HBVdb

Dataset for protein HBx of genotype RF

[Download (right click)] [Alignment] [Repertoires]

969 sequence(s)

>gnl|hbvpro|AB014375_HBx_P-RF-CB Product feature CHAIN AB014375_HBx_P-RF-CB of FT:mat_peptide AB014375_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 16T01HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB031265_HBx_P-RF-CB Product feature CHAIN AB031265_HBx_P-RF-CB of FT:mat_peptide AB031265_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV VietF-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033557_HBx_P-RF-CB Product feature CHAIN AB033557_HBx_P-RF-CB of FT:mat_peptide AB033557_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IWK146). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033558_HBx_P-RF-DE Product feature CHAIN AB033558_HBx_P-RF-DE of FT:mat_peptide AB033558_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate JYW796). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB033559_HBx_P-RF-DE Product feature CHAIN AB033559_HBx_P-RF-DE of FT:mat_peptide AB033559_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate PYW310). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB048702_HBx_P-RF-DE Product feature CHAIN AB048702_HBx_P-RF-DE of FT:mat_peptide AB048702_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB048703_HBx_P-RF-DE Product feature CHAIN AB048703_HBx_P-RF-DE of FT:mat_peptide AB048703_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB049609_HBx_P-RF-CB Product feature CHAIN AB049609_HBx_P-RF-CB of FT:mat_peptide AB049609_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV AN28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSVRGLPVCAISSPGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB105172_HBx_P-RF-CB Product feature CHAIN AB105172_HBx_P-RF-CB of FT:mat_peptide AB105172_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hawaii 2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGDLPSPTSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB188243_HBx_P-RF-DE Product feature CHAIN AB188243_HBx_P-RF-DE of FT:mat_peptide AB188243_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate KAMCHATKA27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB188245_HBx_P-RF-DE Product feature CHAIN AB188245_HBx_P-RF-DE of FT:mat_peptide AB188245_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ALTAY136). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB194949_HBx_P-RF-AE Product feature CHAIN AB194949_HBx_P-RF-AE of FT:mat_peptide AB194949_HBx_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate CMR151). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPFGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB195939_HBx_P-RF-CB Product feature CHAIN AB195939_HBx_P-RF-CB of FT:mat_peptide AB195939_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195940_HBx_P-RF-CB Product feature CHAIN AB195940_HBx_P-RF-CB of FT:mat_peptide AB195940_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195941_HBx_P-RF-CB Product feature CHAIN AB195941_HBx_P-RF-CB of FT:mat_peptide AB195941_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195950_HBx_P-RF-CB Product feature CHAIN AB195950_HBx_P-RF-CB of FT:mat_peptide AB195950_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195951_HBx_P-RF-CB Product feature CHAIN AB195951_HBx_P-RF-CB of FT:mat_peptide AB195951_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195955_HBx_P-RF-CB Product feature CHAIN AB195955_HBx_P-RF-CB of FT:mat_peptide AB195955_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195956_HBx_P-RF-CB Product feature CHAIN AB195956_HBx_P-RF-CB of FT:mat_peptide AB195956_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVYSPAPCNFFTSA
>gnl|hbvpro|AB195957_HBx_P-RF-CB Product feature CHAIN AB195957_HBx_P-RF-CB of FT:mat_peptide AB195957_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVYSPAPCNFFTSA
>gnl|hbvpro|AB198084_HBx_P-RF-CB Product feature CHAIN AB198084_HBx_P-RF-CB of FT:mat_peptide AB198084_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205152_HBx_P-RF-CB Product feature CHAIN AB205152_HBx_P-RF-CB of FT:mat_peptide AB205152_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HB-JFH7-99). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB210819_HBx_P-RF-DE Product feature CHAIN AB210819_HBx_P-RF-DE of FT:mat_peptide AB210819_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB241109_HBx_P-RF-CB Product feature CHAIN AB241109_HBx_P-RF-CB of FT:mat_peptide AB241109_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate PhCH24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGALSSPSPSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270535_HBx_P-RF-DC Product feature CHAIN AB270535_HBx_P-RF-DC of FT:mat_peptide AB270535_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate MGL50F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSTRRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCXHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB270538_HBx_P-RF-DE Product feature CHAIN AB270538_HBx_P-RF-DE of FT:mat_peptide AB270538_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MGL231F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLASPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB300369_HBx_P-RF-CB Product feature CHAIN AB300369_HBx_P-RF-CB of FT:mat_peptide AB300369_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB330368_HBx_P-RF-DA Product feature CHAIN AB330368_HBx_P-RF-DA of FT:mat_peptide AB330368_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate TAJ54HBV). Complete genome. [Hepadnaviridae] (length=152 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB367393_HBx_P-RF-CB Product feature CHAIN AB367393_HBx_P-RF-CB of FT:mat_peptide AB367393_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 2/Adefovir-treated Pt. 2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGPESRGRPVSGSFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLTAMSTTDLEAYFKDCLFKNWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367400_HBx_P-RF-CB Product feature CHAIN AB367400_HBx_P-RF-CB of FT:mat_peptide AB367400_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367419_HBx_P-RF-CB Product feature CHAIN AB367419_HBx_P-RF-CB of FT:mat_peptide AB367419_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLYKRTLGLSAMSTTDLEAYFKDCLFNDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367800_HBx_P-RF-CB Product feature CHAIN AB367800_HBx_P-RF-CB of FT:mat_peptide AB367800_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ADVT Pt. 24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB453985_HBx_P-RF-AC Product feature CHAIN AB453985_HBx_P-RF-AC of FT:mat_peptide AB453985_HBx_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate JPN_CH7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|AB493837_HBx_P-RF-CB Product feature CHAIN AB493837_HBx_P-RF-CB of FT:mat_peptide AB493837_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 03UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPTGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493838_HBx_P-RF-CB Product feature CHAIN AB493838_HBx_P-RF-CB of FT:mat_peptide AB493838_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 06UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493840_HBx_P-RF-CB Product feature CHAIN AB493840_HBx_P-RF-CB of FT:mat_peptide AB493840_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 16UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493842_HBx_P-RF-CB Product feature CHAIN AB493842_HBx_P-RF-CB of FT:mat_peptide AB493842_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 31UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYGAHLSLRGLPVCAFSSADPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|AB493847_HBx_P-RF-CB Product feature CHAIN AB493847_HBx_P-RF-CB of FT:mat_peptide AB493847_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 05UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB583679_HBx_P-RF-DE Product feature CHAIN AB583679_HBx_P-RF-DE of FT:mat_peptide AB583679_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Pkst8134). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTVTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB642096_HBx_P-RF-CB Product feature CHAIN AB642096_HBx_P-RF-CB of FT:mat_peptide AB642096_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BFJT2000-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPFGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670303_HBx_P-RF-CB Product feature CHAIN AB670303_HBx_P-RF-CB of FT:mat_peptide AB670303_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Non-HCC pt No.30). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB674412_HBx_P-RF-DE Product feature CHAIN AB674412_HBx_P-RF-DE of FT:mat_peptide AB674412_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GaziantepHCCC6). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSACHME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVRAPAPCNFFTSA
>gnl|hbvpro|AB674432_HBx_P-RF-DE Product feature CHAIN AB674432_HBx_P-RF-DE of FT:mat_peptide AB674432_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SamsunD90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674433_HBx_P-RF-DE Product feature CHAIN AB674433_HBx_P-RF-DE of FT:mat_peptide AB674433_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SamsunD37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674436_HBx_P-RF-DE Product feature CHAIN AB674436_HBx_P-RF-DE of FT:mat_peptide AB674436_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SamsunD5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674504_HBx_P-RF-DC Product feature CHAIN AB674504_HBx_P-RF-DC of FT:mat_peptide AB674504_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 11B18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB933279_HBx_P-RF-AG Product feature CHAIN AB933279_HBx_P-RF-AG of FT:mat_peptide AB933279_HBx_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Os/JP/2008). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB933280_HBx_P-RF-AG Product feature CHAIN AB933280_HBx_P-RF-AG of FT:mat_peptide AB933280_HBx_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Tk/JP/2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB933281_HBx_P-RF-AG Product feature CHAIN AB933281_HBx_P-RF-AG of FT:mat_peptide AB933281_HBx_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Os/JP/2010). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB933282_HBx_P-RF-AG Product feature CHAIN AB933282_HBx_P-RF-AG of FT:mat_peptide AB933282_HBx_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Os/JP/2011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB933283_HBx_P-RF-AG Product feature CHAIN AB933283_HBx_P-RF-AG of FT:mat_peptide AB933283_HBx_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate Os/JP/2013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPXDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF233236_HBx_P-RF-CB Product feature CHAIN AF233236_HBx_P-RF-CB of FT:mat_peptide AF233236_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV334). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTNDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF297619_HBx_P-RF-DA Product feature CHAIN AF297619_HBx_P-RF-DA of FT:mat_peptide AF297619_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate 41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHGAHLSLRRLPVCAFSSAGPCTLRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297620_HBx_P-RF-DA Product feature CHAIN AF297620_HBx_P-RF-DA of FT:mat_peptide AF297620_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate 57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF330110_HBx_P-RF-CB Product feature CHAIN AF330110_HBx_P-RF-CB of FT:mat_peptide AF330110_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 975484). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF411409_HBx_P-RF-CB Product feature CHAIN AF411409_HBx_P-RF-CB of FT:mat_peptide AF411409_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF461361_HBx_P-RF-CB Product feature CHAIN AF461361_HBx_P-RF-CB of FT:mat_peptide AF461361_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate FH3Q). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCIFLTSA
>gnl|hbvpro|AJ344117_HBx_P-RF-DE Product feature CHAIN AJ344117_HBx_P-RF-DE of FT:mat_peptide AJ344117_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLRGCMHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627217_HBx_P-RF-DE Product feature CHAIN AJ627217_HBx_P-RF-DE of FT:mat_peptide AJ627217_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 20953). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627221_HBx_P-RF-DE Product feature CHAIN AJ627221_HBx_P-RF-DE of FT:mat_peptide AJ627221_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 30125). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM494716_HBx_P-RF-DE Product feature CHAIN AM494716_HBx_P-RF-DE of FT:mat_peptide AM494716_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate CAR175). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AP011102_HBx_P-RF-CB Product feature CHAIN AP011102_HBx_P-RF-CB of FT:mat_peptide AP011102_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGGLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011103_HBx_P-RF-CB Product feature CHAIN AP011103_HBx_P-RF-CB of FT:mat_peptide AP011103_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011104_HBx_P-RF-CB Product feature CHAIN AP011104_HBx_P-RF-CB of FT:mat_peptide AP011104_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011105_HBx_P-RF-CB Product feature CHAIN AP011105_HBx_P-RF-CB of FT:mat_peptide AP011105_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AP011108_HBx_P-RF-CB Product feature CHAIN AP011108_HBx_P-RF-CB of FT:mat_peptide AP011108_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTSRDVLCLRPVGAESRGRPVSGPFVPLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY040627_HBx_P-RF-CB Product feature CHAIN AY040627_HBx_P-RF-CB of FT:mat_peptide AY040627_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPTAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY057948_HBx_P-RF-DC Product feature CHAIN AY057948_HBx_P-RF-DC of FT:mat_peptide AY057948_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTFARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY123041_HBx_P-RF-CB Product feature CHAIN AY123041_HBx_P-RF-CB of FT:mat_peptide AY123041_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSLAFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNGHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY123424_HBx_P-RF-CB Product feature CHAIN AY123424_HBx_P-RF-CB of FT:mat_peptide AY123424_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY161140_HBx_P-RF-AD Product feature CHAIN AY161140_HBx_P-RF-AD of FT:mat_peptide AY161140_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHGEHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPRVLHKRTLGLSAMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161141_HBx_P-RF-AD Product feature CHAIN AY161141_HBx_P-RF-AD of FT:mat_peptide AY161141_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHGEHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPRVLHKRTLGLSAMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161145_HBx_P-RF-AD Product feature CHAIN AY161145_HBx_P-RF-AD of FT:mat_peptide AY161145_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161146_HBx_P-RF-AD Product feature CHAIN AY161146_HBx_P-RF-AD of FT:mat_peptide AY161146_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAIPSDHGVHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161147_HBx_P-RF-DA Product feature CHAIN AY161147_HBx_P-RF-DA of FT:mat_peptide AY161147_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVQYDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVSHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY167095_HBx_P-RF-CB Product feature CHAIN AY167095_HBx_P-RF-CB of FT:mat_peptide AY167095_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IIc). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206374_HBx_P-RF-CB Product feature CHAIN AY206374_HBx_P-RF-CB of FT:mat_peptide AY206374_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGDLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY233277_HBx_P-RF-AC Product feature CHAIN AY233277_HBx_P-RF-AC of FT:mat_peptide AY233277_HBx_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate 1848). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY233293_HBx_P-RF-DE Product feature CHAIN AY233293_HBx_P-RF-DE of FT:mat_peptide AY233293_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHGAHLSLRGLPICAFSSAGPCALRFTSARGME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCMFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233295_HBx_P-RF-DE Product feature CHAIN AY233295_HBx_P-RF-DE of FT:mat_peptide AY233295_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY236161_HBx_P-RF-DA Product feature CHAIN AY236161_HBx_P-RF-DA of FT:mat_peptide AY236161_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate 12A). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCARRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY247030_HBx_P-RF-CB Product feature CHAIN AY247030_HBx_P-RF-CB of FT:mat_peptide AY247030_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate KUHB81). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AY341335_HBx_P-RF-DE Product feature CHAIN AY341335_HBx_P-RF-DE of FT:mat_peptide AY341335_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY373430_HBx_P-RF-DE Product feature CHAIN AY373430_HBx_P-RF-DE of FT:mat_peptide AY373430_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHNRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY800249_HBx_P-RF-DC Product feature CHAIN AY800249_HBx_P-RF-DC of FT:mat_peptide AY800249_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY817509_HBx_P-RF-DC Product feature CHAIN AY817509_HBx_P-RF-DC of FT:mat_peptide AY817509_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L28). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY817510_HBx_P-RF-DC Product feature CHAIN AY817510_HBx_P-RF-DC of FT:mat_peptide AY817510_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGSLPSPSSSAVPAAHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNVHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY817511_HBx_P-RF-DC Product feature CHAIN AY817511_HBx_P-RF-DC of FT:mat_peptide AY817511_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY817512_HBx_P-RF-DC Product feature CHAIN AY817512_HBx_P-RF-DC of FT:mat_peptide AY817512_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSCSAVPAHHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY817515_HBx_P-RF-DC Product feature CHAIN AY817515_HBx_P-RF-DC of FT:mat_peptide AY817515_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY862864_HBx_P-RF-DC Product feature CHAIN AY862864_HBx_P-RF-DC of FT:mat_peptide AY862864_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY862865_HBx_P-RF-DC Product feature CHAIN AY862865_HBx_P-RF-DC of FT:mat_peptide AY862865_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3-2nd). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAHFKDCVFKDWEELGEEIRLMIFVQGGCRHKLVCSPAPCFFFTSA
