AE of FT:mat_peptide GQ161837_HBSP_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1125). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRT
ETAPVFPSHHHGLSXNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ161838_HBSP_P-RF-AE Product feature CHAIN GQ161838_HBSP_P-RF-AE of FT:mat_peptide GQ161838_HBSP_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1127). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRT
ETAPVFPSHHHGLSXNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ183486_HBSP_P-RF-DE Product feature CHAIN GQ183486_HBSP_P-RF-DE of FT:mat_peptide GQ183486_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MOD_4568). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ331048_HBSP_P-RF-AE Product feature CHAIN GQ331048_HBSP_P-RF-AE of FT:mat_peptide GQ331048_HBSP_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate BV-201). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNPNEPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGNGPQSVSHGSVH
>gnl|hbvpro|GQ358155_HBSP_P-RF-CB Product feature CHAIN GQ358155_HBSP_P-RF-CB of FT:mat_peptide GQ358155_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J022). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ358156_HBSP_P-RF-CB Product feature CHAIN GQ358156_HBSP_P-RF-CB of FT:mat_peptide GQ358156_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate STN013). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377516_HBSP_P-RF-CB Product feature CHAIN GQ377516_HBSP_P-RF-CB of FT:mat_peptide GQ377516_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377520_HBSP_P-RF-CB Product feature CHAIN GQ377520_HBSP_P-RF-CB of FT:mat_peptide GQ377520_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J18). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377522_HBSP_P-RF-CB Product feature CHAIN GQ377522_HBSP_P-RF-CB of FT:mat_peptide GQ377522_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J20). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377534_HBSP_P-RF-CB Product feature CHAIN GQ377534_HBSP_P-RF-CB of FT:mat_peptide GQ377534_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377539_HBSP_P-RF-CB Product feature CHAIN GQ377539_HBSP_P-RF-CB of FT:mat_peptide GQ377539_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J53). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPRSVH
>gnl|hbvpro|GQ377544_HBSP_P-RF-CB Product feature CHAIN GQ377544_HBSP_P-RF-CB of FT:mat_peptide GQ377544_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J69). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377548_HBSP_P-RF-CB Product feature CHAIN GQ377548_HBSP_P-RF-CB of FT:mat_peptide GQ377548_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J79). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPVQDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377549_HBSP_P-RF-CB Product feature CHAIN GQ377549_HBSP_P-RF-CB of FT:mat_peptide GQ377549_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J80). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377556_HBSP_P-RF-CB Product feature CHAIN GQ377556_HBSP_P-RF-CB of FT:mat_peptide GQ377556_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J87). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377560_HBSP_P-RF-CB Product feature CHAIN GQ377560_HBSP_P-RF-CB of FT:mat_peptide GQ377560_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J93). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARGHARHARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377564_HBSP_P-RF-CB Product feature CHAIN GQ377564_HBSP_P-RF-CB of FT:mat_peptide GQ377564_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J99). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377565_HBSP_P-RF-CB Product feature CHAIN GQ377565_HBSP_P-RF-CB of FT:mat_peptide GQ377565_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J100). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377581_HBSP_P-RF-CB Product feature CHAIN GQ377581_HBSP_P-RF-CB of FT:mat_peptide GQ377581_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J129). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377590_HBSP_P-RF-CB Product feature CHAIN GQ377590_HBSP_P-RF-CB of FT:mat_peptide GQ377590_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J147). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377592_HBSP_P-RF-CB Product feature CHAIN GQ377592_HBSP_P-RF-CB of FT:mat_peptide GQ377592_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J149). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPPPDHAKPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377594_HBSP_P-RF-CB Product feature CHAIN GQ377594_HBSP_P-RF-CB of FT:mat_peptide GQ377594_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J152). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377595_HBSP_P-RF-BC Product feature CHAIN GQ377595_HBSP_P-RF-BC of FT:mat_peptide GQ377595_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J155). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPQAPGHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377596_HBSP_P-RF-CB Product feature CHAIN GQ377596_HBSP_P-RF-CB of FT:mat_peptide GQ377596_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J156). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377602_HBSP_P-RF-CB Product feature CHAIN GQ377602_HBSP_P-RF-CB of FT:mat_peptide GQ377602_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J165). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377604_HBSP_P-RF-CB Product feature CHAIN GQ377604_HBSP_P-RF-CB of FT:mat_peptide GQ377604_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J168). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGTLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377607_HBSP_P-RF-CB Product feature CHAIN GQ377607_HBSP_P-RF-CB of FT:mat_peptide GQ377607_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J172). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPPRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377611_HBSP_P-RF-CB Product feature CHAIN GQ377611_HBSP_P-RF-CB of FT:mat_peptide GQ377611_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J179). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377613_HBSP_P-RF-CB Product feature CHAIN GQ377613_HBSP_P-RF-CB of FT:mat_peptide GQ377613_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J181). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377614_HBSP_P-RF-CB Product feature CHAIN GQ377614_HBSP_P-RF-CB of FT:mat_peptide GQ377614_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J185). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377626_HBSP_P-RF-CB Product feature CHAIN GQ377626_HBSP_P-RF-CB of FT:mat_peptide GQ377626_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J225). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377627_HBSP_P-RF-CD Product feature CHAIN GQ377627_HBSP_P-RF-CD of FT:mat_peptide GQ377627_HBSP_P-RF-CD of [Viruses] Hepatitis B Virus recombinant form CD (isolate J231). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPPRDHAKPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ377630_HBSP_P-RF-BC Product feature CHAIN GQ377630_HBSP_P-RF-BC of FT:mat_peptide GQ377630_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J236). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377633_HBSP_P-RF-CB Product feature CHAIN GQ377633_HBSP_P-RF-CB of FT:mat_peptide GQ377633_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J241). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377634_HBSP_P-RF-CB Product feature CHAIN GQ377634_HBSP_P-RF-CB of FT:mat_peptide GQ377634_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J242). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GQ377635_HBSP_P-RF-BC Product feature CHAIN GQ377635_HBSP_P-RF-BC of FT:mat_peptide GQ377635_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J245). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ475335_HBSP_P-RF-CB Product feature CHAIN GQ475335_HBSP_P-RF-CB of FT:mat_peptide GQ475335_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate KOR31LC). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|GQ924618_HBSP_P-RF-CB Product feature CHAIN GQ924618_HBSP_P-RF-CB of FT:mat_peptide GQ924618_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate M35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GU177079_HBSP_P-RF-DE Product feature CHAIN GU177079_HBSP_P-RF-DE of FT:mat_peptide GU177079_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate DN171). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPLVAVQNL
RMETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU357843_HBSP_P-RF-CB Product feature CHAIN GU357843_HBSP_P-RF-CB of FT:mat_peptide GU357843_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Y580). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPAREHAGPARFLLKEPLCFPLVAVQNLRP
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|GU385774_HBSP_P-RF-CB Product feature CHAIN GU385774_HBSP_P-RF-CB of FT:mat_peptide GU385774_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C2-Shanghai). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQESYGSGPQSVSPGSVY
>gnl|hbvpro|GU563560_HBSP_P-RF-DE Product feature CHAIN GU563560_HBSP_P-RF-DE of FT:mat_peptide GU563560_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BV-146). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVH
>gnl|hbvpro|HE981180_HBSP_P-RF-GF Product feature CHAIN HE981180_HBSP_P-RF-GF of FT:mat_peptide HE981180_HBSP_P-RF-GF of [Viruses] Hepatitis B Virus recombinant form GF. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|HF571060_HBSP_P-RF-AE Product feature CHAIN HF571060_HBSP_P-RF-AE of FT:mat_peptide HF571060_HBSP_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate 56325). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRT
EIAPVFPSHHHGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|HM146131_HBSP_P-RF-AD Product feature CHAIN HM146131_HBSP_P-RF-AD of FT:mat_peptide HM146131_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate TCGA5889). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAEVGPLEGELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM750133_HBSP_P-RF-CB Product feature CHAIN HM750133_HBSP_P-RF-CB of FT:mat_peptide HM750133_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate GSD-54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARDPARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|HM750142_HBSP_P-RF-DC Product feature CHAIN HM750142_HBSP_P-RF-DC of FT:mat_peptide HM750142_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QHN-52). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HM750143_HBSP_P-RF-DC Product feature CHAIN HM750143_HBSP_P-RF-DC of FT:mat_peptide HM750143_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate tibet-116). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HM750145_HBSP_P-RF-DC Product feature CHAIN HM750145_HBSP_P-RF-DC of FT:mat_peptide HM750145_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HM750146_HBSP_P-RF-DC Product feature CHAIN HM750146_HBSP_P-RF-DC of FT:mat_peptide HM750146_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HM750147_HBSP_P-RF-DC Product feature CHAIN HM750147_HBSP_P-RF-DC of FT:mat_peptide HM750147_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HM750148_HBSP_P-RF-DC Product feature CHAIN HM750148_HBSP_P-RF-DC of FT:mat_peptide HM750148_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HM750149_HBSP_P-RF-DC Product feature CHAIN HM750149_HBSP_P-RF-DC of FT:mat_peptide HM750149_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-60). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HM750150_HBSP_P-RF-DC Product feature CHAIN HM750150_HBSP_P-RF-DC of FT:mat_peptide HM750150_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-70). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ684848_HBSP_P-RF-CB Product feature CHAIN HQ684848_HBSP_P-RF-CB of FT:mat_peptide HQ684848_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVJSTZ1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HQ684849_HBSP_P-RF-BC Product feature CHAIN HQ684849_HBSP_P-RF-BC of FT:mat_peptide HQ684849_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate HBVJSTZ2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPAPDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700492_HBSP_P-RF-DE Product feature CHAIN HQ700492_HBSP_P-RF-DE of FT:mat_peptide HQ700492_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F006PF_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEELNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700493_HBSP_P-RF-DE Product feature CHAIN HQ700493_HBSP_P-RF-DE of FT:mat_peptide HQ700493_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F049PF_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRK
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700494_HBSP_P-RF-DE Product feature CHAIN HQ700494_HBSP_P-RF-DE of FT:mat_peptide HQ700494_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F062PM_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGILNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700497_HBSP_P-RF-DE Product feature CHAIN HQ700497_HBSP_P-RF-DE of FT:mat_peptide HQ700497_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F109C_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700500_HBSP_P-RF-DE Product feature CHAIN HQ700500_HBSP_P-RF-DE of FT:mat_peptide HQ700500_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Samoa_En_1993). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700501_HBSP_P-RF-DE Product feature CHAIN HQ700501_HBSP_P-RF-DE of FT:mat_peptide HQ700501_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Samoa_Fa_1991). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700503_HBSP_P-RF-DE Product feature CHAIN HQ700503_HBSP_P-RF-DE of FT:mat_peptide HQ700503_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_Ng_1992). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLEEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700519_HBSP_P-RF-CB Product feature CHAIN HQ700519_HBSP_P-RF-CB of FT:mat_peptide HQ700519_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_G028A_2003). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNERQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSLGSVY
>gnl|hbvpro|HQ700520_HBSP_P-RF-CB Product feature CHAIN HQ700520_HBSP_P-RF-CB of FT:mat_peptide HQ700520_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_GM009A_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAADLNLGNPNEHQLPARDHARPARFLLKAPLCFPLVVVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700523_HBSP_P-RF-CB Product feature CHAIN HQ700523_HBSP_P-RF-CB of FT:mat_peptide HQ700523_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_P032C_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700524_HBSP_P-RF-DE Product feature CHAIN HQ700524_HBSP_P-RF-DE of FT:mat_peptide HQ700524_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_PNG_P043PF_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700525_HBSP_P-RF-DE Product feature CHAIN HQ700525_HBSP_P-RF-DE of FT:mat_peptide HQ700525_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_PNG_P054PF_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700526_HBSP_P-RF-CB Product feature CHAIN HQ700526_HBSP_P-RF-CB of FT:mat_peptide HQ700526_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_143PF_2005). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEPQLPARDHARPARFLLKEPLCFPHVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700527_HBSP_P-RF-CB Product feature CHAIN HQ700527_HBSP_P-RF-CB of FT:mat_peptide HQ700527_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_W035A_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLPARDHARPARLLLKEPLCFPPVAVQNLRT
ETALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700528_HBSP_P-RF-CB Product feature CHAIN HQ700528_HBSP_P-RF-CB of FT:mat_peptide HQ700528_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_W034A_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLPAQDHARPARLLLKEPLCFPPVAVQNLRT
ETALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700530_HBSP_P-RF-CB Product feature CHAIN HQ700530_HBSP_P-RF-CB of FT:mat_peptide HQ700530_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T127_1994). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLQARDHARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700531_HBSP_P-RF-CB Product feature CHAIN HQ700531_HBSP_P-RF-CB of FT:mat_peptide HQ700531_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T107_1994). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700532_HBSP_P-RF-CB Product feature CHAIN HQ700532_HBSP_P-RF-CB of FT:mat_peptide HQ700532_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T114_1994). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700534_HBSP_P-RF-DE Product feature CHAIN HQ700534_HBSP_P-RF-DE of FT:mat_peptide HQ700534_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI018_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDESGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700535_HBSP_P-RF-DE Product feature CHAIN HQ700535_HBSP_P-RF-DE of FT:mat_peptide HQ700535_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI152P_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700536_HBSP_P-RF-DE Product feature CHAIN HQ700536_HBSP_P-RF-DE of FT:mat_peptide HQ700536_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_K148A_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLAXEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLEEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700537_HBSP_P-RF-DE Product feature CHAIN HQ700537_HBSP_P-RF-DE of FT:mat_peptide HQ700537_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI191P_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700538_HBSP_P-RF-DE Product feature CHAIN HQ700538_HBSP_P-RF-DE of FT:mat_peptide HQ700538_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI215p_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700539_HBSP_P-RF-DE Product feature CHAIN HQ700539_HBSP_P-RF-DE of FT:mat_peptide HQ700539_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI346PF_2004). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700540_HBSP_P-RF-DE Product feature CHAIN HQ700540_HBSP_P-RF-DE of FT:mat_peptide HQ700540_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI346C_2004). Complete genome. [Hepadnaviridae] (length=112 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVYW
>gnl|hbvpro|HQ700541_HBSP_P-RF-DE Product feature CHAIN HQ700541_HBSP_P-RF-DE of FT:mat_peptide HQ700541_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI387C_2005). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAGPARLLLKEPLCIPPVVVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700547_HBSP_P-RF-CB Product feature CHAIN HQ700547_HBSP_P-RF-CB of FT:mat_peptide HQ700547_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I_WA1034A). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ700579_HBSP_P-RF-DE Product feature CHAIN HQ700579_HBSP_P-RF-DE of FT:mat_peptide HQ700579_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C_Tonga_To29_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHRPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700581_HBSP_P-RF-DE Product feature CHAIN HQ700581_HBSP_P-RF-DE of FT:mat_peptide HQ700581_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BB6995_2000). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700582_HBSP_P-RF-DE Product feature CHAIN HQ700582_HBSP_P-RF-DE of FT:mat_peptide HQ700582_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BH0071_2002). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700583_HBSP_P-RF-DE Product feature CHAIN HQ700583_HBSP_P-RF-DE of FT:mat_peptide HQ700583_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BQ3450_2001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700584_HBSP_P-RF-DE Product feature CHAIN HQ700584_HBSP_P-RF-DE of FT:mat_peptide HQ700584_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_JF5498_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700585_HBSP_P-RF-DE Product feature CHAIN HQ700585_HBSP_P-RF-DE of FT:mat_peptide HQ700585_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_To29_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHRPPARDPAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|J02202_HBSP_P-RF-DE Product feature CHAIN J02202_HBSP_P-RF-DE of FT:mat_peptide J02202_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKESLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JF436922_HBSP_P-RF-CB Product feature CHAIN JF436922_HBSP_P-RF-CB of FT:mat_peptide JF436922_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SZ16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKAPLCFPLVAVQNLRT
ETALVFPSHHPGPSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JF436923_HBSP_P-RF-CB Product feature CHAIN JF436923_HBSP_P-RF-CB of FT:mat_peptide JF436923_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SZ19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVVEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRM
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439776_HBSP_P-RF-AG Product feature CHAIN JF439776_HBSP_P-RF-AG of FT:mat_peptide JF439776_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate MAU05C10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF440019_HBSP_P-RF-AG Product feature CHAIN JF440019_HBSP_P-RF-AG of FT:mat_peptide JF440019_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate MAU05C2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF440021_HBSP_P-RF-AG Product feature CHAIN JF440021_HBSP_P-RF-AG of FT:mat_peptide JF440021_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate MAU05C6). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPRPPVRDPAKPARLLLKATLCITHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF440022_HBSP_P-RF-AG Product feature CHAIN JF440022_HBSP_P-RF-AG of FT:mat_peptide JF440022_HBSP_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate MAU05C11). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF491448_HBSP_P-RF-DC Product feature CHAIN JF491448_HBSP_P-RF-DC of FT:mat_peptide JF491448_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLTEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JF491449_HBSP_P-RF-DC Product feature CHAIN JF491449_HBSP_P-RF-DC of FT:mat_peptide JF491449_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JF491451_HBSP_P-RF-DC Product feature CHAIN JF491451_HBSP_P-RF-DC of FT:mat_peptide JF491451_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JF491455_HBSP_P-RF-DC Product feature CHAIN JF491455_HBSP_P-RF-DC of FT:mat_peptide JF491455_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-31). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JF754613_HBSP_P-RF-DE Product feature CHAIN JF754613_HBSP_P-RF-DE of FT:mat_peptide JF754613_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TK145). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQRPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754616_HBSP_P-RF-DE Product feature CHAIN JF754616_HBSP_P-RF-DE of FT:mat_peptide JF754616_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TK138). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF828933_HBSP_P-RF-CB Product feature CHAIN JF828933_HBSP_P-RF-CB of FT:mat_peptide JF828933_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|JF828934_HBSP_P-RF-CB Product feature CHAIN JF828934_HBSP_P-RF-CB of FT:mat_peptide JF828934_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|JF828935_HBSP_P-RF-CB Product feature CHAIN JF828935_HBSP_P-RF-CB of FT:mat_peptide JF828935_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVC
>gnl|hbvpro|JF828936_HBSP_P-RF-CB Product feature CHAIN JF828936_HBSP_P-RF-CB of FT:mat_peptide JF828936_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|JF828938_HBSP_P-RF-CB Product feature CHAIN JF828938_HBSP_P-RF-CB of FT:mat_peptide JF828938_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|JN040803_HBSP_P-RF-DE Product feature CHAIN JN040803_HBSP_P-RF-DE of FT:mat_peptide JN040803_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 919031). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQRPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257154_HBSP_P-RF-DE Product feature CHAIN JN257154_HBSP_P-RF-DE of FT:mat_peptide JN257154_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHDKR). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQLPARDHAEPARLLLKETLRFPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257164_HBSP_P-RF-DE Product feature CHAIN JN257164_HBSP_P-RF-DE of FT:mat_peptide JN257164_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHQNT). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257174_HBSP_P-RF-DE Product feature CHAIN JN257174_HBSP_P-RF-DE of FT:mat_peptide JN257174_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHOTH1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257189_HBSP_P-RF-DE Product feature CHAIN JN257189_HBSP_P-RF-DE of FT:mat_peptide JN257189_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHMHD). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQXPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257191_HBSP_P-RF-DE Product feature CHAIN JN257191_HBSP_P-RF-DE of FT:mat_peptide JN257191_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHWHD1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQXPARXXAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257204_HBSP_P-RF-DE Product feature CHAIN JN257204_HBSP_P-RF-DE of FT:mat_peptide JN257204_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHYMN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQPPARDHAEPARPLLKEPLCIPPVAVPNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257206_HBSP_P-RF-DE Product feature CHAIN JN257206_HBSP_P-RF-DE of FT:mat_peptide JN257206_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHAKF1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLXENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257207_HBSP_P-RF-DE Product feature CHAIN JN257207_HBSP_P-RF-DE of FT:mat_peptide JN257207_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHAKF2). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLXENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257210_HBSP_P-RF-DE Product feature CHAIN JN257210_HBSP_P-RF-DE of FT:mat_peptide JN257210_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHYSR). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257216_HBSP_P-RF-DE Product feature CHAIN JN257216_HBSP_P-RF-DE of FT:mat_peptide JN257216_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHMQR1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARAHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSXY
>gnl|hbvpro|JN400086_HBSP_P-RF-CB Product feature CHAIN JN400086_HBSP_P-RF-CB of FT:mat_peptide JN400086_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-75-Baby). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JN642127_HBSP_P-RF-DE Product feature CHAIN JN642127_HBSP_P-RF-DE of FT:mat_peptide JN642127_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642137_HBSP_P-RF-DE Product feature CHAIN JN642137_HBSP_P-RF-DE of FT:mat_peptide JN642137_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNPNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642139_HBSP_P-RF-DE Product feature CHAIN JN642139_HBSP_P-RF-DE of FT:mat_peptide JN642139_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDPAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642141_HBSP_P-RF-DE Product feature CHAIN JN642141_HBSP_P-RF-DE of FT:mat_peptide JN642141_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb31). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642152_HBSP_P-RF-DE Product feature CHAIN JN642152_HBSP_P-RF-DE of FT:mat_peptide JN642152_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642160_HBSP_P-RF-DE Product feature CHAIN JN642160_HBSP_P-RF-DE of FT:mat_peptide JN642160_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664929_HBSP_P-RF-DE Product feature CHAIN JN664929_HBSP_P-RF-DE of FT:mat_peptide JN664929_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HE33_CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664943_HBSP_P-RF-DE Product feature CHAIN JN664943_HBSP_P-RF-DE of FT:mat_peptide JN664943_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EN76_LC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664946_HBSP_P-RF-DA Product feature CHAIN JN664946_HBSP_P-RF-DA of FT:mat_peptide JN664946_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate THB17_LC). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVEGEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNL
RTEIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688689_HBSP_P-RF-DE Product feature CHAIN JN688689_HBSP_P-RF-DE of FT:mat_peptide JN688689_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV115). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNKAGPLEEELPRLADQGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688715_HBSP_P-RF-DE Product feature CHAIN JN688715_HBSP_P-RF-DE of FT:mat_peptide JN688715_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV192). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQSFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688717_HBSP_P-RF-DE Product feature CHAIN JN688717_HBSP_P-RF-DE of FT:mat_peptide JN688717_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV216). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQLFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLSDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIALVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ027310_HBSP_P-RF-CB Product feature CHAIN JQ027310_HBSP_P-RF-CB of FT:mat_peptide JQ027310_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEXQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JQ040130_HBSP_P-RF-CB Product feature CHAIN JQ040130_HBSP_P-RF-CB of FT:mat_peptide JQ040130_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 95). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JQ040142_HBSP_P-RF-CB Product feature CHAIN JQ040142_HBSP_P-RF-CB of FT:mat_peptide JQ040142_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 262). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JQ040146_HBSP_P-RF-CB Product feature CHAIN JQ040146_HBSP_P-RF-CB of FT:mat_peptide JQ040146_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 278). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGXGPQSVSXGSVY
>gnl|hbvpro|JQ040148_HBSP_P-RF-CB Product feature CHAIN JQ040148_HBSP_P-RF-CB of FT:mat_peptide JQ040148_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate G67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JQ040174_HBSP_P-RF-CB Product feature CHAIN JQ040174_HBSP_P-RF-CB of FT:mat_peptide JQ040174_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate G246). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKXPLCFPLVAVQNLRT
ETALVFPSHHXGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JQ272886_HBSP_P-RF-GF Product feature CHAIN JQ272886_HBSP_P-RF-GF of FT:mat_peptide JQ272886_HBSP_P-RF-GF of [Viruses] Hepatitis B Virus recombinant form GF (isolate HBV_MDQ5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ272887_HBSP_P-RF-GF Product feature CHAIN JQ272887_HBSP_P-RF-GF of FT:mat_peptide JQ272887_HBSP_P-RF-GF of [Viruses] Hepatitis B Virus recombinant form GF (isolate HBV_MDQ24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ687532_HBSP_P-RF-DE Product feature CHAIN JQ687532_HBSP_P-RF-DE of FT:mat_peptide JQ687532_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Srb 207). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707421_HBSP_P-RF-GA Product feature CHAIN JQ707421_HBSP_P-RF-GA of FT:mat_peptide JQ707421_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707424_HBSP_P-RF-GA Product feature CHAIN JQ707424_HBSP_P-RF-GA of FT:mat_peptide JQ707424_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C12). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707426_HBSP_P-RF-GA Product feature CHAIN JQ707426_HBSP_P-RF-GA of FT:mat_peptide JQ707426_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C14). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707430_HBSP_P-RF-GA Product feature CHAIN JQ707430_HBSP_P-RF-GA of FT:mat_peptide JQ707430_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C19). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707432_HBSP_P-RF-GA Product feature CHAIN JQ707432_HBSP_P-RF-GA of FT:mat_peptide JQ707432_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C20). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDLAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707441_HBSP_P-RF-GA Product feature CHAIN JQ707441_HBSP_P-RF-GA of FT:mat_peptide JQ707441_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C34). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707445_HBSP_P-RF-GA Product feature CHAIN JQ707445_HBSP_P-RF-GA of FT:mat_peptide JQ707445_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707448_HBSP_P-RF-GA Product feature CHAIN JQ707448_HBSP_P-RF-GA of FT:mat_peptide JQ707448_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C42). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707450_HBSP_P-RF-GA Product feature CHAIN JQ707450_HBSP_P-RF-GA of FT:mat_peptide JQ707450_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C44). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707456_HBSP_P-RF-GA Product feature CHAIN JQ707456_HBSP_P-RF-GA of FT:mat_peptide JQ707456_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707457_HBSP_P-RF-GA Product feature CHAIN JQ707457_HBSP_P-RF-GA of FT:mat_peptide JQ707457_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C10). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707458_HBSP_P-RF-GA Product feature CHAIN JQ707458_HBSP_P-RF-GA of FT:mat_peptide JQ707458_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C11-10). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707459_HBSP_P-RF-GA Product feature CHAIN JQ707459_HBSP_P-RF-GA of FT:mat_peptide JQ707459_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C12). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707460_HBSP_P-RF-GA Product feature CHAIN JQ707460_HBSP_P-RF-GA of FT:mat_peptide JQ707460_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C13). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707461_HBSP_P-RF-GA Product feature CHAIN JQ707461_HBSP_P-RF-GA of FT:mat_peptide JQ707461_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C15). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707462_HBSP_P-RF-GA Product feature CHAIN JQ707462_HBSP_P-RF-GA of FT:mat_peptide JQ707462_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C17). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707463_HBSP_P-RF-GA Product feature CHAIN JQ707463_HBSP_P-RF-GA of FT:mat_peptide JQ707463_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C19). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVWDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707464_HBSP_P-RF-GA Product feature CHAIN JQ707464_HBSP_P-RF-GA of FT:mat_peptide JQ707464_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C2-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707465_HBSP_P-RF-GA Product feature CHAIN JQ707465_HBSP_P-RF-GA of FT:mat_peptide JQ707465_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C20). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVWDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707466_HBSP_P-RF-GA Product feature CHAIN JQ707466_HBSP_P-RF-GA of FT:mat_peptide JQ707466_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C26). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707467_HBSP_P-RF-GA Product feature CHAIN JQ707467_HBSP_P-RF-GA of FT:mat_peptide JQ707467_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C27). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707468_HBSP_P-RF-GA Product feature CHAIN JQ707468_HBSP_P-RF-GA of FT:mat_peptide JQ707468_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C28). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLGEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707469_HBSP_P-RF-GA Product feature CHAIN JQ707469_HBSP_P-RF-GA of FT:mat_peptide JQ707469_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C32). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707470_HBSP_P-RF-GA Product feature CHAIN JQ707470_HBSP_P-RF-GA of FT:mat_peptide JQ707470_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C34). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707471_HBSP_P-RF-GA Product feature CHAIN JQ707471_HBSP_P-RF-GA of FT:mat_peptide JQ707471_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C37). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707472_HBSP_P-RF-GA Product feature CHAIN JQ707472_HBSP_P-RF-GA of FT:mat_peptide JQ707472_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C40). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707473_HBSP_P-RF-GA Product feature CHAIN JQ707473_HBSP_P-RF-GA of FT:mat_peptide JQ707473_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C41). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707474_HBSP_P-RF-GA Product feature CHAIN JQ707474_HBSP_P-RF-GA of FT:mat_peptide JQ707474_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C43). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKAPLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707475_HBSP_P-RF-GA Product feature CHAIN JQ707475_HBSP_P-RF-GA of FT:mat_peptide JQ707475_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C45). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707714_HBSP_P-RF-CB Product feature CHAIN JQ707714_HBSP_P-RF-CB of FT:mat_peptide JQ707714_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S20_21). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPARDHAKPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JQ732168_HBSP_P-RF-CB Product feature CHAIN JQ732168_HBSP_P-RF-CB of FT:mat_peptide JQ732168_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate DT2007). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNLRVAEDLNLGNLNEHPLPARDHARHARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JQ801476_HBSP_P-RF-CG Product feature CHAIN JQ801476_HBSP_P-RF-CG of FT:mat_peptide JQ801476_HBSP_P-RF-CG of [Viruses] Hepatitis B Virus recombinant form CG (isolate AIDS18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JQ801477_HBSP_P-RF-BC Product feature CHAIN JQ801477_HBSP_P-RF-BC of FT:mat_peptide JQ801477_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate AIDS19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JX026887_HBSP_P-RF-CB Product feature CHAIN JX026887_HBSP_P-RF-CB of FT:mat_peptide JX026887_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WY-NJ-79). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JX429896_HBSP_P-RF-CB Product feature CHAIN JX429896_HBSP_P-RF-CB of FT:mat_peptide JX429896_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WY-HZ-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JX429898_HBSP_P-RF-DC Product feature CHAIN JX429898_HBSP_P-RF-DC of FT:mat_peptide JX429898_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate WY-HZ-13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JX504540_HBSP_P-RF-CB Product feature CHAIN JX504540_HBSP_P-RF-CB of FT:mat_peptide JX504540_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WY-NNJ-13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNEHQPPARDRARPARFLLKETLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGPVY
>gnl|hbvpro|JX661485_HBSP_P-RF-CB Product feature CHAIN JX661485_HBSP_P-RF-CB of FT:mat_peptide JX661485_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1201-C1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JX661486_HBSP_P-RF-CB Product feature CHAIN JX661486_HBSP_P-RF-CB of FT:mat_peptide JX661486_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1225-C12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPALDPARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JX661487_HBSP_P-RF-CB Product feature CHAIN JX661487_HBSP_P-RF-CB of FT:mat_peptide JX661487_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1207-C3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSRHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JX661494_HBSP_P-RF-CB Product feature CHAIN JX661494_HBSP_P-RF-CB of FT:mat_peptide JX661494_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1203-C2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JX661498_HBSP_P-RF-CB Product feature CHAIN JX661498_HBSP_P-RF-CB of FT:mat_peptide JX661498_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1213-C6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|JX898693_HBSP_P-RF-DE Product feature CHAIN JX898693_HBSP_P-RF-DE of FT:mat_peptide JX898693_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPTVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JX898695_HBSP_P-RF-DE Product feature CHAIN JX898695_HBSP_P-RF-DE of FT:mat_peptide JX898695_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPTVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JX898696_HBSP_P-RF-DE Product feature CHAIN JX898696_HBSP_P-RF-DE of FT:mat_peptide JX898696_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P31). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPTVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC012653_HBSP_P-RF-AD Product feature CHAIN KC012653_HBSP_P-RF-AD of FT:mat_peptide KC012653_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KC172106_HBSP_P-RF-GB Product feature CHAIN KC172106_HBSP_P-RF-GB of FT:mat_peptide KC172106_HBSP_P-RF-GB of [Viruses] Hepatitis B Virus recombinant form GB (isolate BTO3048). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KC315400_HBSP_P-RF-CB Product feature CHAIN KC315400_HBSP_P-RF-CB of FT:mat_peptide KC315400_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate M0914). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPAPDHAKPAQLLLKGPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774178_HBSP_P-RF-BC Product feature CHAIN KC774178_HBSP_P-RF-BC of FT:mat_peptide KC774178_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate GS12lz2088). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774183_HBSP_P-RF-CB Product feature CHAIN KC774183_HBSP_P-RF-CB of FT:mat_peptide KC774183_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1020). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774186_HBSP_P-RF-CB Product feature CHAIN KC774186_HBSP_P-RF-CB of FT:mat_peptide KC774186_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1026). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774188_HBSP_P-RF-CB Product feature CHAIN KC774188_HBSP_P-RF-CB of FT:mat_peptide KC774188_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1028). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARVLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774193_HBSP_P-RF-CB Product feature CHAIN KC774193_HBSP_P-RF-CB of FT:mat_peptide KC774193_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1035). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774198_HBSP_P-RF-CB Product feature CHAIN KC774198_HBSP_P-RF-CB of FT:mat_peptide KC774198_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2039). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774201_HBSP_P-RF-CB Product feature CHAIN KC774201_HBSP_P-RF-CB of FT:mat_peptide KC774201_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2047). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774212_HBSP_P-RF-CB Product feature CHAIN KC774212_HBSP_P-RF-CB of FT:mat_peptide KC774212_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2115). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQLPARDHARPARFLLKDPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774222_HBSP_P-RF-CB Product feature CHAIN KC774222_HBSP_P-RF-CB of FT:mat_peptide KC774222_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2166). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774230_HBSP_P-RF-CB Product feature CHAIN KC774230_HBSP_P-RF-CB of FT:mat_peptide KC774230_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cur1027). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774234_HBSP_P-RF-CB Product feature CHAIN KC774234_HBSP_P-RF-CB of FT:mat_peptide KC774234_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cur1038). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774246_HBSP_P-RF-CB Product feature CHAIN KC774246_HBSP_P-RF-CB of FT:mat_peptide KC774246_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cww1014). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774258_HBSP_P-RF-CB Product feature CHAIN KC774258_HBSP_P-RF-CB of FT:mat_peptide KC774258_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cww1060). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAKPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774263_HBSP_P-RF-CB Product feature CHAIN KC774263_HBSP_P-RF-CB of FT:mat_peptide KC774263_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cww1069). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774291_HBSP_P-RF-CB Product feature CHAIN KC774291_HBSP_P-RF-CB of FT:mat_peptide KC774291_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa1194). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774294_HBSP_P-RF-CB Product feature CHAIN KC774294_HBSP_P-RF-CB of FT:mat_peptide KC774294_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa1205). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774305_HBSP_P-RF-CB Product feature CHAIN KC774305_HBSP_P-RF-CB of FT:mat_peptide KC774305_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa1672). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHPLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774307_HBSP_P-RF-CB Product feature CHAIN KC774307_HBSP_P-RF-CB of FT:mat_peptide KC774307_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2016). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774317_HBSP_P-RF-CB Product feature CHAIN KC774317_HBSP_P-RF-CB of FT:mat_peptide KC774317_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2042). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHPLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774322_HBSP_P-RF-CB Product feature CHAIN KC774322_HBSP_P-RF-CB of FT:mat_peptide KC774322_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2053). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHPLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774323_HBSP_P-RF-CB Product feature CHAIN KC774323_HBSP_P-RF-CB of FT:mat_peptide KC774323_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2057). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYHHFGKLLWTHDEAGPIGALLPRLADEKTNCRVPEDLNLGDLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774324_HBSP_P-RF-CB Product feature CHAIN KC774324_HBSP_P-RF-CB of FT:mat_peptide KC774324_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2060). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774328_HBSP_P-RF-CB Product feature CHAIN KC774328_HBSP_P-RF-CB of FT:mat_peptide KC774328_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2073). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774332_HBSP_P-RF-CB Product feature CHAIN KC774332_HBSP_P-RF-CB of FT:mat_peptide KC774332_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1005). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774341_HBSP_P-RF-CB Product feature CHAIN KC774341_HBSP_P-RF-CB of FT:mat_peptide KC774341_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1040). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774344_HBSP_P-RF-CB Product feature CHAIN KC774344_HBSP_P-RF-CB of FT:mat_peptide KC774344_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1049). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVH
>gnl|hbvpro|KC774349_HBSP_P-RF-CB Product feature CHAIN KC774349_HBSP_P-RF-CB of FT:mat_peptide KC774349_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1095). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KC774364_HBSP_P-RF-BC Product feature CHAIN KC774364_HBSP_P-RF-BC of FT:mat_peptide KC774364_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate blz2088). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774414_HBSP_P-RF-BC Product feature CHAIN KC774414_HBSP_P-RF-BC of FT:mat_peptide KC774414_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate bxa2061). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC774420_HBSP_P-RF-DC Product feature CHAIN KC774420_HBSP_P-RF-DC of FT:mat_peptide KC774420_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz1003). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774422_HBSP_P-RF-DC Product feature CHAIN KC774422_HBSP_P-RF-DC of FT:mat_peptide KC774422_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz1044). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774423_HBSP_P-RF-DC Product feature CHAIN KC774423_HBSP_P-RF-DC of FT:mat_peptide KC774423_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2018). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774424_HBSP_P-RF-DC Product feature CHAIN KC774424_HBSP_P-RF-DC of FT:mat_peptide KC774424_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2021). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774425_HBSP_P-RF-DC Product feature CHAIN KC774425_HBSP_P-RF-DC of FT:mat_peptide KC774425_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2068). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774426_HBSP_P-RF-DC Product feature CHAIN KC774426_HBSP_P-RF-DC of FT:mat_peptide KC774426_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2091). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774428_HBSP_P-RF-DC Product feature CHAIN KC774428_HBSP_P-RF-DC of FT:mat_peptide KC774428_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2100). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774430_HBSP_P-RF-DC Product feature CHAIN KC774430_HBSP_P-RF-DC of FT:mat_peptide KC774430_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2121). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774431_HBSP_P-RF-DC Product feature CHAIN KC774431_HBSP_P-RF-DC of FT:mat_peptide KC774431_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2122). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDPAKPAQLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774432_HBSP_P-RF-DC Product feature CHAIN KC774432_HBSP_P-RF-DC of FT:mat_peptide KC774432_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2128). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774433_HBSP_P-RF-DC Product feature CHAIN KC774433_HBSP_P-RF-DC of FT:mat_peptide KC774433_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2143). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774434_HBSP_P-RF-DC Product feature CHAIN KC774434_HBSP_P-RF-DC of FT:mat_peptide KC774434_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dur1021). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774435_HBSP_P-RF-DC Product feature CHAIN KC774435_HBSP_P-RF-DC of FT:mat_peptide KC774435_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1006). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774439_HBSP_P-RF-DC Product feature CHAIN KC774439_HBSP_P-RF-DC of FT:mat_peptide KC774439_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1024). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774442_HBSP_P-RF-DC Product feature CHAIN KC774442_HBSP_P-RF-DC of FT:mat_peptide KC774442_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1035). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVH
>gnl|hbvpro|KC774443_HBSP_P-RF-DC Product feature CHAIN KC774443_HBSP_P-RF-DC of FT:mat_peptide KC774443_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1036). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774447_HBSP_P-RF-DC Product feature CHAIN KC774447_HBSP_P-RF-DC of FT:mat_peptide KC774447_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1057). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGGGPQPVSLGSVY
>gnl|hbvpro|KC774448_HBSP_P-RF-DC Product feature CHAIN KC774448_HBSP_P-RF-DC of FT:mat_peptide KC774448_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1058). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRP
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774449_HBSP_P-RF-DC Product feature CHAIN KC774449_HBSP_P-RF-DC of FT:mat_peptide KC774449_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1071). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774450_HBSP_P-RF-DE Product feature CHAIN KC774450_HBSP_P-RF-DE of FT:mat_peptide KC774450_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate dww1073). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774452_HBSP_P-RF-DC Product feature CHAIN KC774452_HBSP_P-RF-DC of FT:mat_peptide KC774452_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1080). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGGGPQPVSLGSVY
>gnl|hbvpro|KC774453_HBSP_P-RF-DC Product feature CHAIN KC774453_HBSP_P-RF-DC of FT:mat_peptide KC774453_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1083). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774454_HBSP_P-RF-DC Product feature CHAIN KC774454_HBSP_P-RF-DC of FT:mat_peptide KC774454_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1087). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774455_HBSP_P-RF-DC Product feature CHAIN KC774455_HBSP_P-RF-DC of FT:mat_peptide KC774455_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1100). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774456_HBSP_P-RF-DC Product feature CHAIN KC774456_HBSP_P-RF-DC of FT:mat_peptide KC774456_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1102). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774457_HBSP_P-RF-DC Product feature CHAIN KC774457_HBSP_P-RF-DC of FT:mat_peptide KC774457_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1105). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774458_HBSP_P-RF-DC Product feature CHAIN KC774458_HBSP_P-RF-DC of FT:mat_peptide KC774458_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1108). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLEEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774461_HBSP_P-RF-DC Product feature CHAIN KC774461_HBSP_P-RF-DC of FT:mat_peptide KC774461_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxa1577). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774463_HBSP_P-RF-DC Product feature CHAIN KC774463_HBSP_P-RF-DC of FT:mat_peptide KC774463_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxa2066). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCFPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774466_HBSP_P-RF-DC Product feature CHAIN KC774466_HBSP_P-RF-DC of FT:mat_peptide KC774466_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1008). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774468_HBSP_P-RF-DC Product feature CHAIN KC774468_HBSP_P-RF-DC of FT:mat_peptide KC774468_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1012). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774470_HBSP_P-RF-DC Product feature CHAIN KC774470_HBSP_P-RF-DC of FT:mat_peptide KC774470_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1017). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774471_HBSP_P-RF-DC Product feature CHAIN KC774471_HBSP_P-RF-DC of FT:mat_peptide KC774471_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1018). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774472_HBSP_P-RF-DC Product feature CHAIN KC774472_HBSP_P-RF-DC of FT:mat_peptide KC774472_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1020). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774474_HBSP_P-RF-DC Product feature CHAIN KC774474_HBSP_P-RF-DC of FT:mat_peptide KC774474_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1025). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774475_HBSP_P-RF-DC Product feature CHAIN KC774475_HBSP_P-RF-DC of FT:mat_peptide KC774475_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1026). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774476_HBSP_P-RF-DC Product feature CHAIN KC774476_HBSP_P-RF-DC of FT:mat_peptide KC774476_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1030). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774478_HBSP_P-RF-DC Product feature CHAIN KC774478_HBSP_P-RF-DC of FT:mat_peptide KC774478_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1035). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRM
EIAPVFPSHRPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774479_HBSP_P-RF-DC Product feature CHAIN KC774479_HBSP_P-RF-DC of FT:mat_peptide KC774479_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1036). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774480_HBSP_P-RF-DC Product feature CHAIN KC774480_HBSP_P-RF-DC of FT:mat_peptide KC774480_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1038). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRM
EIAPVFPSHRPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774481_HBSP_P-RF-DC Product feature CHAIN KC774481_HBSP_P-RF-DC of FT:mat_peptide KC774481_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1039). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPLVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774482_HBSP_P-RF-DC Product feature CHAIN KC774482_HBSP_P-RF-DC of FT:mat_peptide KC774482_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1043). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEDLNRRVAEDLNLGNLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774483_HBSP_P-RF-DC Product feature CHAIN KC774483_HBSP_P-RF-DC of FT:mat_peptide KC774483_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1047). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774484_HBSP_P-RF-DC Product feature CHAIN KC774484_HBSP_P-RF-DC of FT:mat_peptide KC774484_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1051). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774485_HBSP_P-RF-DC Product feature CHAIN KC774485_HBSP_P-RF-DC of FT:mat_peptide KC774485_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1058). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774486_HBSP_P-RF-DC Product feature CHAIN KC774486_HBSP_P-RF-DC of FT:mat_peptide KC774486_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1064). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPHVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774488_HBSP_P-RF-DC Product feature CHAIN KC774488_HBSP_P-RF-DC of FT:mat_peptide KC774488_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1077). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774489_HBSP_P-RF-DC Product feature CHAIN KC774489_HBSP_P-RF-DC of FT:mat_peptide KC774489_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1079). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774490_HBSP_P-RF-DC Product feature CHAIN KC774490_HBSP_P-RF-DC of FT:mat_peptide KC774490_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1082). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774492_HBSP_P-RF-DC Product feature CHAIN KC774492_HBSP_P-RF-DC of FT:mat_peptide KC774492_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1087). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774493_HBSP_P-RF-DC Product feature CHAIN KC774493_HBSP_P-RF-DC of FT:mat_peptide KC774493_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1089). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774494_HBSP_P-RF-DC Product feature CHAIN KC774494_HBSP_P-RF-DC of FT:mat_peptide KC774494_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1090). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774495_HBSP_P-RF-DC Product feature CHAIN KC774495_HBSP_P-RF-DC of FT:mat_peptide KC774495_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1091). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774497_HBSP_P-RF-DC Product feature CHAIN KC774497_HBSP_P-RF-DC of FT:mat_peptide KC774497_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1097). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774498_HBSP_P-RF-DC Product feature CHAIN KC774498_HBSP_P-RF-DC of FT:mat_peptide KC774498_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dyc1011). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774499_HBSP_P-RF-DC Product feature CHAIN KC774499_HBSP_P-RF-DC of FT:mat_peptide KC774499_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dyc1018). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF053160_HBSP_P-RF-CB Product feature CHAIN KF053160_HBSP_P-RF-CB of FT:mat_peptide KF053160_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY515920). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQPVSPGSVY
>gnl|hbvpro|KF053166_HBSP_P-RF-BC Product feature CHAIN KF053166_HBSP_P-RF-BC of FT:mat_peptide KF053166_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY830498). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFLRLLLLEHGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRPPAPDHAKPARFLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSLGSVY
>gnl|hbvpro|KF053179_HBSP_P-RF-BC Product feature CHAIN KF053179_HBSP_P-RF-BC of FT:mat_peptide KF053179_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY816598). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KF053188_HBSP_P-RF-CB Product feature CHAIN KF053188_HBSP_P-RF-CB of FT:mat_peptide KF053188_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY34118). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF170740_HBSP_P-RF-DE Product feature CHAIN KF170740_HBSP_P-RF-DE of FT:mat_peptide KF170740_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SDAC_031). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAGPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF192833_HBSP_P-RF-DE Product feature CHAIN KF192833_HBSP_P-RF-DE of FT:mat_peptide KF192833_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP68). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192835_HBSP_P-RF-DE Product feature CHAIN KF192835_HBSP_P-RF-DE of FT:mat_peptide KF192835_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192836_HBSP_P-RF-DE Product feature CHAIN KF192836_HBSP_P-RF-DE of FT:mat_peptide KF192836_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP69). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192837_HBSP_P-RF-DE Product feature CHAIN KF192837_HBSP_P-RF-DE of FT:mat_peptide KF192837_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP55). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192838_HBSP_P-RF-DE Product feature CHAIN KF192838_HBSP_P-RF-DE of FT:mat_peptide KF192838_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192839_HBSP_P-RF-DE Product feature CHAIN KF192839_HBSP_P-RF-DE of FT:mat_peptide KF192839_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192841_HBSP_P-RF-DE Product feature CHAIN KF192841_HBSP_P-RF-DE of FT:mat_peptide KF192841_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP49). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREHAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF214656_HBSP_P-RF-AC Product feature CHAIN KF214656_HBSP_P-RF-AC of FT:mat_peptide KF214656_HBSP_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate IND-2009-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KF214680_HBSP_P-RF-GC Product feature CHAIN KF214680_HBSP_P-RF-GC of FT:mat_peptide KF214680_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate IND-1963-3). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRELAEPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KF219922_HBSP_P-RF-GH Product feature CHAIN KF219922_HBSP_P-RF-GH of FT:mat_peptide KF219922_HBSP_P-RF-GH of [Viruses] Hepatitis B Virus recombinant form GH (isolate HBV201302). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDXEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF471643_HBSP_P-RF-DE Product feature CHAIN KF471643_HBSP_P-RF-DE of FT:mat_peptide KF471643_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate PG-60). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679991_HBSP_P-RF-DE Product feature CHAIN KF679991_HBSP_P-RF-DE of FT:mat_peptide KF679991_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EICI-74). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|KF779353_HBSP_P-RF-DA Product feature CHAIN KF779353_HBSP_P-RF-DA of FT:mat_peptide KF779353_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate PNF5063). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHRPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF873530_HBSP_P-RF-CB Product feature CHAIN KF873530_HBSP_P-RF-CB of FT:mat_peptide KF873530_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 018_WAust_Wyn). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDQQPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873531_HBSP_P-RF-CB Product feature CHAIN KF873531_HBSP_P-RF-CB of FT:mat_peptide KF873531_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 021_TI_Ngu). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEXLNRRVAEDLNLGNPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873532_HBSP_P-RF-CB Product feature CHAIN KF873532_HBSP_P-RF-CB of FT:mat_peptide KF873532_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 031_TI_Ngu). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873533_HBSP_P-RF-CB Product feature CHAIN KF873533_HBSP_P-RF-CB of FT:mat_peptide KF873533_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 028_TI_Ngu). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873534_HBSP_P-RF-CB Product feature CHAIN KF873534_HBSP_P-RF-CB of FT:mat_peptide KF873534_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 019_TI_Ngu). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873535_HBSP_P-RF-CB Product feature CHAIN KF873535_HBSP_P-RF-CB of FT:mat_peptide KF873535_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 027_TI_Mil). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPXARDLAEPARXLLKEPLCXPHVAVQNLRT
AIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873537_HBSP_P-RF-CB Product feature CHAIN KF873537_HBSP_P-RF-CB of FT:mat_peptide KF873537_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 045_DR_Wad). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873538_HBSP_P-RF-CB Product feature CHAIN KF873538_HBSP_P-RF-CB of FT:mat_peptide KF873538_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 059_DR_Wad). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873540_HBSP_P-RF-CB Product feature CHAIN KF873540_HBSP_P-RF-CB of FT:mat_peptide KF873540_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 003_DR_Dal). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQNSYGSGPQXVSPGSVY
>gnl|hbvpro|KF873542_HBSP_P-RF-CB Product feature CHAIN KF873542_HBSP_P-RF-CB of FT:mat_peptide KF873542_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 038_DR_Wad). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF873543_HBSP_P-RF-CB Product feature CHAIN KF873543_HBSP_P-RF-CB of FT:mat_peptide KF873543_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 050_DR_Wad). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KF917451_HBSP_P-RF-DC Product feature CHAIN KF917451_HBSP_P-RF-DC of FT:mat_peptide KF917451_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate YN.071). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|KJ173279_HBSP_P-RF-CB Product feature CHAIN KJ173279_HBSP_P-RF-CB of FT:mat_peptide KJ173279_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX004C(e207)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173280_HBSP_P-RF-CB Product feature CHAIN KJ173280_HBSP_P-RF-CB of FT:mat_peptide KJ173280_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX004M(e208)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173299_HBSP_P-RF-CB Product feature CHAIN KJ173299_HBSP_P-RF-CB of FT:mat_peptide KJ173299_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HS005C(e22)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLHKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173300_HBSP_P-RF-CB Product feature CHAIN KJ173300_HBSP_P-RF-CB of FT:mat_peptide KJ173300_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HS005M(e23)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLHKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173320_HBSP_P-RF-CB Product feature CHAIN KJ173320_HBSP_P-RF-CB of FT:mat_peptide KJ173320_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate NH29M(e41)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173322_HBSP_P-RF-CB Product feature CHAIN KJ173322_HBSP_P-RF-CB of FT:mat_peptide KJ173322_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate NH30M(e41)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173325_HBSP_P-RF-CB Product feature CHAIN KJ173325_HBSP_P-RF-CB of FT:mat_peptide KJ173325_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P004-C(012)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPICFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173326_HBSP_P-RF-CB Product feature CHAIN KJ173326_HBSP_P-RF-CB of FT:mat_peptide KJ173326_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P004-M(014)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173329_HBSP_P-RF-CB Product feature CHAIN KJ173329_HBSP_P-RF-CB of FT:mat_peptide KJ173329_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P011-C(b168)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173330_HBSP_P-RF-CB Product feature CHAIN KJ173330_HBSP_P-RF-CB of FT:mat_peptide KJ173330_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P011-M2(170)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173349_HBSP_P-RF-CB Product feature CHAIN KJ173349_HBSP_P-RF-CB of FT:mat_peptide KJ173349_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX017C(e226)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173350_HBSP_P-RF-CB Product feature CHAIN KJ173350_HBSP_P-RF-CB of FT:mat_peptide KJ173350_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX017M(e227)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQQPARDHAKPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ173358_HBSP_P-RF-CB Product feature CHAIN KJ173358_HBSP_P-RF-CB of FT:mat_peptide KJ173358_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX065M(e314)). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKDPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ410497_HBSP_P-RF-BC Product feature CHAIN KJ410497_HBSP_P-RF-BC of FT:mat_peptide KJ410497_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate HK_1325). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ410506_HBSP_P-RF-CB Product feature CHAIN KJ410506_HBSP_P-RF-CB of FT:mat_peptide KJ410506_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Occult_HK526). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ410520_HBSP_P-RF-CB Product feature CHAIN KJ410520_HBSP_P-RF-CB of FT:mat_peptide KJ410520_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Occult_HK4869). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQPPARGHARPARFLLKEPLCFPRVAVQNLRT
QTALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ470884_HBSP_P-RF-DE Product feature CHAIN KJ470884_HBSP_P-RF-DE of FT:mat_peptide KJ470884_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8145). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470886_HBSP_P-RF-DE Product feature CHAIN KJ470886_HBSP_P-RF-DE of FT:mat_peptide KJ470886_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8117). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470887_HBSP_P-RF-DE Product feature CHAIN KJ470887_HBSP_P-RF-DE of FT:mat_peptide KJ470887_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8064). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLXIPPVAVQNLRM
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470888_HBSP_P-RF-DE Product feature CHAIN KJ470888_HBSP_P-RF-DE of FT:mat_peptide KJ470888_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8035). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470890_HBSP_P-RF-DE Product feature CHAIN KJ470890_HBSP_P-RF-DE of FT:mat_peptide KJ470890_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8033). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470891_HBSP_P-RF-DE Product feature CHAIN KJ470891_HBSP_P-RF-DE of FT:mat_peptide KJ470891_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8003). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470892_HBSP_P-RF-DE Product feature CHAIN KJ470892_HBSP_P-RF-DE of FT:mat_peptide KJ470892_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8022). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470897_HBSP_P-RF-DE Product feature CHAIN KJ470897_HBSP_P-RF-DE of FT:mat_peptide KJ470897_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8016). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470898_HBSP_P-RF-DE Product feature CHAIN KJ470898_HBSP_P-RF-DE of FT:mat_peptide KJ470898_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8142). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVH
>gnl|hbvpro|KJ586810_HBSP_P-RF-AF Product feature CHAIN KJ586810_HBSP_P-RF-AF of FT:mat_peptide KJ586810_HBSP_P-RF-AF of [Viruses] Hepatitis B Virus recombinant form AF. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ598675_HBSP_P-RF-CB Product feature CHAIN KJ598675_HBSP_P-RF-CB of FT:mat_peptide KJ598675_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SHB3B2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ647349_HBSP_P-RF-DE Product feature CHAIN KJ647349_HBSP_P-RF-DE of FT:mat_peptide KJ647349_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV156). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KJ647351_HBSP_P-RF-DE Product feature CHAIN KJ647351_HBSP_P-RF-DE of FT:mat_peptide KJ647351_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV202). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KJ647356_HBSP_P-RF-DE Product feature CHAIN KJ647356_HBSP_P-RF-DE of FT:mat_peptide KJ647356_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV249). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDHAKPAQLLFKEPLCFPHVAVQNLRT
EIAPVFPSHHPGLSEISYGSGPQPVSLGSVY
>gnl|hbvpro|KJ717794_HBSP_P-RF-CB Product feature CHAIN KJ717794_HBSP_P-RF-CB of FT:mat_peptide KJ717794_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY541105). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDVNLGNLNEHQLPARDHARPARFLLKEPVCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ717800_HBSP_P-RF-CB Product feature CHAIN KJ717800_HBSP_P-RF-CB of FT:mat_peptide KJ717800_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY824318). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRLAEDLNLGNLNEHQQQARDRARPARLLLKGPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717814_HBSP_P-RF-CB Product feature CHAIN KJ717814_HBSP_P-RF-CB of FT:mat_peptide KJ717814_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY604675). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRFAEDLNLGNLNEHQLPAPDHAKPARLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717815_HBSP_P-RF-CB Product feature CHAIN KJ717815_HBSP_P-RF-CB of FT:mat_peptide KJ717815_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY501032). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717816_HBSP_P-RF-CB Product feature CHAIN KJ717816_HBSP_P-RF-CB of FT:mat_peptide KJ717816_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY590465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ717832_HBSP_P-RF-CB Product feature CHAIN KJ717832_HBSP_P-RF-CB of FT:mat_peptide KJ717832_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY501297). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSHGSVY
>gnl|hbvpro|KJ803753_HBSP_P-RF-CB Product feature CHAIN KJ803753_HBSP_P-RF-CB of FT:mat_peptide KJ803753_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY515920). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQPVSPGSVY
>gnl|hbvpro|KJ803771_HBSP_P-RF-DB Product feature CHAIN KJ803771_HBSP_P-RF-DB of FT:mat_peptide KJ803771_HBSP_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate MY62981). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEHARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KJ803772_HBSP_P-RF-BC Product feature CHAIN KJ803772_HBSP_P-RF-BC of FT:mat_peptide KJ803772_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY816598). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ803782_HBSP_P-RF-CB Product feature CHAIN KJ803782_HBSP_P-RF-CB of FT:mat_peptide KJ803782_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY34118). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803785_HBSP_P-RF-CB Product feature CHAIN KJ803785_HBSP_P-RF-CB of FT:mat_peptide KJ803785_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY34920). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNEHQLPARDHARPARFLLKGPLCFPLVAVQNLRT
EIALVFPSHRLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ803788_HBSP_P-RF-CB Product feature CHAIN KJ803788_HBSP_P-RF-CB of FT:mat_peptide KJ803788_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY541105). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDVNLGNLNEHQLPARDHARPARFLLKEPVCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ803791_HBSP_P-RF-CB Product feature CHAIN KJ803791_HBSP_P-RF-CB of FT:mat_peptide KJ803791_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY824318). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRLAEDLNLGNLNEHQQQARDRARPARLLLKGPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803798_HBSP_P-RF-CB Product feature CHAIN KJ803798_HBSP_P-RF-CB of FT:mat_peptide KJ803798_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY464961). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPAPDHAKPARFLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ803802_HBSP_P-RF-CB Product feature CHAIN KJ803802_HBSP_P-RF-CB of FT:mat_peptide KJ803802_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY604675). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRFAEDLNLGNLNEHQLPAPDHAKPARLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803803_HBSP_P-RF-CB Product feature CHAIN KJ803803_HBSP_P-RF-CB of FT:mat_peptide KJ803803_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY501032). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ803804_HBSP_P-RF-CB Product feature CHAIN KJ803804_HBSP_P-RF-CB of FT:mat_peptide KJ803804_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY590465). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KJ803822_HBSP_P-RF-CB Product feature CHAIN KJ803822_HBSP_P-RF-CB of FT:mat_peptide KJ803822_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY091938). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQCFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDPARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQDTYGSGPQSVSPGSVY
>gnl|hbvpro|KJ803827_HBSP_P-RF-BC Product feature CHAIN KJ803827_HBSP_P-RF-BC of FT:mat_peptide KJ803827_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY830498). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFLRLLLLEHGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRPPAPDHAKPARFLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSLGSVY
>gnl|hbvpro|KM213033_HBSP_P-RF-CB Product feature CHAIN KM213033_HBSP_P-RF-CB of FT:mat_peptide KM213033_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WSQ-k1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KM359442_HBSP_P-RF-DE Product feature CHAIN KM359442_HBSP_P-RF-DE of FT:mat_peptide KM359442_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate CM4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM386676_HBSP_P-RF-DE Product feature CHAIN KM386676_HBSP_P-RF-DE of FT:mat_peptide KM386676_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate CM1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524336_HBSP_P-RF-DE Product feature CHAIN KM524336_HBSP_P-RF-DE of FT:mat_peptide KM524336_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV010_EP-CHB). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRT
KIAPVFPSHHPGLSENSYGSGPQPVSPDSVY
>gnl|hbvpro|KM524337_HBSP_P-RF-DE Product feature CHAIN KM524337_HBSP_P-RF-DE of FT:mat_peptide KM524337_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV013_EP-CHB). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYVSGPQPVSPDSVY
>gnl|hbvpro|KM524357_HBSP_P-RF-DE Product feature CHAIN KM524357_HBSP_P-RF-DE of FT:mat_peptide KM524357_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV.I-146_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524359_HBSP_P-RF-DE Product feature CHAIN KM524359_HBSP_P-RF-DE of FT:mat_peptide KM524359_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EHBV.I-058_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM577663_HBSP_P-RF-DE Product feature CHAIN KM577663_HBSP_P-RF-DE of FT:mat_peptide KM577663_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAKPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM577664_HBSP_P-RF-DE Product feature CHAIN KM577664_HBSP_P-RF-DE of FT:mat_peptide KM577664_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAKPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGTQPVSPGSVY
>gnl|hbvpro|KM577665_HBSP_P-RF-DE Product feature CHAIN KM577665_HBSP_P-RF-DE of FT:mat_peptide KM577665_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM577666_HBSP_P-RF-DE Product feature CHAIN KM577666_HBSP_P-RF-DE of FT:mat_peptide KM577666_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNETQPPARDHAEPARLLLKEPLCISPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM577667_HBSP_P-RF-DE Product feature CHAIN KM577667_HBSP_P-RF-DE of FT:mat_peptide KM577667_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM606741_HBSP_P-RF-DE Product feature CHAIN KM606741_HBSP_P-RF-DE of FT:mat_peptide KM606741_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Cuba53a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAHVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM606750_HBSP_P-RF-DE Product feature CHAIN KM606750_HBSP_P-RF-DE of FT:mat_peptide KM606750_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Cuba60). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM606751_HBSP_P-RF-DE Product feature CHAIN KM606751_HBSP_P-RF-DE of FT:mat_peptide KM606751_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Cuba64). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLANEGLNRHVAENLNLGNLNDLQPPARDHAEPARLLLKAPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM875422_HBSP_P-RF-CB Product feature CHAIN KM875422_HBSP_P-RF-CB of FT:mat_peptide KM875422_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate pt12N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
QTALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KP148337_HBSP_P-RF-BC Product feature CHAIN KP148337_HBSP_P-RF-BC of FT:mat_peptide KP148337_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D282-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP148352_HBSP_P-RF-CB Product feature CHAIN KP148352_HBSP_P-RF-CB of FT:mat_peptide KP148352_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D71-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KP148441_HBSP_P-RF-GC Product feature CHAIN KP148441_HBSP_P-RF-GC of FT:mat_peptide KP148441_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y132-2-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KP148449_HBSP_P-RF-GC Product feature CHAIN KP148449_HBSP_P-RF-GC of FT:mat_peptide KP148449_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y132-2-48). Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KP148450_HBSP_P-RF-GC Product feature CHAIN KP148450_HBSP_P-RF-GC of FT:mat_peptide KP148450_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y132-2-46). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQQFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|KP148586_HBSP_P-RF-GC Product feature CHAIN KP148586_HBSP_P-RF-GC of FT:mat_peptide KP148586_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y50-13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KP168416_HBSP_P-RF-DE Product feature CHAIN KP168416_HBSP_P-RF-DE of FT:mat_peptide KP168416_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD422). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP168417_HBSP_P-RF-DE Product feature CHAIN KP168417_HBSP_P-RF-DE of FT:mat_peptide KP168417_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD429). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP168418_HBSP_P-RF-DE Product feature CHAIN KP168418_HBSP_P-RF-DE of FT:mat_peptide KP168418_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD416). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP168420_HBSP_P-RF-DE Product feature CHAIN KP168420_HBSP_P-RF-DE of FT:mat_peptide KP168420_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD428). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KP168421_HBSP_P-RF-DE Product feature CHAIN KP168421_HBSP_P-RF-DE of FT:mat_peptide KP168421_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD401). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KP274926_HBSP_P-RF-GA Product feature CHAIN KP274926_HBSP_P-RF-GA of FT:mat_peptide KP274926_HBSP_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate GS-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP276253_HBSP_P-RF-DC Product feature CHAIN KP276253_HBSP_P-RF-DC of FT:mat_peptide KP276253_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1874). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KP276254_HBSP_P-RF-DC Product feature CHAIN KP276254_HBSP_P-RF-DC of FT:mat_peptide KP276254_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1887). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KP276255_HBSP_P-RF-DC Product feature CHAIN KP276255_HBSP_P-RF-DC of FT:mat_peptide KP276255_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1888). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KP276256_HBSP_P-RF-DC Product feature CHAIN KP276256_HBSP_P-RF-DC of FT:mat_peptide KP276256_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1925). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KP288875_HBSP_P-RF-DE Product feature CHAIN KP288875_HBSP_P-RF-DE of FT:mat_peptide KP288875_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate PatC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQYFRRLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQPPARDRAKPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KP995112_HBSP_P-RF-DE Product feature CHAIN KP995112_HBSP_P-RF-DE of FT:mat_peptide KP995112_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 1925-HCC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKAPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KR013806_HBSP_P-RF-CB Product feature CHAIN KR013806_HBSP_P-RF-CB of FT:mat_peptide KR013806_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQRPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KR013816_HBSP_P-RF-CB Product feature CHAIN KR013816_HBSP_P-RF-CB of FT:mat_peptide KR013816_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDSYGSGPQSVSLGSVY
>gnl|hbvpro|KR013843_HBSP_P-RF-CB Product feature CHAIN KR013843_HBSP_P-RF-CB of FT:mat_peptide KR013843_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAGPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPYSVY
>gnl|hbvpro|KR905422_HBSP_P-RF-DE Product feature CHAIN KR905422_HBSP_P-RF-DE of FT:mat_peptide KR905422_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EICI-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT003704_HBSP_P-RF-CB Product feature CHAIN KT003704_HBSP_P-RF-CB of FT:mat_peptide KT003704_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IND-DIB-RMRC-667). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNERQRPVRDHAGPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KT366492_HBSP_P-RF-DE Product feature CHAIN KT366492_HBSP_P-RF-DE of FT:mat_peptide KT366492_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366503_HBSP_P-RF-DE Product feature CHAIN KT366503_HBSP_P-RF-DE of FT:mat_peptide KT366503_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLYIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366504_HBSP_P-RF-DE Product feature CHAIN KT366504_HBSP_P-RF-DE of FT:mat_peptide KT366504_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKGPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT991417_HBSP_P-RF-DC Product feature CHAIN KT991417_HBSP_P-RF-DC of FT:mat_peptide KT991417_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KT991419_HBSP_P-RF-DC Product feature CHAIN KT991419_HBSP_P-RF-DC of FT:mat_peptide KT991419_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KT991420_HBSP_P-RF-DC Product feature CHAIN KT991420_HBSP_P-RF-DC of FT:mat_peptide KT991420_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KT991421_HBSP_P-RF-DC Product feature CHAIN KT991421_HBSP_P-RF-DC of FT:mat_peptide KT991421_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KT991423_HBSP_P-RF-DC Product feature CHAIN KT991423_HBSP_P-RF-DC of FT:mat_peptide KT991423_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KT991424_HBSP_P-RF-DC Product feature CHAIN KT991424_HBSP_P-RF-DC of FT:mat_peptide KT991424_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDNAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KT991427_HBSP_P-RF-DC Product feature CHAIN KT991427_HBSP_P-RF-DC of FT:mat_peptide KT991427_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113-2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDNAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU519422_HBSP_P-RF-DC Product feature CHAIN KU519422_HBSP_P-RF-DC of FT:mat_peptide KU519422_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLinzhi-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU519423_HBSP_P-RF-DC Product feature CHAIN KU519423_HBSP_P-RF-DC of FT:mat_peptide KU519423_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLinzhi-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU679939_HBSP_P-RF-CB Product feature CHAIN KU679939_HBSP_P-RF-CB of FT:mat_peptide KU679939_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 083_WA_Man). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARSLLKEPLCFPPVAVQNLRT
AIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KU679940_HBSP_P-RF-CB Product feature CHAIN KU679940_HBSP_P-RF-CB of FT:mat_peptide KU679940_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 084_WA_Man). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
XIAPVFPSHHLGLSQNSYGSGPQXVSPGXVY
>gnl|hbvpro|KU679945_HBSP_P-RF-CB Product feature CHAIN KU679945_HBSP_P-RF-CB of FT:mat_peptide KU679945_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 098_DR_Wad). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIALVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KU679952_HBSP_P-RF-CB Product feature CHAIN KU679952_HBSP_P-RF-CB of FT:mat_peptide KU679952_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 114_TI_Ngu). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLXEELPRLABEGLNRRVAXDLNLGNPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KU695742_HBSP_P-RF-CB Product feature CHAIN KU695742_HBSP_P-RF-CB of FT:mat_peptide KU695742_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5072). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELHRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU711666_HBSP_P-RF-DE Product feature CHAIN KU711666_HBSP_P-RF-DE of FT:mat_peptide KU711666_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 007N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHHGLSENSYGSGPQPVSPGSVH
>gnl|hbvpro|KU736914_HBSP_P-RF-DE Product feature CHAIN KU736914_HBSP_P-RF-DE of FT:mat_peptide KU736914_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHADPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU736915_HBSP_P-RF-DE Product feature CHAIN KU736915_HBSP_P-RF-DE of FT:mat_peptide KU736915_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAXPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU736917_HBSP_P-RF-DE Product feature CHAIN KU736917_HBSP_P-RF-DE of FT:mat_peptide KU736917_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Sudan_19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHADPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU736921_HBSP_P-RF-DE Product feature CHAIN KU736921_HBSP_P-RF-DE of FT:mat_peptide KU736921_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KU736922_HBSP_P-RF-DE Product feature CHAIN KU736922_HBSP_P-RF-DE of FT:mat_peptide KU736922_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEXAGPLEEELPRLADEGLNRRVAXDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KU736923_HBSP_P-RF-DE Product feature CHAIN KU736923_HBSP_P-RF-DE of FT:mat_peptide KU736923_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Somalia_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KU963856_HBSP_P-RF-CB Product feature CHAIN KU963856_HBSP_P-RF-CB of FT:mat_peptide KU963856_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963857_HBSP_P-RF-CB Product feature CHAIN KU963857_HBSP_P-RF-CB of FT:mat_peptide KU963857_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963858_HBSP_P-RF-CB Product feature CHAIN KU963858_HBSP_P-RF-CB of FT:mat_peptide KU963858_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963859_HBSP_P-RF-CB Product feature CHAIN KU963859_HBSP_P-RF-CB of FT:mat_peptide KU963859_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963860_HBSP_P-RF-CB Product feature CHAIN KU963860_HBSP_P-RF-CB of FT:mat_peptide KU963860_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963861_HBSP_P-RF-CB Product feature CHAIN KU963861_HBSP_P-RF-CB of FT:mat_peptide KU963861_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963862_HBSP_P-RF-CB Product feature CHAIN KU963862_HBSP_P-RF-CB of FT:mat_peptide KU963862_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVKNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963863_HBSP_P-RF-CB Product feature CHAIN KU963863_HBSP_P-RF-CB of FT:mat_peptide KU963863_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963864_HBSP_P-RF-CB Product feature CHAIN KU963864_HBSP_P-RF-CB of FT:mat_peptide KU963864_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963865_HBSP_P-RF-CB Product feature CHAIN KU963865_HBSP_P-RF-CB of FT:mat_peptide KU963865_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963866_HBSP_P-RF-CB Product feature CHAIN KU963866_HBSP_P-RF-CB of FT:mat_peptide KU963866_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963867_HBSP_P-RF-CB Product feature CHAIN KU963867_HBSP_P-RF-CB of FT:mat_peptide KU963867_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963868_HBSP_P-RF-CB Product feature CHAIN KU963868_HBSP_P-RF-CB of FT:mat_peptide KU963868_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963869_HBSP_P-RF-CB Product feature CHAIN KU963869_HBSP_P-RF-CB of FT:mat_peptide KU963869_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963870_HBSP_P-RF-CB Product feature CHAIN KU963870_HBSP_P-RF-CB of FT:mat_peptide KU963870_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963883_HBSP_P-RF-CB Product feature CHAIN KU963883_HBSP_P-RF-CB of FT:mat_peptide KU963883_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 6_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963930_HBSP_P-RF-CB Product feature CHAIN KU963930_HBSP_P-RF-CB of FT:mat_peptide KU963930_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963931_HBSP_P-RF-CB Product feature CHAIN KU963931_HBSP_P-RF-CB of FT:mat_peptide KU963931_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_2). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963932_HBSP_P-RF-CB Product feature CHAIN KU963932_HBSP_P-RF-CB of FT:mat_peptide KU963932_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_3). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963933_HBSP_P-RF-CB Product feature CHAIN KU963933_HBSP_P-RF-CB of FT:mat_peptide KU963933_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_4). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963934_HBSP_P-RF-CB Product feature CHAIN KU963934_HBSP_P-RF-CB of FT:mat_peptide KU963934_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_5). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963935_HBSP_P-RF-CB Product feature CHAIN KU963935_HBSP_P-RF-CB of FT:mat_peptide KU963935_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_6). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963936_HBSP_P-RF-CB Product feature CHAIN KU963936_HBSP_P-RF-CB of FT:mat_peptide KU963936_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963938_HBSP_P-RF-CB Product feature CHAIN KU963938_HBSP_P-RF-CB of FT:mat_peptide KU963938_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_9). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963939_HBSP_P-RF-CB Product feature CHAIN KU963939_HBSP_P-RF-CB of FT:mat_peptide KU963939_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_10). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963940_HBSP_P-RF-CB Product feature CHAIN KU963940_HBSP_P-RF-CB of FT:mat_peptide KU963940_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_11). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963941_HBSP_P-RF-CB Product feature CHAIN KU963941_HBSP_P-RF-CB of FT:mat_peptide KU963941_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_12). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963942_HBSP_P-RF-CB Product feature CHAIN KU963942_HBSP_P-RF-CB of FT:mat_peptide KU963942_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_13). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963943_HBSP_P-RF-CB Product feature CHAIN KU963943_HBSP_P-RF-CB of FT:mat_peptide KU963943_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_14). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963944_HBSP_P-RF-CB Product feature CHAIN KU963944_HBSP_P-RF-CB of FT:mat_peptide KU963944_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_15). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHHGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963990_HBSP_P-RF-CB Product feature CHAIN KU963990_HBSP_P-RF-CB of FT:mat_peptide KU963990_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963991_HBSP_P-RF-CB Product feature CHAIN KU963991_HBSP_P-RF-CB of FT:mat_peptide KU963991_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963993_HBSP_P-RF-CB Product feature CHAIN KU963993_HBSP_P-RF-CB of FT:mat_peptide KU963993_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963994_HBSP_P-RF-CB Product feature CHAIN KU963994_HBSP_P-RF-CB of FT:mat_peptide KU963994_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963995_HBSP_P-RF-CB Product feature CHAIN KU963995_HBSP_P-RF-CB of FT:mat_peptide KU963995_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963998_HBSP_P-RF-CB Product feature CHAIN KU963998_HBSP_P-RF-CB of FT:mat_peptide KU963998_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU963999_HBSP_P-RF-CB Product feature CHAIN KU963999_HBSP_P-RF-CB of FT:mat_peptide KU963999_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964001_HBSP_P-RF-CB Product feature CHAIN KU964001_HBSP_P-RF-CB of FT:mat_peptide KU964001_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964003_HBSP_P-RF-CB Product feature CHAIN KU964003_HBSP_P-RF-CB of FT:mat_peptide KU964003_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964005_HBSP_P-RF-CB Product feature CHAIN KU964005_HBSP_P-RF-CB of FT:mat_peptide KU964005_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964006_HBSP_P-RF-CB Product feature CHAIN KU964006_HBSP_P-RF-CB of FT:mat_peptide KU964006_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964007_HBSP_P-RF-CB Product feature CHAIN KU964007_HBSP_P-RF-CB of FT:mat_peptide KU964007_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964008_HBSP_P-RF-CB Product feature CHAIN KU964008_HBSP_P-RF-CB of FT:mat_peptide KU964008_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964009_HBSP_P-RF-CB Product feature CHAIN KU964009_HBSP_P-RF-CB of FT:mat_peptide KU964009_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964010_HBSP_P-RF-CB Product feature CHAIN KU964010_HBSP_P-RF-CB of FT:mat_peptide KU964010_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964303_HBSP_P-RF-CB Product feature CHAIN KU964303_HBSP_P-RF-CB of FT:mat_peptide KU964303_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964304_HBSP_P-RF-CB Product feature CHAIN KU964304_HBSP_P-RF-CB of FT:mat_peptide KU964304_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964305_HBSP_P-RF-CB Product feature CHAIN KU964305_HBSP_P-RF-CB of FT:mat_peptide KU964305_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964306_HBSP_P-RF-CB Product feature CHAIN KU964306_HBSP_P-RF-CB of FT:mat_peptide KU964306_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964307_HBSP_P-RF-CB Product feature CHAIN KU964307_HBSP_P-RF-CB of FT:mat_peptide KU964307_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964308_HBSP_P-RF-CB Product feature CHAIN KU964308_HBSP_P-RF-CB of FT:mat_peptide KU964308_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964309_HBSP_P-RF-CB Product feature CHAIN KU964309_HBSP_P-RF-CB of FT:mat_peptide KU964309_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964310_HBSP_P-RF-CB Product feature CHAIN KU964310_HBSP_P-RF-CB of FT:mat_peptide KU964310_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964311_HBSP_P-RF-CB Product feature CHAIN KU964311_HBSP_P-RF-CB of FT:mat_peptide KU964311_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964312_HBSP_P-RF-CB Product feature CHAIN KU964312_HBSP_P-RF-CB of FT:mat_peptide KU964312_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964313_HBSP_P-RF-CB Product feature CHAIN KU964313_HBSP_P-RF-CB of FT:mat_peptide KU964313_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLREPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964314_HBSP_P-RF-CB Product feature CHAIN KU964314_HBSP_P-RF-CB of FT:mat_peptide KU964314_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964315_HBSP_P-RF-CB Product feature CHAIN KU964315_HBSP_P-RF-CB of FT:mat_peptide KU964315_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964316_HBSP_P-RF-CB Product feature CHAIN KU964316_HBSP_P-RF-CB of FT:mat_peptide KU964316_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964317_HBSP_P-RF-CB Product feature CHAIN KU964317_HBSP_P-RF-CB of FT:mat_peptide KU964317_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964351_HBSP_P-RF-CB Product feature CHAIN KU964351_HBSP_P-RF-CB of FT:mat_peptide KU964351_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 39_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|KU964366_HBSP_P-RF-DC Product feature CHAIN KU964366_HBSP_P-RF-DC of FT:mat_peptide KU964366_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_1). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU964367_HBSP_P-RF-DC Product feature CHAIN KU964367_HBSP_P-RF-DC of FT:mat_peptide KU964367_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_2). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRT
EIAPVFPSHHFGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU964370_HBSP_P-RF-DC Product feature CHAIN KU964370_HBSP_P-RF-DC of FT:mat_peptide KU964370_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_5). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU964372_HBSP_P-RF-DC Product feature CHAIN KU964372_HBSP_P-RF-DC of FT:mat_peptide KU964372_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_7). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU964374_HBSP_P-RF-DC Product feature CHAIN KU964374_HBSP_P-RF-DC of FT:mat_peptide KU964374_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_9). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU964379_HBSP_P-RF-DC Product feature CHAIN KU964379_HBSP_P-RF-DC of FT:mat_peptide KU964379_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_14). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU964380_HBSP_P-RF-DC Product feature CHAIN KU964380_HBSP_P-RF-DC of FT:mat_peptide KU964380_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_15). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX096713_HBSP_P-RF-CA Product feature CHAIN KX096713_HBSP_P-RF-CA of FT:mat_peptide KX096713_HBSP_P-RF-CA of [Viruses] Hepatitis B Virus recombinant form CA. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQLPARDHAKPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KX354997_HBSP_P-RF-DC Product feature CHAIN KX354997_HBSP_P-RF-DC of FT:mat_peptide KX354997_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate B118_2012_CD). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX357623_HBSP_P-RF-DE Product feature CHAIN KX357623_HBSP_P-RF-DE of FT:mat_peptide KX357623_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL43ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357624_HBSP_P-RF-DE Product feature CHAIN KX357624_HBSP_P-RF-DE of FT:mat_peptide KX357624_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GD65ETH). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357625_HBSP_P-RF-DE Product feature CHAIN KX357625_HBSP_P-RF-DE of FT:mat_peptide KX357625_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL60ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357626_HBSP_P-RF-DE Product feature CHAIN KX357626_HBSP_P-RF-DE of FT:mat_peptide KX357626_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA164ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357627_HBSP_P-RF-DE Product feature CHAIN KX357627_HBSP_P-RF-DE of FT:mat_peptide KX357627_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MK75ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357628_HBSP_P-RF-DE Product feature CHAIN KX357628_HBSP_P-RF-DE of FT:mat_peptide KX357628_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL70ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQLPARDHAEPARLLLKAPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357629_HBSP_P-RF-DE Product feature CHAIN KX357629_HBSP_P-RF-DE of FT:mat_peptide KX357629_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL63ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357630_HBSP_P-RF-DE Product feature CHAIN KX357630_HBSP_P-RF-DE of FT:mat_peptide KX357630_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA124ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357631_HBSP_P-RF-DE Product feature CHAIN KX357631_HBSP_P-RF-DE of FT:mat_peptide KX357631_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MK152ETH). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357632_HBSP_P-RF-DE Product feature CHAIN KX357632_HBSP_P-RF-DE of FT:mat_peptide KX357632_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA141ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357633_HBSP_P-RF-DE Product feature CHAIN KX357633_HBSP_P-RF-DE of FT:mat_peptide KX357633_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GD69ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357634_HBSP_P-RF-DE Product feature CHAIN KX357634_HBSP_P-RF-DE of FT:mat_peptide KX357634_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA33ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357635_HBSP_P-RF-DE Product feature CHAIN KX357635_HBSP_P-RF-DE of FT:mat_peptide KX357635_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GD39ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357636_HBSP_P-RF-DE Product feature CHAIN KX357636_HBSP_P-RF-DE of FT:mat_peptide KX357636_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MK74ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX357641_HBSP_P-RF-DE Product feature CHAIN KX357641_HBSP_P-RF-DE of FT:mat_peptide KX357641_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MK141ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLFLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHARPARLLLKAXLCFPHVAVPNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX660674_HBSP_P-RF-DC Product feature CHAIN KX660674_HBSP_P-RF-DC of FT:mat_peptide KX660674_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX660675_HBSP_P-RF-DC Product feature CHAIN KX660675_HBSP_P-RF-DC of FT:mat_peptide KX660675_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX660677_HBSP_P-RF-DC Product feature CHAIN KX660677_HBSP_P-RF-DC of FT:mat_peptide KX660677_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX660680_HBSP_P-RF-DC Product feature CHAIN KX660680_HBSP_P-RF-DC of FT:mat_peptide KX660680_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEEXPRXADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX660682_HBSP_P-RF-DC Product feature CHAIN KX660682_HBSP_P-RF-DC of FT:mat_peptide KX660682_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLahsa). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSXY
>gnl|hbvpro|KX660684_HBSP_P-RF-DC Product feature CHAIN KX660684_HBSP_P-RF-DC of FT:mat_peptide KX660684_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetShannan-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLVDDEAGPLEDELPRLADEGLNRRVAKDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX660685_HBSP_P-RF-DC Product feature CHAIN KX660685_HBSP_P-RF-DC of FT:mat_peptide KX660685_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetShannan-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADKGLNRRVAKDLDLGNLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRT
EIAPVFPSHHPGLSENYYGSGPQPVSLGSVY
>gnl|hbvpro|KX660686_HBSP_P-RF-DC Product feature CHAIN KX660686_HBSP_P-RF-DC of FT:mat_peptide KX660686_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetRikaze-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRK
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX660689_HBSP_P-RF-DC Product feature CHAIN KX660689_HBSP_P-RF-DC of FT:mat_peptide KX660689_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetRikaze-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQDFRKLLLLDDEAGPLEDELPRLADEDLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KX765835_HBSP_P-RF-GC Product feature CHAIN KX765835_HBSP_P-RF-GC of FT:mat_peptide KX765835_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate PID:0725). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPVRDPAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KX827299_HBSP_P-RF-DE Product feature CHAIN KX827299_HBSP_P-RF-DE of FT:mat_peptide KX827299_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate geno20.11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGGGPQPVSPGSVY
>gnl|hbvpro|KX827302_HBSP_P-RF-DE Product feature CHAIN KX827302_HBSP_P-RF-DE of FT:mat_peptide KX827302_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate geno31.9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KY363262_HBSP_P-RF-CB Product feature CHAIN KY363262_HBSP_P-RF-CB of FT:mat_peptide KY363262_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate geno6.1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KY363263_HBSP_P-RF-CB Product feature CHAIN KY363263_HBSP_P-RF-CB of FT:mat_peptide KY363263_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPAWDHARPAQLLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KY470843_HBSP_P-RF-DC Product feature CHAIN KY470843_HBSP_P-RF-DC of FT:mat_peptide KY470843_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-10-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRS
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470844_HBSP_P-RF-DC Product feature CHAIN KY470844_HBSP_P-RF-DC of FT:mat_peptide KY470844_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-109). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKTPLCIPPVAVQNLRP
EIAPVFPSHHPGLSENSYGSGPQPVSLGPVY
>gnl|hbvpro|KY470845_HBSP_P-RF-DC Product feature CHAIN KY470845_HBSP_P-RF-DC of FT:mat_peptide KY470845_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-113). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470846_HBSP_P-RF-DC Product feature CHAIN KY470846_HBSP_P-RF-DC of FT:mat_peptide KY470846_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-118). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRS
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470847_HBSP_P-RF-DC Product feature CHAIN KY470847_HBSP_P-RF-DC of FT:mat_peptide KY470847_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-120). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRS
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470848_HBSP_P-RF-DC Product feature CHAIN KY470848_HBSP_P-RF-DC of FT:mat_peptide KY470848_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-122). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470849_HBSP_P-RF-DC Product feature CHAIN KY470849_HBSP_P-RF-DC of FT:mat_peptide KY470849_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-123). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRS
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470850_HBSP_P-RF-DC Product feature CHAIN KY470850_HBSP_P-RF-DC of FT:mat_peptide KY470850_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-124). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRS
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470851_HBSP_P-RF-DC Product feature CHAIN KY470851_HBSP_P-RF-DC of FT:mat_peptide KY470851_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-22). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470852_HBSP_P-RF-DC Product feature CHAIN KY470852_HBSP_P-RF-DC of FT:mat_peptide KY470852_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-24). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470854_HBSP_P-RF-DC Product feature CHAIN KY470854_HBSP_P-RF-DC of FT:mat_peptide KY470854_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDPAEPARLLLKTSLCIPPVAVQNLRP
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470855_HBSP_P-RF-DC Product feature CHAIN KY470855_HBSP_P-RF-DC of FT:mat_peptide KY470855_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-9-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRS
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470856_HBSP_P-RF-DC Product feature CHAIN KY470856_HBSP_P-RF-DC of FT:mat_peptide KY470856_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-X-1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRP
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY470893_HBSP_P-RF-CB Product feature CHAIN KY470893_HBSP_P-RF-CB of FT:mat_peptide KY470893_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 24-B1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|KY470996_HBSP_P-RF-GC Product feature CHAIN KY470996_HBSP_P-RF-GC of FT:mat_peptide KY470996_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-31). Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQQFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVREHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY470997_HBSP_P-RF-GC Product feature CHAIN KY470997_HBSP_P-RF-GC of FT:mat_peptide KY470997_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate LMX-C4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY470998_HBSP_P-RF-GC Product feature CHAIN KY470998_HBSP_P-RF-GC of FT:mat_peptide KY470998_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-9-1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSQHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY470999_HBSP_P-RF-GC Product feature CHAIN KY470999_HBSP_P-RF-GC of FT:mat_peptide KY470999_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate LMX4-7). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY471000_HBSP_P-RF-GC Product feature CHAIN KY471000_HBSP_P-RF-GC of FT:mat_peptide KY471000_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate LMX-6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY471001_HBSP_P-RF-GC Product feature CHAIN KY471001_HBSP_P-RF-GC of FT:mat_peptide KY471001_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-7-1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSQHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY471002_HBSP_P-RF-GC Product feature CHAIN KY471002_HBSP_P-RF-GC of FT:mat_peptide KY471002_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-6-1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY471003_HBSP_P-RF-GC Product feature CHAIN KY471003_HBSP_P-RF-GC of FT:mat_peptide KY471003_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY471004_HBSP_P-RF-GC Product feature CHAIN KY471004_HBSP_P-RF-GC of FT:mat_peptide KY471004_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-14). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY471005_HBSP_P-RF-GC Product feature CHAIN KY471005_HBSP_P-RF-GC of FT:mat_peptide KY471005_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-11). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY471006_HBSP_P-RF-GC Product feature CHAIN KY471006_HBSP_P-RF-GC of FT:mat_peptide KY471006_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-7). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY471007_HBSP_P-RF-GC Product feature CHAIN KY471007_HBSP_P-RF-GC of FT:mat_peptide KY471007_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KY629632_HBSP_P-RF-DC Product feature CHAIN KY629632_HBSP_P-RF-DC of FT:mat_peptide KY629632_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate GSK1901). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY670781_HBSP_P-RF-DC Product feature CHAIN KY670781_HBSP_P-RF-DC of FT:mat_peptide KY670781_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TYM01067). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY881840_HBSP_P-RF-CB Product feature CHAIN KY881840_HBSP_P-RF-CB of FT:mat_peptide KY881840_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient-03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|LC279263_HBSP_P-RF-CB Product feature CHAIN LC279263_HBSP_P-RF-CB of FT:mat_peptide LC279263_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_child_nail). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|LC279264_HBSP_P-RF-CB Product feature CHAIN LC279264_HBSP_P-RF-CB of FT:mat_peptide LC279264_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_hair). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|LC279265_HBSP_P-RF-CB Product feature CHAIN LC279265_HBSP_P-RF-CB of FT:mat_peptide LC279265_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_nail). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|LC279266_HBSP_P-RF-CB Product feature CHAIN LC279266_HBSP_P-RF-CB of FT:mat_peptide LC279266_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_serum). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|LC279267_HBSP_P-RF-CB Product feature CHAIN LC279267_HBSP_P-RF-CB of FT:mat_peptide LC279267_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi-child_serum). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|LC416040_HBSP_P-RF-CB Product feature CHAIN LC416040_HBSP_P-RF-CB of FT:mat_peptide LC416040_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CT_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPVLDHARPARFLLKEPLCFPHVVVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|LC458432_HBSP_P-RF-CB Product feature CHAIN LC458432_HBSP_P-RF-CB of FT:mat_peptide LC458432_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate JRC-HE02). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|M38454_HBSP_P-RF-CB Product feature CHAIN M38454_HBSP_P-RF-CB of FT:mat_peptide M38454_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXXXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLLAVQNL
RTETALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MF488702_HBSP_P-RF-DE Product feature CHAIN MF488702_HBSP_P-RF-DE of FT:mat_peptide MF488702_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-PCP015). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLKEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF488705_HBSP_P-RF-AD Product feature CHAIN MF488705_HBSP_P-RF-AD of FT:mat_peptide MF488705_HBSP_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate OHBV-PCP243). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF618346_HBSP_P-RF-DE Product feature CHAIN MF618346_HBSP_P-RF-DE of FT:mat_peptide MF618346_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-HIV076). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREHAGPARLLLEEPLCIPLVAVQNLRM
ETALVFPSHHPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF618347_HBSP_P-RF-DE Product feature CHAIN MF618347_HBSP_P-RF-DE of FT:mat_peptide MF618347_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-HIV078). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREHAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|MF925360_HBSP_P-RF-DB Product feature CHAIN MF925360_HBSP_P-RF-DB of FT:mat_peptide MF925360_HBSP_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV03). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925370_HBSP_P-RF-CB Product feature CHAIN MF925370_HBSP_P-RF-CB of FT:mat_peptide MF925370_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BD-HBV14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MF925371_HBSP_P-RF-DC Product feature CHAIN MF925371_HBSP_P-RF-DC of FT:mat_peptide MF925371_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925381_HBSP_P-RF-CB Product feature CHAIN MF925381_HBSP_P-RF-CB of FT:mat_peptide MF925381_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BD-HBV25). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQDSYGSGPQSVSPGSIY
>gnl|hbvpro|MF925382_HBSP_P-RF-CB Product feature CHAIN MF925382_HBSP_P-RF-CB of FT:mat_peptide MF925382_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BD-HBV26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARLLLKGPLCFPLVAVQNLRM
EIALVFPSHRLGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MF925384_HBSP_P-RF-DB Product feature CHAIN MF925384_HBSP_P-RF-DB of FT:mat_peptide MF925384_HBSP_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925386_HBSP_P-RF-AC Product feature CHAIN MF925386_HBSP_P-RF-AC of FT:mat_peptide MF925386_HBSP_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate BD-HBV30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MF925388_HBSP_P-RF-DC Product feature CHAIN MF925388_HBSP_P-RF-DC of FT:mat_peptide MF925388_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925389_HBSP_P-RF-DC Product feature CHAIN MF925389_HBSP_P-RF-DC of FT:mat_peptide MF925389_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV33). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAKPARFLLKEPLCFPLVAVQNLRT
EIALVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|MF925392_HBSP_P-RF-DB Product feature CHAIN MF925392_HBSP_P-RF-DB of FT:mat_peptide MF925392_HBSP_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925396_HBSP_P-RF-DC Product feature CHAIN MF925396_HBSP_P-RF-DC of FT:mat_peptide MF925396_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQYFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPAWDHAEPARPLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQSVSPGSVY
>gnl|hbvpro|MF925397_HBSP_P-RF-DC Product feature CHAIN MF925397_HBSP_P-RF-DC of FT:mat_peptide MF925397_HBSP_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925401_HBSP_P-RF-DB Product feature CHAIN MF925401_HBSP_P-RF-DB of FT:mat_peptide MF925401_HBSP_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925402_HBSP_P-RF-BD Product feature CHAIN MF925402_HBSP_P-RF-BD of FT:mat_peptide MF925402_HBSP_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate BD-HBV48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQTPAWDHAEPARLLFKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925404_HBSP_P-RF-AC Product feature CHAIN MF925404_HBSP_P-RF-AC of FT:mat_peptide MF925404_HBSP_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate BD-HBV50). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG826141_HBSP_P-RF-CB Product feature CHAIN MG826141_HBSP_P-RF-CB of FT:mat_peptide MG826141_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM57). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQLPARDHARPARLLLREPLCFPLVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG826142_HBSP_P-RF-CB Product feature CHAIN MG826142_HBSP_P-RF-CB of FT:mat_peptide MG826142_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM31H). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG826144_HBSP_P-RF-CB Product feature CHAIN MG826144_HBSP_P-RF-CB of FT:mat_peptide MG826144_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNELQLPARDHARPAQFLLKEPLCFPHVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG826145_HBSP_P-RF-BC Product feature CHAIN MG826145_HBSP_P-RF-BC of FT:mat_peptide MG826145_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEKELPRLADEDLNRRVAEDLNLGNPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG826146_HBSP_P-RF-CB Product feature CHAIN MG826146_HBSP_P-RF-CB of FT:mat_peptide MG826146_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM40H). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG826147_HBSP_P-RF-CB Product feature CHAIN MG826147_HBSP_P-RF-CB of FT:mat_peptide MG826147_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM19H). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG826148_HBSP_P-RF-CB Product feature CHAIN MG826148_HBSP_P-RF-CB of FT:mat_peptide MG826148_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM50). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNELQLPARDHARPARHLLKEPLCFPLVAVQNLRT
EIALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG826149_HBSP_P-RF-CB Product feature CHAIN MG826149_HBSP_P-RF-CB of FT:mat_peptide MG826149_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM63). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG826150_HBSP_P-RF-BC Product feature CHAIN MG826150_HBSP_P-RF-BC of FT:mat_peptide MG826150_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM15H). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRPPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG826151_HBSP_P-RF-BC Product feature CHAIN MG826151_HBSP_P-RF-BC of FT:mat_peptide MG826151_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM26H). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPPLAEEGFNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKGTLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MG893554_HBSP_P-RF-CB Product feature CHAIN MG893554_HBSP_P-RF-CB of FT:mat_peptide MG893554_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14021). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG893555_HBSP_P-RF-CB Product feature CHAIN MG893555_HBSP_P-RF-CB of FT:mat_peptide MG893555_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14022). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG893559_HBSP_P-RF-CB Product feature CHAIN MG893559_HBSP_P-RF-CB of FT:mat_peptide MG893559_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14052). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MG893561_HBSP_P-RF-CB Product feature CHAIN MG893561_HBSP_P-RF-CB of FT:mat_peptide MG893561_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14075). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFGKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|MH094410_HBSP_P-RF-BC Product feature CHAIN MH094410_HBSP_P-RF-BC of FT:mat_peptide MH094410_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J61). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH368022_HBSP_P-RF-GC Product feature CHAIN MH368022_HBSP_P-RF-GC of FT:mat_peptide MH368022_HBSP_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate 9736409). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPRPRVRDHAKPARLLLKATLCIPHVAVPNLRT
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVH
>gnl|hbvpro|MH464835_HBSP_P-RF-DE Product feature CHAIN MH464835_HBSP_P-RF-DE of FT:mat_peptide MH464835_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA113). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLVLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNL
RTEIALVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MH464846_HBSP_P-RF-DE Product feature CHAIN MH464846_HBSP_P-RF-DE of FT:mat_peptide MH464846_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA124). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNL
RTEIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MH464850_HBSP_P-RF-DA Product feature CHAIN MH464850_HBSP_P-RF-DA of FT:mat_peptide MH464850_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate MA128). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEXXAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNL
RTEIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MH464851_HBSP_P-RF-DE Product feature CHAIN MH464851_HBSP_P-RF-DE of FT:mat_peptide MH464851_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA129). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNL
RTEIAPVFPSHHPGLSETSYGSGPQPVSPGSVY
>gnl|hbvpro|MH464852_HBSP_P-RF-DE Product feature CHAIN MH464852_HBSP_P-RF-DE of FT:mat_peptide MH464852_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA130). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNL
RTEIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MH481858_HBSP_P-RF-DE Product feature CHAIN MH481858_HBSP_P-RF-DE of FT:mat_peptide MH481858_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|MH481859_HBSP_P-RF-DE Product feature CHAIN MH481859_HBSP_P-RF-DE of FT:mat_peptide MH481859_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C1). Complete genome. [Hepadnaviridae] (length=111 residues).
TPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|MH481860_HBSP_P-RF-DE Product feature CHAIN MH481860_HBSP_P-RF-DE of FT:mat_peptide MH481860_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEGLPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|MH481861_HBSP_P-RF-DE Product feature CHAIN MH481861_HBSP_P-RF-DE of FT:mat_peptide MH481861_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|MH481862_HBSP_P-RF-DE Product feature CHAIN MH481862_HBSP_P-RF-DE of FT:mat_peptide MH481862_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|MH685719_HBSP_P-RF-DE Product feature CHAIN MH685719_HBSP_P-RF-DE of FT:mat_peptide MH685719_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate E0-055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLWM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MH746811_HBSP_P-RF-BC Product feature CHAIN MH746811_HBSP_P-RF-BC of FT:mat_peptide MH746811_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPSDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH746812_HBSP_P-RF-BC Product feature CHAIN MH746812_HBSP_P-RF-BC of FT:mat_peptide MH746812_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|MH746813_HBSP_P-RF-BC Product feature CHAIN MH746813_HBSP_P-RF-BC of FT:mat_peptide MH746813_HBSP_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEKELPRLADEDLNRRVAEDLNLGNPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|MK052957_HBSP_P-RF-DE Product feature CHAIN MK052957_HBSP_P-RF-DE of FT:mat_peptide MK052957_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NP137-11). Partial genome (Contains: HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLHKEPLCIPPVAVQNLRT
EIAPVFPSRHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052967_HBSP_P-RF-BD Product feature CHAIN MK052967_HBSP_P-RF-BD of FT:mat_peptide MK052967_HBSP_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK052968_HBSP_P-RF-BD Product feature CHAIN MK052968_HBSP_P-RF-BD of FT:mat_peptide MK052968_HBSP_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRPADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK052969_HBSP_P-RF-DE Product feature CHAIN MK052969_HBSP_P-RF-DE of FT:mat_peptide MK052969_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NP137Q-8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLQT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052970_HBSP_P-RF-BD Product feature CHAIN MK052970_HBSP_P-RF-BD of FT:mat_peptide MK052970_HBSP_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADKGLNRRVTKDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK052976_HBSP_P-RF-BD Product feature CHAIN MK052976_HBSP_P-RF-BD of FT:mat_peptide MK052976_HBSP_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK321265_HBSP_P-RF-CB Product feature CHAIN MK321265_HBSP_P-RF-CB of FT:mat_peptide MK321265_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1331). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRM
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|X65259_HBSP_P-RF-DA Product feature CHAIN X65259_HBSP_P-RF-DA of FT:mat_peptide X65259_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate patient E; HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLHDEAGPLEEELPRLPDQGLNRRVAEDLNLGNLNDLQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X68292_HBSP_P-RF-DA Product feature CHAIN X68292_HBSP_P-RF-DA of FT:mat_peptide X68292_HBSP_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate Patient D, HBV subtype ayw). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDGTGPLEEELPRLADEGLNRRVAEDLNLGNLNVLQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X80925_HBSP_P-RF-DE Product feature CHAIN X80925_HBSP_P-RF-DE of FT:mat_peptide X80925_HBSP_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate patient 4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|Y18856_HBSP_P-RF-CB Product feature CHAIN Y18856_HBSP_P-RF-CB of FT:mat_peptide Y18856_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-C5). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNPRVAEDLNLGNLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRT
ETALVFPSHHPGLSQDSYGSGPQSVSPGSVY
>gnl|hbvpro|Y18857_HBSP_P-RF-CB Product feature CHAIN Y18857_HBSP_P-RF-CB of FT:mat_peptide Y18857_HBSP_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPARDLARPARFLLKEPLCFPLVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
© 1998-2019