>gnl|hbvpro|AY862866_HBx_P-RF-DC Product feature CHAIN AY862866_HBx_P-RF-DC of FT:mat_peptide AY862866_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3-2nd). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHGARLSLRGLPVCAFSSAGPCAPRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089798_HBx_P-RF-CB Product feature CHAIN DQ089798_HBx_P-RF-CB of FT:mat_peptide DQ089798_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HK477). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ111987_HBx_P-RF-DE Product feature CHAIN DQ111987_HBx_P-RF-DE of FT:mat_peptide DQ111987_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MMU36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ315777_HBx_P-RF-DE Product feature CHAIN DQ315777_HBx_P-RF-DE of FT:mat_peptide DQ315777_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EI03194). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ315779_HBx_P-RF-DE Product feature CHAIN DQ315779_HBx_P-RF-DE of FT:mat_peptide DQ315779_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EI0399). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ315780_HBx_P-RF-DE Product feature CHAIN DQ315780_HBx_P-RF-DE of FT:mat_peptide DQ315780_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EI02456). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILYKRTLGLSAMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464164_HBx_P-RF-DE Product feature CHAIN DQ464164_HBx_P-RF-DE of FT:mat_peptide DQ464164_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=155 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTFAQ
>gnl|hbvpro|DQ464165_HBx_P-RF-DE Product feature CHAIN DQ464165_HBx_P-RF-DE of FT:mat_peptide DQ464165_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464166_HBx_P-RF-DE Product feature CHAIN DQ464166_HBx_P-RF-DE of FT:mat_peptide DQ464166_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464167_HBx_P-RF-DE Product feature CHAIN DQ464167_HBx_P-RF-DE of FT:mat_peptide DQ464167_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ478886_HBx_P-RF-DC Product feature CHAIN DQ478886_HBx_P-RF-DC of FT:mat_peptide DQ478886_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPPSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478887_HBx_P-RF-DC Product feature CHAIN DQ478887_HBx_P-RF-DC of FT:mat_peptide DQ478887_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478889_HBx_P-RF-DC Product feature CHAIN DQ478889_HBx_P-RF-DC of FT:mat_peptide DQ478889_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTIGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478890_HBx_P-RF-DC Product feature CHAIN DQ478890_HBx_P-RF-DC of FT:mat_peptide DQ478890_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478892_HBx_P-RF-DC Product feature CHAIN DQ478892_HBx_P-RF-DC of FT:mat_peptide DQ478892_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478897_HBx_P-RF-DC Product feature CHAIN DQ478897_HBx_P-RF-DC of FT:mat_peptide DQ478897_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478898_HBx_P-RF-DC Product feature CHAIN DQ478898_HBx_P-RF-DC of FT:mat_peptide DQ478898_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ991753_HBx_P-RF-DE Product feature CHAIN DQ991753_HBx_P-RF-DE of FT:mat_peptide DQ991753_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Irish-13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRSLPKVLCKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPIPCNFFTSA
>gnl|hbvpro|EF103282_HBx_P-RF-AD Product feature CHAIN EF103282_HBx_P-RF-AD of FT:mat_peptide EF103282_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate Ran103). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|EF103283_HBx_P-RF-AD Product feature CHAIN EF103283_HBx_P-RF-AD of FT:mat_peptide EF103283_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate Ran105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF103284_HBx_P-RF-AD Product feature CHAIN EF103284_HBx_P-RF-AD of FT:mat_peptide EF103284_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate Ran113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF103285_HBx_P-RF-DE Product feature CHAIN EF103285_HBx_P-RF-DE of FT:mat_peptide EF103285_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ran128). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF494376_HBx_P-RF-CA Product feature CHAIN EF494376_HBx_P-RF-CA of FT:mat_peptide EF494376_HBx_P-RF-CA of [Viruses] Hepatitis B Virus recombinant form CA (isolate TW706). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSTAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF494378_HBx_P-RF-CA Product feature CHAIN EF494378_HBx_P-RF-CA of FT:mat_peptide EF494378_HBx_P-RF-CA of [Viruses] Hepatitis B Virus recombinant form CA (isolate TW1244). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFPSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185780_HBx_P-RF-AD Product feature CHAIN EU185780_HBx_P-RF-AD of FT:mat_peptide EU185780_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate H-IDU7 (Rec.Arg-1)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCXRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPXALXFTSARRME
TTVNAHRMLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU522070_HBx_P-RF-CB Product feature CHAIN EU522070_HBx_P-RF-CB of FT:mat_peptide EU522070_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient 7N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSVSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU589337_HBx_P-RF-CB Product feature CHAIN EU589337_HBx_P-RF-CB of FT:mat_peptide EU589337_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S710-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU589339_HBx_P-RF-CB Product feature CHAIN EU589339_HBx_P-RF-CB of FT:mat_peptide EU589339_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S1556-11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU594406_HBx_P-RF-DE Product feature CHAIN EU594406_HBx_P-RF-DE of FT:mat_peptide EU594406_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594435_HBx_P-RF-DE Product feature CHAIN EU594435_HBx_P-RF-DE of FT:mat_peptide EU594435_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594436_HBx_P-RF-DE Product feature CHAIN EU594436_HBx_P-RF-DE of FT:mat_peptide EU594436_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHCILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU660227_HBx_P-RF-BC Product feature CHAIN EU660227_HBx_P-RF-BC of FT:mat_peptide EU660227_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate HBV-14N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU717211_HBx_P-RF-CB Product feature CHAIN EU717211_HBx_P-RF-CB of FT:mat_peptide EU717211_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D23K-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU787434_HBx_P-RF-DC Product feature CHAIN EU787434_HBx_P-RF-DC of FT:mat_peptide EU787434_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRIMIFELGRCTHTLHCSPEPCNFFTSA
>gnl|hbvpro|EU787435_HBx_P-RF-DC Product feature CHAIN EU787435_HBx_P-RF-DC of FT:mat_peptide EU787435_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU787444_HBx_P-RF-CB Product feature CHAIN EU787444_HBx_P-RF-CB of FT:mat_peptide EU787444_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate W41). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU833889_HBx_P-RF-GA Product feature CHAIN EU833889_HBx_P-RF-GA of FT:mat_peptide EU833889_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate 5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU833890_HBx_P-RF-GA Product feature CHAIN EU833890_HBx_P-RF-GA of FT:mat_peptide EU833890_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate 6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFRDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPSNFFTSA
>gnl|hbvpro|EU833891_HBx_P-RF-GC Product feature CHAIN EU833891_HBx_P-RF-GC of FT:mat_peptide EU833891_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H4536/07). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDHARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU835240_HBx_P-RF-GC Product feature CHAIN EU835240_HBx_P-RF-GC of FT:mat_peptide EU835240_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate IND-DIB112). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSPSSSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLTLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871981_HBx_P-RF-CB Product feature CHAIN EU871981_HBx_P-RF-CB of FT:mat_peptide EU871981_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 318-95-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWGELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871983_HBx_P-RF-CB Product feature CHAIN EU871983_HBx_P-RF-CB of FT:mat_peptide EU871983_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 318-97-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCASPSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871984_HBx_P-RF-CB Product feature CHAIN EU871984_HBx_P-RF-CB of FT:mat_peptide EU871984_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-00-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871985_HBx_P-RF-CB Product feature CHAIN EU871985_HBx_P-RF-CB of FT:mat_peptide EU871985_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-00-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871986_HBx_P-RF-CB Product feature CHAIN EU871986_HBx_P-RF-CB of FT:mat_peptide EU871986_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871987_HBx_P-RF-CB Product feature CHAIN EU871987_HBx_P-RF-CB of FT:mat_peptide EU871987_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-01-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871988_HBx_P-RF-CB Product feature CHAIN EU871988_HBx_P-RF-CB of FT:mat_peptide EU871988_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-01-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871989_HBx_P-RF-CB Product feature CHAIN EU871989_HBx_P-RF-CB of FT:mat_peptide EU871989_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-03-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871990_HBx_P-RF-CB Product feature CHAIN EU871990_HBx_P-RF-CB of FT:mat_peptide EU871990_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-04-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871991_HBx_P-RF-CB Product feature CHAIN EU871991_HBx_P-RF-CB of FT:mat_peptide EU871991_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-04-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871992_HBx_P-RF-CB Product feature CHAIN EU871992_HBx_P-RF-CB of FT:mat_peptide EU871992_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-99-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871993_HBx_P-RF-CB Product feature CHAIN EU871993_HBx_P-RF-CB of FT:mat_peptide EU871993_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-99-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871994_HBx_P-RF-CB Product feature CHAIN EU871994_HBx_P-RF-CB of FT:mat_peptide EU871994_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490A-3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHRAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871995_HBx_P-RF-CB Product feature CHAIN EU871995_HBx_P-RF-CB of FT:mat_peptide EU871995_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490A-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871996_HBx_P-RF-CB Product feature CHAIN EU871996_HBx_P-RF-CB of FT:mat_peptide EU871996_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490A-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871997_HBx_P-RF-CB Product feature CHAIN EU871997_HBx_P-RF-CB of FT:mat_peptide EU871997_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 530-00-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHGAHLSLRGLPVCAFPSAGPCALRFTSTRRME
TTVNAHQVLPKVLHKRTPGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871999_HBx_P-RF-CB Product feature CHAIN EU871999_HBx_P-RF-CB of FT:mat_peptide EU871999_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 530-00-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWGELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU872014_HBx_P-RF-CB Product feature CHAIN EU872014_HBx_P-RF-CB of FT:mat_peptide EU872014_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-96-3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU872015_HBx_P-RF-CB Product feature CHAIN EU872015_HBx_P-RF-CB of FT:mat_peptide EU872015_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-96-1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARGVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU881995_HBx_P-RF-CB Product feature CHAIN EU881995_HBx_P-RF-CB of FT:mat_peptide EU881995_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVSCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882006_HBx_P-RF-CB Product feature CHAIN EU882006_HBx_P-RF-CB of FT:mat_peptide EU882006_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFRDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916228_HBx_P-RF-CB Product feature CHAIN EU916228_HBx_P-RF-CB of FT:mat_peptide EU916228_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S7.3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916232_HBx_P-RF-CB Product feature CHAIN EU916232_HBx_P-RF-CB of FT:mat_peptide EU916232_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S8.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916239_HBx_P-RF-CB Product feature CHAIN EU916239_HBx_P-RF-CB of FT:mat_peptide EU916239_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916240_HBx_P-RF-CB Product feature CHAIN EU916240_HBx_P-RF-CB of FT:mat_peptide EU916240_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916241_HBx_P-RF-CB Product feature CHAIN EU916241_HBx_P-RF-CB of FT:mat_peptide EU916241_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919166_HBx_P-RF-CB Product feature CHAIN EU919166_HBx_P-RF-CB of FT:mat_peptide EU919166_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919167_HBx_P-RF-CB Product feature CHAIN EU919167_HBx_P-RF-CB of FT:mat_peptide EU919167_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939547_HBx_P-RF-CB Product feature CHAIN EU939547_HBx_P-RF-CB of FT:mat_peptide EU939547_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRVCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLSSPSSFAVPADLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEEVGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939551_HBx_P-RF-CB Product feature CHAIN EU939551_HBx_P-RF-CB of FT:mat_peptide EU939551_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939565_HBx_P-RF-CB Product feature CHAIN EU939565_HBx_P-RF-CB of FT:mat_peptide EU939565_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C86). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVARPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939577_HBx_P-RF-CB Product feature CHAIN EU939577_HBx_P-RF-CB of FT:mat_peptide EU939577_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C116). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTVHGENLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939581_HBx_P-RF-CB Product feature CHAIN EU939581_HBx_P-RF-CB of FT:mat_peptide EU939581_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate B16). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939589_HBx_P-RF-CB Product feature CHAIN EU939589_HBx_P-RF-CB of FT:mat_peptide EU939589_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C175). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVPRPFGTLPSPSDSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939602_HBx_P-RF-CB Product feature CHAIN EU939602_HBx_P-RF-CB of FT:mat_peptide EU939602_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C179). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939606_HBx_P-RF-CB Product feature CHAIN EU939606_HBx_P-RF-CB of FT:mat_peptide EU939606_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C206). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939620_HBx_P-RF-CB Product feature CHAIN EU939620_HBx_P-RF-CB of FT:mat_peptide EU939620_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate B140). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939621_HBx_P-RF-CB Product feature CHAIN EU939621_HBx_P-RF-CB of FT:mat_peptide EU939621_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C94). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939627_HBx_P-RF-BC Product feature CHAIN EU939627_HBx_P-RF-BC of FT:mat_peptide EU939627_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU939629_HBx_P-RF-BC Product feature CHAIN EU939629_HBx_P-RF-BC of FT:mat_peptide EU939629_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate C95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939630_HBx_P-RF-CB Product feature CHAIN EU939630_HBx_P-RF-CB of FT:mat_peptide EU939630_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTPA
>gnl|hbvpro|EU939631_HBx_P-RF-BC Product feature CHAIN EU939631_HBx_P-RF-BC of FT:mat_peptide EU939631_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate C123). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|EU939632_HBx_P-RF-CB Product feature CHAIN EU939632_HBx_P-RF-CB of FT:mat_peptide EU939632_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C130). Partial genome (Contains: HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939668_HBx_P-RF-CB Product feature CHAIN EU939668_HBx_P-RF-CB of FT:mat_peptide EU939668_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C182). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTVPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023659_HBx_P-RF-BC Product feature CHAIN FJ023659_HBx_P-RF-BC of FT:mat_peptide FJ023659_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate I1_M04-0469). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023662_HBx_P-RF-GC Product feature CHAIN FJ023662_HBx_P-RF-GC of FT:mat_peptide FJ023662_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I1_M04-3718). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023664_HBx_P-RF-GC Product feature CHAIN FJ023664_HBx_P-RF-GC of FT:mat_peptide FJ023664_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-0026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023665_HBx_P-RF-GC Product feature CHAIN FJ023665_HBx_P-RF-GC of FT:mat_peptide FJ023665_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-0033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023666_HBx_P-RF-GC Product feature CHAIN FJ023666_HBx_P-RF-GC of FT:mat_peptide FJ023666_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-1907). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023667_HBx_P-RF-GC Product feature CHAIN FJ023667_HBx_P-RF-GC of FT:mat_peptide FJ023667_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-2742). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023668_HBx_P-RF-GC Product feature CHAIN FJ023668_HBx_P-RF-GC of FT:mat_peptide FJ023668_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-3223). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023670_HBx_P-RF-GC Product feature CHAIN FJ023670_HBx_P-RF-GC of FT:mat_peptide FJ023670_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-3724). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ023673_HBx_P-RF-GC Product feature CHAIN FJ023673_HBx_P-RF-GC of FT:mat_peptide FJ023673_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-4997). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032337_HBx_P-RF-CB Product feature CHAIN FJ032337_HBx_P-RF-CB of FT:mat_peptide FJ032337_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S462-5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSV
>gnl|hbvpro|FJ032343_HBx_P-RF-CB Product feature CHAIN FJ032343_HBx_P-RF-CB of FT:mat_peptide FJ032343_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S659-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ349207_HBx_P-RF-DE Product feature CHAIN FJ349207_HBx_P-RF-DE of FT:mat_peptide FJ349207_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate H22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSPSPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349212_HBx_P-RF-DE Product feature CHAIN FJ349212_HBx_P-RF-DE of FT:mat_peptide FJ349212_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate H36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHRMLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLQIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349221_HBx_P-RF-DE Product feature CHAIN FJ349221_HBx_P-RF-DE of FT:mat_peptide FJ349221_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate H149). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVSAHLMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349241_HBx_P-RF-DC Product feature CHAIN FJ349241_HBx_P-RF-DC of FT:mat_peptide FJ349241_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate C115). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ361772_HBx_P-RF-GC Product feature CHAIN FJ361772_HBx_P-RF-GC of FT:mat_peptide FJ361772_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTDWEELGEESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386578_HBx_P-RF-CB Product feature CHAIN FJ386578_HBx_P-RF-CB of FT:mat_peptide FJ386578_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1748). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386581_HBx_P-RF-CB Product feature CHAIN FJ386581_HBx_P-RF-CB of FT:mat_peptide FJ386581_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1764). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ386585_HBx_P-RF-CB Product feature CHAIN FJ386585_HBx_P-RF-CB of FT:mat_peptide FJ386585_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1800). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386586_HBx_P-RF-CB Product feature CHAIN FJ386586_HBx_P-RF-CB of FT:mat_peptide FJ386586_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1811). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386593_HBx_P-RF-CB Product feature CHAIN FJ386593_HBx_P-RF-CB of FT:mat_peptide FJ386593_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1877). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ386633_HBx_P-RF-CB Product feature CHAIN FJ386633_HBx_P-RF-CB of FT:mat_peptide FJ386633_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2372). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIIVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386635_HBx_P-RF-CB Product feature CHAIN FJ386635_HBx_P-RF-CB of FT:mat_peptide FJ386635_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2399). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386643_HBx_P-RF-CB Product feature CHAIN FJ386643_HBx_P-RF-CB of FT:mat_peptide FJ386643_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2493). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLXKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386646_HBx_P-RF-CB Product feature CHAIN FJ386646_HBx_P-RF-CB of FT:mat_peptide FJ386646_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1716). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRBLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLDCPPAPCNFFTSA
>gnl|hbvpro|FJ386649_HBx_P-RF-CB Product feature CHAIN FJ386649_HBx_P-RF-CB of FT:mat_peptide FJ386649_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2422). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386674_HBx_P-RF-BC Product feature CHAIN FJ386674_HBx_P-RF-BC of FT:mat_peptide FJ386674_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate S659). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVIAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPLPCNFFTSA
>gnl|hbvpro|FJ562223_HBx_P-RF-CD Product feature CHAIN FJ562223_HBx_P-RF-CD of FT:mat_peptide FJ562223_HBx_P-RF-CD of [Viruses] Hepatitis B Virus recombinant form CD (isolate I15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGILSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ562226_HBx_P-RF-CB Product feature CHAIN FJ562226_HBx_P-RF-CB of FT:mat_peptide FJ562226_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562227_HBx_P-RF-CB Product feature CHAIN FJ562227_HBx_P-RF-CB of FT:mat_peptide FJ562227_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKXVCSPAPCNFFTSA
>gnl|hbvpro|FJ562229_HBx_P-RF-CB Product feature CHAIN FJ562229_HBx_P-RF-CB of FT:mat_peptide FJ562229_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I36). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSSAPCNFFTSA
>gnl|hbvpro|FJ562247_HBx_P-RF-CB Product feature CHAIN FJ562247_HBx_P-RF-CB of FT:mat_peptide FJ562247_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVVHNRTLGVSSMSTTNLDAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562263_HBx_P-RF-DC Product feature CHAIN FJ562263_HBx_P-RF-DC of FT:mat_peptide FJ562263_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562267_HBx_P-RF-CB Product feature CHAIN FJ562267_HBx_P-RF-CB of FT:mat_peptide FJ562267_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDTARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEDLGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562271_HBx_P-RF-CB Product feature CHAIN FJ562271_HBx_P-RF-CB of FT:mat_peptide FJ562271_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I124). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562277_HBx_P-RF-CB Product feature CHAIN FJ562277_HBx_P-RF-CB of FT:mat_peptide FJ562277_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I134). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562278_HBx_P-RF-DC Product feature CHAIN FJ562278_HBx_P-RF-DC of FT:mat_peptide FJ562278_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562287_HBx_P-RF-CB Product feature CHAIN FJ562287_HBx_P-RF-CB of FT:mat_peptide FJ562287_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I151). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPTPSNFFTFA
>gnl|hbvpro|FJ562294_HBx_P-RF-CB Product feature CHAIN FJ562294_HBx_P-RF-CB of FT:mat_peptide FJ562294_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I168). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562302_HBx_P-RF-CB Product feature CHAIN FJ562302_HBx_P-RF-CB of FT:mat_peptide FJ562302_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I186). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPALDVLCLRPVSAESRGRSLSGRFGTLPSPCSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ562305_HBx_P-RF-CB Product feature CHAIN FJ562305_HBx_P-RF-CB of FT:mat_peptide FJ562305_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I191). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLXKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562314_HBx_P-RF-CB Product feature CHAIN FJ562314_HBx_P-RF-CB of FT:mat_peptide FJ562314_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I206). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562317_HBx_P-RF-CB Product feature CHAIN FJ562317_HBx_P-RF-CB of FT:mat_peptide FJ562317_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I209). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPSGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562328_HBx_P-RF-CB Product feature CHAIN FJ562328_HBx_P-RF-CB of FT:mat_peptide FJ562328_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I229). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562336_HBx_P-RF-CB Product feature CHAIN FJ562336_HBx_P-RF-CB of FT:mat_peptide FJ562336_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I115). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ692536_HBx_P-RF-DE Product feature CHAIN FJ692536_HBx_P-RF-DE of FT:mat_peptide FJ692536_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D4_50077). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ787446_HBx_P-RF-CB Product feature CHAIN FJ787446_HBx_P-RF-CB of FT:mat_peptide FJ787446_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S425-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787480_HBx_P-RF-CB Product feature CHAIN FJ787480_HBx_P-RF-CB of FT:mat_peptide FJ787480_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S425-16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ882610_HBx_P-RF-GC Product feature CHAIN FJ882610_HBx_P-RF-GC of FT:mat_peptide FJ882610_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H2252/01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCTFFTSA
>gnl|hbvpro|FJ882611_HBx_P-RF-GC Product feature CHAIN FJ882611_HBx_P-RF-GC of FT:mat_peptide FJ882611_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H2072/03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ882612_HBx_P-RF-GC Product feature CHAIN FJ882612_HBx_P-RF-GC of FT:mat_peptide FJ882612_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1886/07). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ882613_HBx_P-RF-GC Product feature CHAIN FJ882613_HBx_P-RF-GC of FT:mat_peptide FJ882613_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1357/05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ882614_HBx_P-RF-GC Product feature CHAIN FJ882614_HBx_P-RF-GC of FT:mat_peptide FJ882614_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1099/02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCXFFTSA
>gnl|hbvpro|FJ882617_HBx_P-RF-GC Product feature CHAIN FJ882617_HBx_P-RF-GC of FT:mat_peptide FJ882617_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H0645/08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLXVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ882618_HBx_P-RF-GC Product feature CHAIN FJ882618_HBx_P-RF-GC of FT:mat_peptide FJ882618_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H0035/08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ904394_HBx_P-RF-DE Product feature CHAIN FJ904394_HBx_P-RF-DE of FT:mat_peptide FJ904394_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904396_HBx_P-RF-DE Product feature CHAIN FJ904396_HBx_P-RF-DE of FT:mat_peptide FJ904396_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904397_HBx_P-RF-DE Product feature CHAIN FJ904397_HBx_P-RF-DE of FT:mat_peptide FJ904397_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A13). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSSSXPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904398_HBx_P-RF-DE Product feature CHAIN FJ904398_HBx_P-RF-DE of FT:mat_peptide FJ904398_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLSAVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|FJ904400_HBx_P-RF-DE Product feature CHAIN FJ904400_HBx_P-RF-DE of FT:mat_peptide FJ904400_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904401_HBx_P-RF-DE Product feature CHAIN FJ904401_HBx_P-RF-DE of FT:mat_peptide FJ904401_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904403_HBx_P-RF-DE Product feature CHAIN FJ904403_HBx_P-RF-DE of FT:mat_peptide FJ904403_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904404_HBx_P-RF-DE Product feature CHAIN FJ904404_HBx_P-RF-DE of FT:mat_peptide FJ904404_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904405_HBx_P-RF-DE Product feature CHAIN FJ904405_HBx_P-RF-DE of FT:mat_peptide FJ904405_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904406_HBx_P-RF-DE Product feature CHAIN FJ904406_HBx_P-RF-DE of FT:mat_peptide FJ904406_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPFSGPLGDISSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904407_HBx_P-RF-DE Product feature CHAIN FJ904407_HBx_P-RF-DE of FT:mat_peptide FJ904407_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPFGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904408_HBx_P-RF-DE Product feature CHAIN FJ904408_HBx_P-RF-DE of FT:mat_peptide FJ904408_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904409_HBx_P-RF-DE Product feature CHAIN FJ904409_HBx_P-RF-DE of FT:mat_peptide FJ904409_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A54a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEELRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|FJ904414_HBx_P-RF-DE Product feature CHAIN FJ904414_HBx_P-RF-DE of FT:mat_peptide FJ904414_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904416_HBx_P-RF-DE Product feature CHAIN FJ904416_HBx_P-RF-DE of FT:mat_peptide FJ904416_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A66a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904417_HBx_P-RF-DE Product feature CHAIN FJ904417_HBx_P-RF-DE of FT:mat_peptide FJ904417_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A66b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904425_HBx_P-RF-DE Product feature CHAIN FJ904425_HBx_P-RF-DE of FT:mat_peptide FJ904425_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLSSPSLPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|FJ904428_HBx_P-RF-DE Product feature CHAIN FJ904428_HBx_P-RF-DE of FT:mat_peptide FJ904428_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B7). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPIGAESCGRPVSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904430_HBx_P-RF-DE Product feature CHAIN FJ904430_HBx_P-RF-DE of FT:mat_peptide FJ904430_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904436_HBx_P-RF-DE Product feature CHAIN FJ904436_HBx_P-RF-DE of FT:mat_peptide FJ904436_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904437_HBx_P-RF-DE Product feature CHAIN FJ904437_HBx_P-RF-DE of FT:mat_peptide FJ904437_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B30a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904440_HBx_P-RF-DE Product feature CHAIN FJ904440_HBx_P-RF-DE of FT:mat_peptide FJ904440_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904441_HBx_P-RF-DE Product feature CHAIN FJ904441_HBx_P-RF-DE of FT:mat_peptide FJ904441_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B42a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904442_HBx_P-RF-DE Product feature CHAIN FJ904442_HBx_P-RF-DE of FT:mat_peptide FJ904442_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904444_HBx_P-RF-DE Product feature CHAIN FJ904444_HBx_P-RF-DE of FT:mat_peptide FJ904444_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904447_HBx_P-RF-DE Product feature CHAIN FJ904447_HBx_P-RF-DE of FT:mat_peptide FJ904447_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVTAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FN594767_HBx_P-RF-DE Product feature CHAIN FN594767_HBx_P-RF-DE of FT:mat_peptide FN594767_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQLLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FN594769_HBx_P-RF-DE Product feature CHAIN FN594769_HBx_P-RF-DE of FT:mat_peptide FN594769_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne281). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGDESCGRPFSGPLGDLPSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FN594770_HBx_P-RF-DE Product feature CHAIN FN594770_HBx_P-RF-DE of FT:mat_peptide FN594770_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne367). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPPLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRME
TTVNAHHVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FN594771_HBx_P-RF-DE Product feature CHAIN FN594771_HBx_P-RF-DE of FT:mat_peptide FN594771_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne442). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLSAVPTDHGSHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FR714490_HBx_P-RF-GB Product feature CHAIN FR714490_HBx_P-RF-GB of FT:mat_peptide FR714490_HBx_P-RF-GB of [Viruses] Hepatitis B Virus recombinant form GB (isolate DL706). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGDLPSSSSSAVPPVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|FR714496_HBx_P-RF-CB Product feature CHAIN FR714496_HBx_P-RF-CB of FT:mat_peptide FR714496_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate QL523). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCRRPLSGPLGDLSSSSASAVPPVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ161753_HBx_P-RF-AE Product feature CHAIN GQ161753_HBx_P-RF-AE of FT:mat_peptide GQ161753_HBx_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GH2537). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQILPKILHKRTLGLPAMSTTDLEAYFRDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GQ161754_HBx_P-RF-DE Product feature CHAIN GQ161754_HBx_P-RF-DE of FT:mat_peptide GQ161754_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GH16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQISPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ161767_HBx_P-RF-AE Product feature CHAIN GQ161767_HBx_P-RF-AE of FT:mat_peptide GQ161767_HBx_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1616). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVKAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ161788_HBx_P-RF-AE Product feature CHAIN GQ161788_HBx_P-RF-AE of FT:mat_peptide GQ161788_HBx_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1607). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ161806_HBx_P-RF-EA Product feature CHAIN GQ161806_HBx_P-RF-EA of FT:mat_peptide GQ161806_HBx_P-RF-EA of [Viruses] Hepatitis B Virus recombinant form EA (isolate GU763). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDXSRDVLCLRPVSAESXGRPLSGSLGDLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSXCNFFTSA
>gnl|hbvpro|GQ161837_HBx_P-RF-AE Product feature CHAIN GQ161837_HBx_P-RF-AE of FT:mat_peptide GQ161837_HBx_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1125). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183486_HBx_P-RF-DE Product feature CHAIN GQ183486_HBx_P-RF-DE of FT:mat_peptide GQ183486_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MOD_4568). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ205377_HBx_P-RF-DE Product feature CHAIN GQ205377_HBx_P-RF-DE of FT:mat_peptide GQ205377_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1178). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|GQ205378_HBx_P-RF-DE Product feature CHAIN GQ205378_HBx_P-RF-DE of FT:mat_peptide GQ205378_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1181). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|GQ205379_HBx_P-RF-DE Product feature CHAIN GQ205379_HBx_P-RF-DE of FT:mat_peptide GQ205379_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1234). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHILPKLLHKRTLGLSTMSTTELEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|GQ205386_HBx_P-RF-DE Product feature CHAIN GQ205386_HBx_P-RF-DE of FT:mat_peptide GQ205386_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1503). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|GQ205387_HBx_P-RF-DE Product feature CHAIN GQ205387_HBx_P-RF-DE of FT:mat_peptide GQ205387_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1545). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|GQ331048_HBx_P-RF-AE Product feature CHAIN GQ331048_HBx_P-RF-AE of FT:mat_peptide GQ331048_HBx_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate BV-201). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEESGEEIRLKVYLLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ358155_HBx_P-RF-CB Product feature CHAIN GQ358155_HBx_P-RF-CB of FT:mat_peptide GQ358155_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358156_HBx_P-RF-CB Product feature CHAIN GQ358156_HBx_P-RF-CB of FT:mat_peptide GQ358156_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate STN013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377516_HBx_P-RF-CB Product feature CHAIN GQ377516_HBx_P-RF-CB of FT:mat_peptide GQ377516_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPGNFFTSA
>gnl|hbvpro|GQ377522_HBx_P-RF-CB Product feature CHAIN GQ377522_HBx_P-RF-CB of FT:mat_peptide GQ377522_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377534_HBx_P-RF-CB Product feature CHAIN GQ377534_HBx_P-RF-CB of FT:mat_peptide GQ377534_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVARPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377539_HBx_P-RF-CB Product feature CHAIN GQ377539_HBx_P-RF-CB of FT:mat_peptide GQ377539_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J53). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377544_HBx_P-RF-CB Product feature CHAIN GQ377544_HBx_P-RF-CB of FT:mat_peptide GQ377544_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGSESRGRPVSRPFGTLPSPSASAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377548_HBx_P-RF-CB Product feature CHAIN GQ377548_HBx_P-RF-CB of FT:mat_peptide GQ377548_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J79). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377549_HBx_P-RF-CB Product feature CHAIN GQ377549_HBx_P-RF-CB of FT:mat_peptide GQ377549_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377556_HBx_P-RF-CB Product feature CHAIN GQ377556_HBx_P-RF-CB of FT:mat_peptide GQ377556_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J87). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377560_HBx_P-RF-CB Product feature CHAIN GQ377560_HBx_P-RF-CB of FT:mat_peptide GQ377560_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNNRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377564_HBx_P-RF-CB Product feature CHAIN GQ377564_HBx_P-RF-CB of FT:mat_peptide GQ377564_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J99). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377565_HBx_P-RF-CB Product feature CHAIN GQ377565_HBx_P-RF-CB of FT:mat_peptide GQ377565_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J100). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377581_HBx_P-RF-CB Product feature CHAIN GQ377581_HBx_P-RF-CB of FT:mat_peptide GQ377581_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J129). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377590_HBx_P-RF-CB Product feature CHAIN GQ377590_HBx_P-RF-CB of FT:mat_peptide GQ377590_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J147). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEAIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377592_HBx_P-RF-CB Product feature CHAIN GQ377592_HBx_P-RF-CB of FT:mat_peptide GQ377592_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J149). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPSVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377594_HBx_P-RF-CB Product feature CHAIN GQ377594_HBx_P-RF-CB of FT:mat_peptide GQ377594_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J152). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPXDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377595_HBx_P-RF-BC Product feature CHAIN GQ377595_HBx_P-RF-BC of FT:mat_peptide GQ377595_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J155). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377596_HBx_P-RF-CB Product feature CHAIN GQ377596_HBx_P-RF-CB of FT:mat_peptide GQ377596_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J156). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRYKLVCSQAPCNFFTSA
>gnl|hbvpro|GQ377602_HBx_P-RF-CB Product feature CHAIN GQ377602_HBx_P-RF-CB of FT:mat_peptide GQ377602_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377604_HBx_P-RF-CB Product feature CHAIN GQ377604_HBx_P-RF-CB of FT:mat_peptide GQ377604_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J168). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377607_HBx_P-RF-CB Product feature CHAIN GQ377607_HBx_P-RF-CB of FT:mat_peptide GQ377607_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J172). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEVIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377611_HBx_P-RF-CB Product feature CHAIN GQ377611_HBx_P-RF-CB of FT:mat_peptide GQ377611_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J179). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377614_HBx_P-RF-CB Product feature CHAIN GQ377614_HBx_P-RF-CB of FT:mat_peptide GQ377614_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377626_HBx_P-RF-CB Product feature CHAIN GQ377626_HBx_P-RF-CB of FT:mat_peptide GQ377626_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J225). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNDWEELGEEIRLMIFVLGGCRHKLVCSLAPCNFFTSA
>gnl|hbvpro|GQ377627_HBx_P-RF-CD Product feature CHAIN GQ377627_HBx_P-RF-CD of FT:mat_peptide GQ377627_HBx_P-RF-CD of [Viruses] Hepatitis B Virus recombinant form CD (isolate J231). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSXMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCKHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ377630_HBx_P-RF-BC Product feature CHAIN GQ377630_HBx_P-RF-BC of FT:mat_peptide GQ377630_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J236). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377633_HBx_P-RF-CB Product feature CHAIN GQ377633_HBx_P-RF-CB of FT:mat_peptide GQ377633_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J241). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSPMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377634_HBx_P-RF-CB Product feature CHAIN GQ377634_HBx_P-RF-CB of FT:mat_peptide GQ377634_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J242). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEVRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377635_HBx_P-RF-BC Product feature CHAIN GQ377635_HBx_P-RF-BC of FT:mat_peptide GQ377635_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J245). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475335_HBx_P-RF-CB Product feature CHAIN GQ475335_HBx_P-RF-CB of FT:mat_peptide GQ475335_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate KOR31LC). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924618_HBx_P-RF-CB Product feature CHAIN GQ924618_HBx_P-RF-CB of FT:mat_peptide GQ924618_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate M35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU177079_HBx_P-RF-DE Product feature CHAIN GU177079_HBx_P-RF-DE of FT:mat_peptide GU177079_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate DN171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU357843_HBx_P-RF-CB Product feature CHAIN GU357843_HBx_P-RF-CB of FT:mat_peptide GU357843_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Y580). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYNRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU385774_HBx_P-RF-CB Product feature CHAIN GU385774_HBx_P-RF-CB of FT:mat_peptide GU385774_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C2-Shanghai). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU563560_HBx_P-RF-DE Product feature CHAIN GU563560_HBx_P-RF-DE of FT:mat_peptide GU563560_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BV-146). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE981179_HBx_P-RF-FG Product feature CHAIN HE981179_HBx_P-RF-FG of FT:mat_peptide HE981179_HBx_P-RF-FG of [Viruses] Hepatitis B Virus recombinant form FG. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE981180_HBx_P-RF-GF Product feature CHAIN HE981180_HBx_P-RF-GF of FT:mat_peptide HE981180_HBx_P-RF-GF of [Viruses] Hepatitis B Virus recombinant form GF. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHEAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMSTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HF571060_HBx_P-RF-AE Product feature CHAIN HF571060_HBx_P-RF-AE of FT:mat_peptide HF571060_HBx_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate 56325). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HM146131_HBx_P-RF-AD Product feature CHAIN HM146131_HBx_P-RF-AD of FT:mat_peptide HM146131_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate TCGA5889). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCVFKDWEKVGEEIRLKVFVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|HM750133_HBx_P-RF-CB Product feature CHAIN HM750133_HBx_P-RF-CB of FT:mat_peptide HM750133_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate GSD-54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750142_HBx_P-RF-DC Product feature CHAIN HM750142_HBx_P-RF-DC of FT:mat_peptide HM750142_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QHN-52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750143_HBx_P-RF-DC Product feature CHAIN HM750143_HBx_P-RF-DC of FT:mat_peptide HM750143_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate tibet-116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750144_HBx_P-RF-DC Product feature CHAIN HM750144_HBx_P-RF-DC of FT:mat_peptide HM750144_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QHX-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFASARRME
TTVNAHLVLPKALHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750145_HBx_P-RF-DC Product feature CHAIN HM750145_HBx_P-RF-DC of FT:mat_peptide HM750145_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSFAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750146_HBx_P-RF-DC Product feature CHAIN HM750146_HBx_P-RF-DC of FT:mat_peptide HM750146_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750147_HBx_P-RF-DC Product feature CHAIN HM750147_HBx_P-RF-DC of FT:mat_peptide HM750147_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750148_HBx_P-RF-DC Product feature CHAIN HM750148_HBx_P-RF-DC of FT:mat_peptide HM750148_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750149_HBx_P-RF-DC Product feature CHAIN HM750149_HBx_P-RF-DC of FT:mat_peptide HM750149_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750150_HBx_P-RF-DC Product feature CHAIN HM750150_HBx_P-RF-DC of FT:mat_peptide HM750150_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-70). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLCPVGAESRGRPFSGPPRSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSALSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ684848_HBx_P-RF-CB Product feature CHAIN HQ684848_HBx_P-RF-CB of FT:mat_peptide HQ684848_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVJSTZ1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNPHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEEGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700462_HBx_P-RF-CB Product feature CHAIN HQ700462_HBx_P-RF-CB of FT:mat_peptide HQ700462_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NZL_HU27_1996). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPPSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700485_HBx_P-RF-CB Product feature CHAIN HQ700485_HBx_P-RF-CB of FT:mat_peptide HQ700485_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NZL_TE55_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700492_HBx_P-RF-DE Product feature CHAIN HQ700492_HBx_P-RF-DE of FT:mat_peptide HQ700492_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F006PF_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700493_HBx_P-RF-DE Product feature CHAIN HQ700493_HBx_P-RF-DE of FT:mat_peptide HQ700493_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F049PF_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700494_HBx_P-RF-DE Product feature CHAIN HQ700494_HBx_P-RF-DE of FT:mat_peptide HQ700494_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F062PM_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGXLGXLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLLKDWEELGEELRLKVFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|HQ700497_HBx_P-RF-DE Product feature CHAIN HQ700497_HBx_P-RF-DE of FT:mat_peptide HQ700497_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F109C_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700498_HBx_P-RF-CB Product feature CHAIN HQ700498_HBx_P-RF-CB of FT:mat_peptide HQ700498_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_F528PF_2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSALSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700499_HBx_P-RF-CB Product feature CHAIN HQ700499_HBx_P-RF-CB of FT:mat_peptide HQ700499_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_F528C_2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSALSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700500_HBx_P-RF-DE Product feature CHAIN HQ700500_HBx_P-RF-DE of FT:mat_peptide HQ700500_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Samoa_En_1993). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCTFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLLKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700501_HBx_P-RF-DE Product feature CHAIN HQ700501_HBx_P-RF-DE of FT:mat_peptide HQ700501_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Samoa_Fa_1991). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700503_HBx_P-RF-DE Product feature CHAIN HQ700503_HBx_P-RF-DE of FT:mat_peptide HQ700503_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_Ng_1992). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700505_HBx_P-RF-CB Product feature CHAIN HQ700505_HBx_P-RF-CB of FT:mat_peptide HQ700505_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_KI178P_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPPGDLPSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700507_HBx_P-RF-CB Product feature CHAIN HQ700507_HBx_P-RF-CB of FT:mat_peptide HQ700507_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NC_179928_2001). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEVGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700508_HBx_P-RF-CB Product feature CHAIN HQ700508_HBx_P-RF-CB of FT:mat_peptide HQ700508_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NC_43577_2003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700509_HBx_P-RF-CB Product feature CHAIN HQ700509_HBx_P-RF-CB of FT:mat_peptide HQ700509_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NC_3001_2003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700518_HBx_P-RF-CB Product feature CHAIN HQ700518_HBx_P-RF-CB of FT:mat_peptide HQ700518_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_D071A_2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRSVGAESRGRPVSGPLGDLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTADLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700519_HBx_P-RF-CB Product feature CHAIN HQ700519_HBx_P-RF-CB of FT:mat_peptide HQ700519_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_G028A_2003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTTRDVLCLRPVGAESSGRSVSGPLGDLSSPSPPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700520_HBx_P-RF-CB Product feature CHAIN HQ700520_HBx_P-RF-CB of FT:mat_peptide HQ700520_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_GM009A_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPLGTLPSPSSPAVPAHHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHIVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|HQ700521_HBx_P-RF-CB Product feature CHAIN HQ700521_HBx_P-RF-CB of FT:mat_peptide HQ700521_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_H058_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESGGRSVSGPLGDLPSPSPPTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700523_HBx_P-RF-CB Product feature CHAIN HQ700523_HBx_P-RF-CB of FT:mat_peptide HQ700523_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_P032C_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPIGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700524_HBx_P-RF-DE Product feature CHAIN HQ700524_HBx_P-RF-DE of FT:mat_peptide HQ700524_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_PNG_P043PF_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700525_HBx_P-RF-DE Product feature CHAIN HQ700525_HBx_P-RF-DE of FT:mat_peptide HQ700525_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_PNG_P054PF_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPAXHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700526_HBx_P-RF-CB Product feature CHAIN HQ700526_HBx_P-RF-CB of FT:mat_peptide HQ700526_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_143PF_2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700527_HBx_P-RF-CB Product feature CHAIN HQ700527_HBx_P-RF-CB of FT:mat_peptide HQ700527_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_W035A_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700528_HBx_P-RF-CB Product feature CHAIN HQ700528_HBx_P-RF-CB of FT:mat_peptide HQ700528_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_W034A_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700530_HBx_P-RF-CB Product feature CHAIN HQ700530_HBx_P-RF-CB of FT:mat_peptide HQ700530_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T127_1994). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700531_HBx_P-RF-CB Product feature CHAIN HQ700531_HBx_P-RF-CB of FT:mat_peptide HQ700531_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T107_1994). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLCAMSTTDLEAYFKDCVFKDWKELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700532_HBx_P-RF-CB Product feature CHAIN HQ700532_HBx_P-RF-CB of FT:mat_peptide HQ700532_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T114_1994). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|HQ700533_HBx_P-RF-DE Product feature CHAIN HQ700533_HBx_P-RF-DE of FT:mat_peptide HQ700533_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI012P_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700534_HBx_P-RF-DE Product feature CHAIN HQ700534_HBx_P-RF-DE of FT:mat_peptide HQ700534_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI018_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700535_HBx_P-RF-DE Product feature CHAIN HQ700535_HBx_P-RF-DE of FT:mat_peptide HQ700535_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI152P_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVXVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700536_HBx_P-RF-DE Product feature CHAIN HQ700536_HBx_P-RF-DE of FT:mat_peptide HQ700536_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_K148A_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700537_HBx_P-RF-DE Product feature CHAIN HQ700537_HBx_P-RF-DE of FT:mat_peptide HQ700537_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI191P_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700538_HBx_P-RF-DE Product feature CHAIN HQ700538_HBx_P-RF-DE of FT:mat_peptide HQ700538_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI215p_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700540_HBx_P-RF-DE Product feature CHAIN HQ700540_HBx_P-RF-DE of FT:mat_peptide HQ700540_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI346C_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700541_HBx_P-RF-DE Product feature CHAIN HQ700541_HBx_P-RF-DE of FT:mat_peptide HQ700541_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI387C_2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700542_HBx_P-RF-CB Product feature CHAIN HQ700542_HBx_P-RF-CB of FT:mat_peptide HQ700542_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_Y020_2003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRNVLCLRPVSAESRGRPVSRSLGDLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
ATMNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700547_HBx_P-RF-CB Product feature CHAIN HQ700547_HBx_P-RF-CB of FT:mat_peptide HQ700547_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I_WA1034A). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700554_HBx_P-RF-CB Product feature CHAIN HQ700554_HBx_P-RF-CB of FT:mat_peptide HQ700554_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NZL_PA81). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGDLPSPSSSAVPANYGAHLSLRSLPVCAFSSAGPCALRFTSARRME
TTVNAHMXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEELRLKIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|HQ700557_HBx_P-RF-CB Product feature CHAIN HQ700557_HBx_P-RF-CB of FT:mat_peptide HQ700557_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_Tonga_BB6189_2002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCXLRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRXKVXVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700560_HBx_P-RF-CB Product feature CHAIN HQ700560_HBx_P-RF-CB of FT:mat_peptide HQ700560_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_Tonga_BE4253_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700579_HBx_P-RF-DE Product feature CHAIN HQ700579_HBx_P-RF-DE of FT:mat_peptide HQ700579_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C_Tonga_To29_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|HQ700580_HBx_P-RF-CB Product feature CHAIN HQ700580_HBx_P-RF-CB of FT:mat_peptide HQ700580_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_Tonga_To251_2006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPISGPLGDLPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700581_HBx_P-RF-DE Product feature CHAIN HQ700581_HBx_P-RF-DE of FT:mat_peptide HQ700581_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BB6995_2000). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700582_HBx_P-RF-DE Product feature CHAIN HQ700582_HBx_P-RF-DE of FT:mat_peptide HQ700582_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BH0071_2002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700583_HBx_P-RF-DE Product feature CHAIN HQ700583_HBx_P-RF-DE of FT:mat_peptide HQ700583_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BQ3450_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700584_HBx_P-RF-DE Product feature CHAIN HQ700584_HBx_P-RF-DE of FT:mat_peptide HQ700584_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_JF5498_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700585_HBx_P-RF-DE Product feature CHAIN HQ700585_HBx_P-RF-DE of FT:mat_peptide HQ700585_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_To29_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|JF436919_HBx_P-RF-CB Product feature CHAIN JF436919_HBx_P-RF-CB of FT:mat_peptide JF436919_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SZ5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGLCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF436922_HBx_P-RF-CB Product feature CHAIN JF436922_HBx_P-RF-CB of FT:mat_peptide JF436922_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SZ16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPRALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF436923_HBx_P-RF-CB Product feature CHAIN JF436923_HBx_P-RF-CB of FT:mat_peptide JF436923_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SZ19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCTFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF439994_HBx_P-RF-DE Product feature CHAIN JF439994_HBx_P-RF-DE of FT:mat_peptide JF439994_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF439995_HBx_P-RF-DE Product feature CHAIN JF439995_HBx_P-RF-DE of FT:mat_peptide JF439995_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN17). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF439996_HBx_P-RF-DE Product feature CHAIN JF439996_HBx_P-RF-DE of FT:mat_peptide JF439996_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN31). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF439998_HBx_P-RF-DE Product feature CHAIN JF439998_HBx_P-RF-DE of FT:mat_peptide JF439998_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN35). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF439999_HBx_P-RF-DE Product feature CHAIN JF439999_HBx_P-RF-DE of FT:mat_peptide JF439999_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN36). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440000_HBx_P-RF-DE Product feature CHAIN JF440000_HBx_P-RF-DE of FT:mat_peptide JF440000_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN37). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440001_HBx_P-RF-DE Product feature CHAIN JF440001_HBx_P-RF-DE of FT:mat_peptide JF440001_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN42). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440002_HBx_P-RF-DE Product feature CHAIN JF440002_HBx_P-RF-DE of FT:mat_peptide JF440002_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRYTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWGELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF440003_HBx_P-RF-DE Product feature CHAIN JF440003_HBx_P-RF-DE of FT:mat_peptide JF440003_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN44). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRYTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWGELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440004_HBx_P-RF-DE Product feature CHAIN JF440004_HBx_P-RF-DE of FT:mat_peptide JF440004_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN52). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFASARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440005_HBx_P-RF-DE Product feature CHAIN JF440005_HBx_P-RF-DE of FT:mat_peptide JF440005_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN53). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFASARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440006_HBx_P-RF-DE Product feature CHAIN JF440006_HBx_P-RF-DE of FT:mat_peptide JF440006_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN60). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLFAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440007_HBx_P-RF-DE Product feature CHAIN JF440007_HBx_P-RF-DE of FT:mat_peptide JF440007_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN64). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440008_HBx_P-RF-DE Product feature CHAIN JF440008_HBx_P-RF-DE of FT:mat_peptide JF440008_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN70). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440009_HBx_P-RF-DE Product feature CHAIN JF440009_HBx_P-RF-DE of FT:mat_peptide JF440009_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN72). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440010_HBx_P-RF-DE Product feature CHAIN JF440010_HBx_P-RF-DE of FT:mat_peptide JF440010_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN77). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440011_HBx_P-RF-DE Product feature CHAIN JF440011_HBx_P-RF-DE of FT:mat_peptide JF440011_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF440012_HBx_P-RF-DE Product feature CHAIN JF440012_HBx_P-RF-DE of FT:mat_peptide JF440012_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN82). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440013_HBx_P-RF-DE Product feature CHAIN JF440013_HBx_P-RF-DE of FT:mat_peptide JF440013_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN84). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440014_HBx_P-RF-DE Product feature CHAIN JF440014_HBx_P-RF-DE of FT:mat_peptide JF440014_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN86). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440015_HBx_P-RF-DE Product feature CHAIN JF440015_HBx_P-RF-DE of FT:mat_peptide JF440015_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN94). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCRRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSMS
>gnl|hbvpro|JF440017_HBx_P-RF-DA Product feature CHAIN JF440017_HBx_P-RF-DA of FT:mat_peptide JF440017_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate FOL496). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRYTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWGELGEEIRLKVFVLGGCRHKLVCAPAPCNFXXXA
>gnl|hbvpro|JF491448_HBx_P-RF-DC Product feature CHAIN JF491448_HBx_P-RF-DC of FT:mat_peptide JF491448_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF491449_HBx_P-RF-DC Product feature CHAIN JF491449_HBx_P-RF-DC of FT:mat_peptide JF491449_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF491451_HBx_P-RF-DC Product feature CHAIN JF491451_HBx_P-RF-DC of FT:mat_peptide JF491451_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF491455_HBx_P-RF-DC Product feature CHAIN JF491455_HBx_P-RF-DC of FT:mat_peptide JF491455_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSTAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF491456_HBx_P-RF-DC Product feature CHAIN JF491456_HBx_P-RF-DC of FT:mat_peptide JF491456_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF754613_HBx_P-RF-DE Product feature CHAIN JF754613_HBx_P-RF-DE of FT:mat_peptide JF754613_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TK145). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754616_HBx_P-RF-DE Product feature CHAIN JF754616_HBx_P-RF-DE of FT:mat_peptide JF754616_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TK138). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGPLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF828933_HBx_P-RF-CB Product feature CHAIN JF828933_HBx_P-RF-CB of FT:mat_peptide JF828933_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828934_HBx_P-RF-CB Product feature CHAIN JF828934_HBx_P-RF-CB of FT:mat_peptide JF828934_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828935_HBx_P-RF-CB Product feature CHAIN JF828935_HBx_P-RF-CB of FT:mat_peptide JF828935_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828936_HBx_P-RF-CB Product feature CHAIN JF828936_HBx_P-RF-CB of FT:mat_peptide JF828936_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828938_HBx_P-RF-CB Product feature CHAIN JF828938_HBx_P-RF-CB of FT:mat_peptide JF828938_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN040798_HBx_P-RF-DE Product feature CHAIN JN040798_HBx_P-RF-DE of FT:mat_peptide JN040798_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 919077). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040803_HBx_P-RF-DE Product feature CHAIN JN040803_HBx_P-RF-DE of FT:mat_peptide JN040803_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 919031). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN104438_HBx_P-RF-CB Product feature CHAIN JN104438_HBx_P-RF-CB of FT:mat_peptide JN104438_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTNLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN104442_HBx_P-RF-CB Product feature CHAIN JN104442_HBx_P-RF-CB of FT:mat_peptide JN104442_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIXLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN257154_HBx_P-RF-DE Product feature CHAIN JN257154_HBx_P-RF-DE of FT:mat_peptide JN257154_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHDKR). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257164_HBx_P-RF-DE Product feature CHAIN JN257164_HBx_P-RF-DE of FT:mat_peptide JN257164_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHQNT). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVXVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257174_HBx_P-RF-DE Product feature CHAIN JN257174_HBx_P-RF-DE of FT:mat_peptide JN257174_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHOTH1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPXRDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257189_HBx_P-RF-DE Product feature CHAIN JN257189_HBx_P-RF-DE of FT:mat_peptide JN257189_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHMHD). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257191_HBx_P-RF-DE Product feature CHAIN JN257191_HBx_P-RF-DE of FT:mat_peptide JN257191_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHWHD1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257204_HBx_P-RF-DE Product feature CHAIN JN257204_HBx_P-RF-DE of FT:mat_peptide JN257204_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHYMN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JN257206_HBx_P-RF-DE Product feature CHAIN JN257206_HBx_P-RF-DE of FT:mat_peptide JN257206_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHAKF1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEEXGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257207_HBx_P-RF-DE Product feature CHAIN JN257207_HBx_P-RF-DE of FT:mat_peptide JN257207_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHAKF2). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEEXGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257210_HBx_P-RF-DE Product feature CHAIN JN257210_HBx_P-RF-DE of FT:mat_peptide JN257210_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHYSR). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSAX
>gnl|hbvpro|JN257216_HBx_P-RF-DE Product feature CHAIN JN257216_HBx_P-RF-DE of FT:mat_peptide JN257216_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHMQR1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN400086_HBx_P-RF-CB Product feature CHAIN JN400086_HBx_P-RF-CB of FT:mat_peptide JN400086_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-75-Baby). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN642127_HBx_P-RF-DE Product feature CHAIN JN642127_HBx_P-RF-DE of FT:mat_peptide JN642127_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPEPCNFFTSA
>gnl|hbvpro|JN642137_HBx_P-RF-DE Product feature CHAIN JN642137_HBx_P-RF-DE of FT:mat_peptide JN642137_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLELFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642139_HBx_P-RF-DE Product feature CHAIN JN642139_HBx_P-RF-DE of FT:mat_peptide JN642139_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642141_HBx_P-RF-DE Product feature CHAIN JN642141_HBx_P-RF-DE of FT:mat_peptide JN642141_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb31). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642152_HBx_P-RF-DE Product feature CHAIN JN642152_HBx_P-RF-DE of FT:mat_peptide JN642152_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642160_HBx_P-RF-DE Product feature CHAIN JN642160_HBx_P-RF-DE of FT:mat_peptide JN642160_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Leb53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFNDWEELGEETRLMIFVLGGCRHKWVCGPAPCNFFTSA
>gnl|hbvpro|JN664915_HBx_P-RF-DE Product feature CHAIN JN664915_HBx_P-RF-DE of FT:mat_peptide JN664915_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EN56_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPFSGSLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664925_HBx_P-RF-DE Product feature CHAIN JN664925_HBx_P-RF-DE of FT:mat_peptide JN664925_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EN57_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664929_HBx_P-RF-DE Product feature CHAIN JN664929_HBx_P-RF-DE of FT:mat_peptide JN664929_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HE33_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664933_HBx_P-RF-DA Product feature CHAIN JN664933_HBx_P-RF-DA of FT:mat_peptide JN664933_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate EN58_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664934_HBx_P-RF-DE Product feature CHAIN JN664934_HBx_P-RF-DE of FT:mat_peptide JN664934_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EN61_CHB). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664935_HBx_P-RF-DC Product feature CHAIN JN664935_HBx_P-RF-DC of FT:mat_peptide JN664935_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate HE28_CHB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN664940_HBx_P-RF-DE Product feature CHAIN JN664940_HBx_P-RF-DE of FT:mat_peptide JN664940_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate THB20_LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPPGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664943_HBx_P-RF-DE Product feature CHAIN JN664943_HBx_P-RF-DE of FT:mat_peptide JN664943_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EN76_LC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPWNFFTSA
>gnl|hbvpro|JN664946_HBx_P-RF-DA Product feature CHAIN JN664946_HBx_P-RF-DA of FT:mat_peptide JN664946_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate THB17_LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688689_HBx_P-RF-DE Product feature CHAIN JN688689_HBx_P-RF-DE of FT:mat_peptide JN688689_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV115). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARXME
TTVNAHQILPKVLHKRTLGLFAKSTTDLEAYFKNCLFKEWEELGEEIRLKVFVLGGCRHKLVWAPAPCNIFTSA
>gnl|hbvpro|JN688715_HBx_P-RF-DE Product feature CHAIN JN688715_HBx_P-RF-DE of FT:mat_peptide JN688715_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV192). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPXRDVLCLRPVGAESRGRPXSGXXGTLSSPSPSAVPXDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688717_HBx_P-RF-DE Product feature CHAIN JN688717_HBx_P-RF-DE of FT:mat_peptide JN688717_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV216). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPXRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGWRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ027310_HBx_P-RF-CB Product feature CHAIN JQ027310_HBx_P-RF-CB of FT:mat_peptide JQ027310_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPXGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040142_HBx_P-RF-CB Product feature CHAIN JQ040142_HBx_P-RF-CB of FT:mat_peptide JQ040142_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 262). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040146_HBx_P-RF-CB Product feature CHAIN JQ040146_HBx_P-RF-CB of FT:mat_peptide JQ040146_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 278). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040148_HBx_P-RF-CB Product feature CHAIN JQ040148_HBx_P-RF-CB of FT:mat_peptide JQ040148_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate G67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040174_HBx_P-RF-CB Product feature CHAIN JQ040174_HBx_P-RF-CB of FT:mat_peptide JQ040174_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate G246). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRXRPVSGPFGXLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040175_HBx_P-RF-CB Product feature CHAIN JQ040175_HBx_P-RF-CB of FT:mat_peptide JQ040175_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate G250). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ272886_HBx_P-RF-GF Product feature CHAIN JQ272886_HBx_P-RF-GF of FT:mat_peptide JQ272886_HBx_P-RF-GF of [Viruses] Hepatitis B Virus recombinant form GF (isolate HBV_MDQ5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ272887_HBx_P-RF-GF Product feature CHAIN JQ272887_HBx_P-RF-GF of FT:mat_peptide JQ272887_HBx_P-RF-GF of [Viruses] Hepatitis B Virus recombinant form GF (isolate HBV_MDQ24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFADWEELGNESRLMTFVLGGCRHKLVCAPAPCNYFTSA
>gnl|hbvpro|JQ687532_HBx_P-RF-DE Product feature CHAIN JQ687532_HBx_P-RF-DE of FT:mat_peptide JQ687532_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Srb 207). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707421_HBx_P-RF-GA Product feature CHAIN JQ707421_HBx_P-RF-GA of FT:mat_peptide JQ707421_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707424_HBx_P-RF-GA Product feature CHAIN JQ707424_HBx_P-RF-GA of FT:mat_peptide JQ707424_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C12). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707426_HBx_P-RF-GA Product feature CHAIN JQ707426_HBx_P-RF-GA of FT:mat_peptide JQ707426_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C14). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707430_HBx_P-RF-GA Product feature CHAIN JQ707430_HBx_P-RF-GA of FT:mat_peptide JQ707430_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C19). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707432_HBx_P-RF-GA Product feature CHAIN JQ707432_HBx_P-RF-GA of FT:mat_peptide JQ707432_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707441_HBx_P-RF-GA Product feature CHAIN JQ707441_HBx_P-RF-GA of FT:mat_peptide JQ707441_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C34). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707445_HBx_P-RF-GA Product feature CHAIN JQ707445_HBx_P-RF-GA of FT:mat_peptide JQ707445_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707448_HBx_P-RF-GA Product feature CHAIN JQ707448_HBx_P-RF-GA of FT:mat_peptide JQ707448_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C42). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707450_HBx_P-RF-GA Product feature CHAIN JQ707450_HBx_P-RF-GA of FT:mat_peptide JQ707450_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC1_C44). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707456_HBx_P-RF-GA Product feature CHAIN JQ707456_HBx_P-RF-GA of FT:mat_peptide JQ707456_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707457_HBx_P-RF-GA Product feature CHAIN JQ707457_HBx_P-RF-GA of FT:mat_peptide JQ707457_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707458_HBx_P-RF-GA Product feature CHAIN JQ707458_HBx_P-RF-GA of FT:mat_peptide JQ707458_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C11-10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707459_HBx_P-RF-GA Product feature CHAIN JQ707459_HBx_P-RF-GA of FT:mat_peptide JQ707459_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C12). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707460_HBx_P-RF-GA Product feature CHAIN JQ707460_HBx_P-RF-GA of FT:mat_peptide JQ707460_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C13). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707461_HBx_P-RF-GA Product feature CHAIN JQ707461_HBx_P-RF-GA of FT:mat_peptide JQ707461_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C15). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707462_HBx_P-RF-GA Product feature CHAIN JQ707462_HBx_P-RF-GA of FT:mat_peptide JQ707462_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C17). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707463_HBx_P-RF-GA Product feature CHAIN JQ707463_HBx_P-RF-GA of FT:mat_peptide JQ707463_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C19). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHPLPRQLYKRTLGLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707464_HBx_P-RF-GA Product feature CHAIN JQ707464_HBx_P-RF-GA of FT:mat_peptide JQ707464_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C2-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707465_HBx_P-RF-GA Product feature CHAIN JQ707465_HBx_P-RF-GA of FT:mat_peptide JQ707465_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFTEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707466_HBx_P-RF-GA Product feature CHAIN JQ707466_HBx_P-RF-GA of FT:mat_peptide JQ707466_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C26). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPIGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707467_HBx_P-RF-GA Product feature CHAIN JQ707467_HBx_P-RF-GA of FT:mat_peptide JQ707467_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C27). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707468_HBx_P-RF-GA Product feature CHAIN JQ707468_HBx_P-RF-GA of FT:mat_peptide JQ707468_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C28). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYERTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707469_HBx_P-RF-GA Product feature CHAIN JQ707469_HBx_P-RF-GA of FT:mat_peptide JQ707469_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C32). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPFPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707470_HBx_P-RF-GA Product feature CHAIN JQ707470_HBx_P-RF-GA of FT:mat_peptide JQ707470_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C34). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707471_HBx_P-RF-GA Product feature CHAIN JQ707471_HBx_P-RF-GA of FT:mat_peptide JQ707471_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C37). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHPLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707472_HBx_P-RF-GA Product feature CHAIN JQ707472_HBx_P-RF-GA of FT:mat_peptide JQ707472_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C40). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707473_HBx_P-RF-GA Product feature CHAIN JQ707473_HBx_P-RF-GA of FT:mat_peptide JQ707473_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C41). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707475_HBx_P-RF-GA Product feature CHAIN JQ707475_HBx_P-RF-GA of FT:mat_peptide JQ707475_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate MC3_C45). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707714_HBx_P-RF-CB Product feature CHAIN JQ707714_HBx_P-RF-CB of FT:mat_peptide JQ707714_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S20_21). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ732168_HBx_P-RF-CB Product feature CHAIN JQ732168_HBx_P-RF-CB of FT:mat_peptide JQ732168_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate DT2007). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPACHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801476_HBx_P-RF-CG Product feature CHAIN JQ801476_HBx_P-RF-CG of FT:mat_peptide JQ801476_HBx_P-RF-CG of [Viruses] Hepatitis B Virus recombinant form CG (isolate AIDS18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTSRDVLCLRPVSAESSGRPLSGPLGAFSPPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801477_HBx_P-RF-BC Product feature CHAIN JQ801477_HBx_P-RF-BC of FT:mat_peptide JQ801477_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate AIDS19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026887_HBx_P-RF-CB Product feature CHAIN JX026887_HBx_P-RF-CB of FT:mat_peptide JX026887_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WY-NJ-79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429896_HBx_P-RF-CB Product feature CHAIN JX429896_HBx_P-RF-CB of FT:mat_peptide JX429896_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WY-HZ-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429898_HBx_P-RF-DC Product feature CHAIN JX429898_HBx_P-RF-DC of FT:mat_peptide JX429898_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate WY-HZ-13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGFSAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504540_HBx_P-RF-CB Product feature CHAIN JX504540_HBx_P-RF-CB of FT:mat_peptide JX504540_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WY-NNJ-13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661485_HBx_P-RF-CB Product feature CHAIN JX661485_HBx_P-RF-CB of FT:mat_peptide JX661485_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1201-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661486_HBx_P-RF-CB Product feature CHAIN JX661486_HBx_P-RF-CB of FT:mat_peptide JX661486_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1225-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661487_HBx_P-RF-CB Product feature CHAIN JX661487_HBx_P-RF-CB of FT:mat_peptide JX661487_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1207-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVDAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661494_HBx_P-RF-CB Product feature CHAIN JX661494_HBx_P-RF-CB of FT:mat_peptide JX661494_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1203-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMILVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661498_HBx_P-RF-CB Product feature CHAIN JX661498_HBx_P-RF-CB of FT:mat_peptide JX661498_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1213-C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSYSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX898686_HBx_P-RF-DE Product feature CHAIN JX898686_HBx_P-RF-DE of FT:mat_peptide JX898686_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898687_HBx_P-RF-DE Product feature CHAIN JX898687_HBx_P-RF-DE of FT:mat_peptide JX898687_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898688_HBx_P-RF-DE Product feature CHAIN JX898688_HBx_P-RF-DE of FT:mat_peptide JX898688_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898690_HBx_P-RF-DE Product feature CHAIN JX898690_HBx_P-RF-DE of FT:mat_peptide JX898690_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898693_HBx_P-RF-DE Product feature CHAIN JX898693_HBx_P-RF-DE of FT:mat_peptide JX898693_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898695_HBx_P-RF-DE Product feature CHAIN JX898695_HBx_P-RF-DE of FT:mat_peptide JX898695_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898696_HBx_P-RF-DE Product feature CHAIN JX898696_HBx_P-RF-DE of FT:mat_peptide JX898696_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898698_HBx_P-RF-DE Product feature CHAIN JX898698_HBx_P-RF-DE of FT:mat_peptide JX898698_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898699_HBx_P-RF-DE Product feature CHAIN JX898699_HBx_P-RF-DE of FT:mat_peptide JX898699_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC012653_HBx_P-RF-AD Product feature CHAIN KC012653_HBx_P-RF-AD of FT:mat_peptide KC012653_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCXRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPXALXFTSARRME
TTVNAHRMLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFILGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC172106_HBx_P-RF-GB Product feature CHAIN KC172106_HBx_P-RF-GB of FT:mat_peptide KC172106_HBx_P-RF-GB of [Viruses] Hepatitis B Virus recombinant form GB (isolate BTO3048). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGDLPSSSSSAVPPVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAACNFFTSA
>gnl|hbvpro|KC315400_HBx_P-RF-CB Product feature CHAIN KC315400_HBx_P-RF-CB of FT:mat_peptide KC315400_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate M0914). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774178_HBx_P-RF-BC Product feature CHAIN KC774178_HBx_P-RF-BC of FT:mat_peptide KC774178_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate GS12lz2088). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774183_HBx_P-RF-CB Product feature CHAIN KC774183_HBx_P-RF-CB of FT:mat_peptide KC774183_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1020). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774186_HBx_P-RF-CB Product feature CHAIN KC774186_HBx_P-RF-CB of FT:mat_peptide KC774186_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774188_HBx_P-RF-CB Product feature CHAIN KC774188_HBx_P-RF-CB of FT:mat_peptide KC774188_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1028). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774193_HBx_P-RF-CB Product feature CHAIN KC774193_HBx_P-RF-CB of FT:mat_peptide KC774193_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1035). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774198_HBx_P-RF-CB Product feature CHAIN KC774198_HBx_P-RF-CB of FT:mat_peptide KC774198_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2039). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774201_HBx_P-RF-CB Product feature CHAIN KC774201_HBx_P-RF-CB of FT:mat_peptide KC774201_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2047). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774212_HBx_P-RF-CB Product feature CHAIN KC774212_HBx_P-RF-CB of FT:mat_peptide KC774212_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2115). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774222_HBx_P-RF-CB Product feature CHAIN KC774222_HBx_P-RF-CB of FT:mat_peptide KC774222_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2166). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774230_HBx_P-RF-CB Product feature CHAIN KC774230_HBx_P-RF-CB of FT:mat_peptide KC774230_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cur1027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774234_HBx_P-RF-CB Product feature CHAIN KC774234_HBx_P-RF-CB of FT:mat_peptide KC774234_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cur1038). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774246_HBx_P-RF-CB Product feature CHAIN KC774246_HBx_P-RF-CB of FT:mat_peptide KC774246_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cww1014). Complete genome. [Hepadnaviridae] (length=154 residues).
MVARVCCQVDHWRDVGSLRAVGPESRGRPVSPPWGRLRSPCSFAVPADHGAHGRTRGLPVRPLASAGLPALRLTSAPCME
TTVKTPRAPPQAPRKRTSGLLAGSKSCRQAYFQASKIKEWEELGEEIRLRICVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774258_HBx_P-RF-CB Product feature CHAIN KC774258_HBx_P-RF-CB of FT:mat_peptide KC774258_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cww1060). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774263_HBx_P-RF-CB Product feature CHAIN KC774263_HBx_P-RF-CB of FT:mat_peptide KC774263_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cww1069). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774291_HBx_P-RF-CB Product feature CHAIN KC774291_HBx_P-RF-CB of FT:mat_peptide KC774291_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa1194). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774294_HBx_P-RF-CB Product feature CHAIN KC774294_HBx_P-RF-CB of FT:mat_peptide KC774294_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa1205). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774305_HBx_P-RF-CB Product feature CHAIN KC774305_HBx_P-RF-CB of FT:mat_peptide KC774305_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa1672). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQILPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774307_HBx_P-RF-CB Product feature CHAIN KC774307_HBx_P-RF-CB of FT:mat_peptide KC774307_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2016). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAWVCCQLDPARDVLCLRPVSAESRGRPVSRPFGSLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774317_HBx_P-RF-CB Product feature CHAIN KC774317_HBx_P-RF-CB of FT:mat_peptide KC774317_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2042). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774322_HBx_P-RF-CB Product feature CHAIN KC774322_HBx_P-RF-CB of FT:mat_peptide KC774322_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2053). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774323_HBx_P-RF-CB Product feature CHAIN KC774323_HBx_P-RF-CB of FT:mat_peptide KC774323_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2057). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774324_HBx_P-RF-CB Product feature CHAIN KC774324_HBx_P-RF-CB of FT:mat_peptide KC774324_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2060). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774328_HBx_P-RF-CB Product feature CHAIN KC774328_HBx_P-RF-CB of FT:mat_peptide KC774328_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2073). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774332_HBx_P-RF-CB Product feature CHAIN KC774332_HBx_P-RF-CB of FT:mat_peptide KC774332_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774341_HBx_P-RF-CB Product feature CHAIN KC774341_HBx_P-RF-CB of FT:mat_peptide KC774341_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1040). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774344_HBx_P-RF-CB Product feature CHAIN KC774344_HBx_P-RF-CB of FT:mat_peptide KC774344_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1049). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774349_HBx_P-RF-CB Product feature CHAIN KC774349_HBx_P-RF-CB of FT:mat_peptide KC774349_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1095). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSVESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGFPVCALSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774364_HBx_P-RF-BC Product feature CHAIN KC774364_HBx_P-RF-BC of FT:mat_peptide KC774364_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate blz2088). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774414_HBx_P-RF-BC Product feature CHAIN KC774414_HBx_P-RF-BC of FT:mat_peptide KC774414_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate bxa2061). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESCGRPISGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774420_HBx_P-RF-DC Product feature CHAIN KC774420_HBx_P-RF-DC of FT:mat_peptide KC774420_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz1003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774422_HBx_P-RF-DC Product feature CHAIN KC774422_HBx_P-RF-DC of FT:mat_peptide KC774422_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz1044). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPVPSPSTSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774423_HBx_P-RF-DC Product feature CHAIN KC774423_HBx_P-RF-DC of FT:mat_peptide KC774423_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774424_HBx_P-RF-DC Product feature CHAIN KC774424_HBx_P-RF-DC of FT:mat_peptide KC774424_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2021). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774425_HBx_P-RF-DC Product feature CHAIN KC774425_HBx_P-RF-DC of FT:mat_peptide KC774425_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2068). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774426_HBx_P-RF-DC Product feature CHAIN KC774426_HBx_P-RF-DC of FT:mat_peptide KC774426_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774428_HBx_P-RF-DC Product feature CHAIN KC774428_HBx_P-RF-DC of FT:mat_peptide KC774428_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2100). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774430_HBx_P-RF-DC Product feature CHAIN KC774430_HBx_P-RF-DC of FT:mat_peptide KC774430_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPASSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774431_HBx_P-RF-DC Product feature CHAIN KC774431_HBx_P-RF-DC of FT:mat_peptide KC774431_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774432_HBx_P-RF-DC Product feature CHAIN KC774432_HBx_P-RF-DC of FT:mat_peptide KC774432_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2128). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774433_HBx_P-RF-DC Product feature CHAIN KC774433_HBx_P-RF-DC of FT:mat_peptide KC774433_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2143). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRMGGQLDPARDVLCLRPVGGESRGRPFPGPFGFLRSPSSSAVPPDPGAPLSFRGLPVCAFSSAGPCAFRFTSARRME
TTVNAHQVLPKVLLKRILGLSAMSTPDLEAYLKDCVFKDGEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774434_HBx_P-RF-DC Product feature CHAIN KC774434_HBx_P-RF-DC of FT:mat_peptide KC774434_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dur1021). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774435_HBx_P-RF-DC Product feature CHAIN KC774435_HBx_P-RF-DC of FT:mat_peptide KC774435_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774439_HBx_P-RF-DC Product feature CHAIN KC774439_HBx_P-RF-DC of FT:mat_peptide KC774439_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1024). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774442_HBx_P-RF-DC Product feature CHAIN KC774442_HBx_P-RF-DC of FT:mat_peptide KC774442_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1035). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774443_HBx_P-RF-DC Product feature CHAIN KC774443_HBx_P-RF-DC of FT:mat_peptide KC774443_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1036). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774447_HBx_P-RF-DC Product feature CHAIN KC774447_HBx_P-RF-DC of FT:mat_peptide KC774447_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1057). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774448_HBx_P-RF-DC Product feature CHAIN KC774448_HBx_P-RF-DC of FT:mat_peptide KC774448_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1058). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774449_HBx_P-RF-DC Product feature CHAIN KC774449_HBx_P-RF-DC of FT:mat_peptide KC774449_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1071). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774450_HBx_P-RF-DE Product feature CHAIN KC774450_HBx_P-RF-DE of FT:mat_peptide KC774450_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate dww1073). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFQGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774452_HBx_P-RF-DC Product feature CHAIN KC774452_HBx_P-RF-DC of FT:mat_peptide KC774452_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1080). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774453_HBx_P-RF-DC Product feature CHAIN KC774453_HBx_P-RF-DC of FT:mat_peptide KC774453_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1083). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774454_HBx_P-RF-DC Product feature CHAIN KC774454_HBx_P-RF-DC of FT:mat_peptide KC774454_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1087). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774455_HBx_P-RF-DC Product feature CHAIN KC774455_HBx_P-RF-DC of FT:mat_peptide KC774455_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1100). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774456_HBx_P-RF-DC Product feature CHAIN KC774456_HBx_P-RF-DC of FT:mat_peptide KC774456_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774457_HBx_P-RF-DC Product feature CHAIN KC774457_HBx_P-RF-DC of FT:mat_peptide KC774457_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774458_HBx_P-RF-DC Product feature CHAIN KC774458_HBx_P-RF-DC of FT:mat_peptide KC774458_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774461_HBx_P-RF-DC Product feature CHAIN KC774461_HBx_P-RF-DC of FT:mat_peptide KC774461_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxa1577). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARSCCQLDPARDVLFLRPVAVVSGRRPVSGPDGSFRSRLCFAVPAAHGAHLSLRGLTVRSLFSPGPCALRFTCARCME
TTVNAHQVLPKVTHKRTIGLSARLTTLLESYFKACLLKDWEEFGEEIRLKVRGLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774463_HBx_P-RF-DC Product feature CHAIN KC774463_HBx_P-RF-DC of FT:mat_peptide KC774463_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxa2066). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774466_HBx_P-RF-DC Product feature CHAIN KC774466_HBx_P-RF-DC of FT:mat_peptide KC774466_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1008). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774468_HBx_P-RF-DC Product feature CHAIN KC774468_HBx_P-RF-DC of FT:mat_peptide KC774468_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1012). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774470_HBx_P-RF-DC Product feature CHAIN KC774470_HBx_P-RF-DC of FT:mat_peptide KC774470_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1017). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774471_HBx_P-RF-DC Product feature CHAIN KC774471_HBx_P-RF-DC of FT:mat_peptide KC774471_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774472_HBx_P-RF-DC Product feature CHAIN KC774472_HBx_P-RF-DC of FT:mat_peptide KC774472_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1020). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774474_HBx_P-RF-DC Product feature CHAIN KC774474_HBx_P-RF-DC of FT:mat_peptide KC774474_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1025). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774475_HBx_P-RF-DC Product feature CHAIN KC774475_HBx_P-RF-DC of FT:mat_peptide KC774475_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVFCQLDPAGDVLCLRPVAVVSRRWPMSGPVGSFRSPSSFAVPANHGAHLPIRGLPVCALASPGPCSLRFTCARCME
TTVNAHQVLPKVLHKRTSGLSAMLTTVLEAYFKACLFKEREELGEERRLKVLVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774476_HBx_P-RF-DC Product feature CHAIN KC774476_HBx_P-RF-DC of FT:mat_peptide KC774476_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1030). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRVWCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKALVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774478_HBx_P-RF-DC Product feature CHAIN KC774478_HBx_P-RF-DC of FT:mat_peptide KC774478_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1035). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774479_HBx_P-RF-DC Product feature CHAIN KC774479_HBx_P-RF-DC of FT:mat_peptide KC774479_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1036). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774480_HBx_P-RF-DC Product feature CHAIN KC774480_HBx_P-RF-DC of FT:mat_peptide KC774480_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1038). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774481_HBx_P-RF-DC Product feature CHAIN KC774481_HBx_P-RF-DC of FT:mat_peptide KC774481_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1039). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774482_HBx_P-RF-DC Product feature CHAIN KC774482_HBx_P-RF-DC of FT:mat_peptide KC774482_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1043). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KC774483_HBx_P-RF-DC Product feature CHAIN KC774483_HBx_P-RF-DC of FT:mat_peptide KC774483_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1047). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774484_HBx_P-RF-DC Product feature CHAIN KC774484_HBx_P-RF-DC of FT:mat_peptide KC774484_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1051). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774485_HBx_P-RF-DC Product feature CHAIN KC774485_HBx_P-RF-DC of FT:mat_peptide KC774485_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1058). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774486_HBx_P-RF-DC Product feature CHAIN KC774486_HBx_P-RF-DC of FT:mat_peptide KC774486_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1064). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSAFAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774487_HBx_P-RF-DC Product feature CHAIN KC774487_HBx_P-RF-DC of FT:mat_peptide KC774487_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1066). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KC774488_HBx_P-RF-DC Product feature CHAIN KC774488_HBx_P-RF-DC of FT:mat_peptide KC774488_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1077). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774489_HBx_P-RF-DC Product feature CHAIN KC774489_HBx_P-RF-DC of FT:mat_peptide KC774489_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1079). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774490_HBx_P-RF-DC Product feature CHAIN KC774490_HBx_P-RF-DC of FT:mat_peptide KC774490_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1082). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774492_HBx_P-RF-DC Product feature CHAIN KC774492_HBx_P-RF-DC of FT:mat_peptide KC774492_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1087). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KC774493_HBx_P-RF-DC Product feature CHAIN KC774493_HBx_P-RF-DC of FT:mat_peptide KC774493_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1089). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774494_HBx_P-RF-DC Product feature CHAIN KC774494_HBx_P-RF-DC of FT:mat_peptide KC774494_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1090). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774495_HBx_P-RF-DC Product feature CHAIN KC774495_HBx_P-RF-DC of FT:mat_peptide KC774495_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774497_HBx_P-RF-DC Product feature CHAIN KC774497_HBx_P-RF-DC of FT:mat_peptide KC774497_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1097). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KC774498_HBx_P-RF-DC Product feature CHAIN KC774498_HBx_P-RF-DC of FT:mat_peptide KC774498_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dyc1011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774499_HBx_P-RF-DC Product feature CHAIN KC774499_HBx_P-RF-DC of FT:mat_peptide KC774499_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dyc1018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875338_HBx_P-RF-DE Product feature CHAIN KC875338_HBx_P-RF-DE of FT:mat_peptide KC875338_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSMTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|KC875339_HBx_P-RF-DE Product feature CHAIN KC875339_HBx_P-RF-DE of FT:mat_peptide KC875339_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLELSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|KF170740_HBx_P-RF-DE Product feature CHAIN KF170740_HBx_P-RF-DE of FT:mat_peptide KF170740_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SDAC_031). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPPGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192833_HBx_P-RF-DE Product feature CHAIN KF192833_HBx_P-RF-DE of FT:mat_peptide KF192833_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP68). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCALSSAGPCALRFTYARCME
TTVNAHRILPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192835_HBx_P-RF-DE Product feature CHAIN KF192835_HBx_P-RF-DE of FT:mat_peptide KF192835_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192836_HBx_P-RF-DE Product feature CHAIN KF192836_HBx_P-RF-DE of FT:mat_peptide KF192836_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVYAPAPCNFFNSA
>gnl|hbvpro|KF192837_HBx_P-RF-DE Product feature CHAIN KF192837_HBx_P-RF-DE of FT:mat_peptide KF192837_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192838_HBx_P-RF-DE Product feature CHAIN KF192838_HBx_P-RF-DE of FT:mat_peptide KF192838_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF192839_HBx_P-RF-DE Product feature CHAIN KF192839_HBx_P-RF-DE of FT:mat_peptide KF192839_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFQDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192840_HBx_P-RF-DE Product feature CHAIN KF192840_HBx_P-RF-DE of FT:mat_peptide KF192840_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192841_HBx_P-RF-DE Product feature CHAIN KF192841_HBx_P-RF-DE of FT:mat_peptide KF192841_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF214656_HBx_P-RF-AC Product feature CHAIN KF214656_HBx_P-RF-AC of FT:mat_peptide KF214656_HBx_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate IND-2009-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDSSRDVLCIRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|KF214680_HBx_P-RF-GC Product feature CHAIN KF214680_HBx_P-RF-GC of FT:mat_peptide KF214680_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate IND-1963-3). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSPSSPAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHLTLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF219922_HBx_P-RF-GH Product feature CHAIN KF219922_HBx_P-RF-GH of FT:mat_peptide KF219922_HBx_P-RF-GH of [Viruses] Hepatitis B Virus recombinant form GH (isolate HBV201302). Complete genome. [Hepadnaviridae] (length=154 residues).
VAAGLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCSFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLXTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471643_HBx_P-RF-DE Product feature CHAIN KF471643_HBx_P-RF-DE of FT:mat_peptide KF471643_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate PG-60). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTVSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679991_HBx_P-RF-DE Product feature CHAIN KF679991_HBx_P-RF-DE of FT:mat_peptide KF679991_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EICI-74). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVSAHQILPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF873511_HBx_P-RF-CB Product feature CHAIN KF873511_HBx_P-RF-CB of FT:mat_peptide KF873511_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 010_EA_Ram). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873513_HBx_P-RF-CB Product feature CHAIN KF873513_HBx_P-RF-CB of FT:mat_peptide KF873513_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 024_K_Kal). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873515_HBx_P-RF-CB Product feature CHAIN KF873515_HBx_P-RF-CB of FT:mat_peptide KF873515_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 022_EA_Gap). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873517_HBx_P-RF-BC Product feature CHAIN KF873517_HBx_P-RF-BC of FT:mat_peptide KF873517_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 005_EA_Gal). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873518_HBx_P-RF-CB Product feature CHAIN KF873518_HBx_P-RF-CB of FT:mat_peptide KF873518_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 016_EA_Gap). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873519_HBx_P-RF-CB Product feature CHAIN KF873519_HBx_P-RF-CB of FT:mat_peptide KF873519_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 017_EA_Gun). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMATTDLEAYFKDCLFKDWEELGEEIRLKXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873521_HBx_P-RF-BC Product feature CHAIN KF873521_HBx_P-RF-BC of FT:mat_peptide KF873521_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 063_K_Ngk). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873522_HBx_P-RF-CB Product feature CHAIN KF873522_HBx_P-RF-CB of FT:mat_peptide KF873522_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 015_WA_Gou). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHGAXLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873523_HBx_P-RF-CB Product feature CHAIN KF873523_HBx_P-RF-CB of FT:mat_peptide KF873523_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 055_WA_Oen). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXVPSPSSSTVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873524_HBx_P-RF-CB Product feature CHAIN KF873524_HBx_P-RF-CB of FT:mat_peptide KF873524_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 039_WA_Oen). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873527_HBx_P-RF-CB Product feature CHAIN KF873527_HBx_P-RF-CB of FT:mat_peptide KF873527_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 052_K_Vic). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873530_HBx_P-RF-CB Product feature CHAIN KF873530_HBx_P-RF-CB of FT:mat_peptide KF873530_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 018_WAust_Wyn). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAEPRGRPVSGPLGDLXSPSSPAVPADHGTHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMMLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873531_HBx_P-RF-CB Product feature CHAIN KF873531_HBx_P-RF-CB of FT:mat_peptide KF873531_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 021_TI_Ngu). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSXMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873532_HBx_P-RF-CB Product feature CHAIN KF873532_HBx_P-RF-CB of FT:mat_peptide KF873532_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 031_TI_Ngu). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873533_HBx_P-RF-CB Product feature CHAIN KF873533_HBx_P-RF-CB of FT:mat_peptide KF873533_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 028_TI_Ngu). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873534_HBx_P-RF-CB Product feature CHAIN KF873534_HBx_P-RF-CB of FT:mat_peptide KF873534_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 019_TI_Ngu). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873535_HBx_P-RF-CB Product feature CHAIN KF873535_HBx_P-RF-CB of FT:mat_peptide KF873535_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 027_TI_Mil). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHMSLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873537_HBx_P-RF-CB Product feature CHAIN KF873537_HBx_P-RF-CB of FT:mat_peptide KF873537_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 045_DR_Wad). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRMA
TTVNAHMXLPKVLHKRTLGLSTXSTTDLEAYFKDCVFKDWEELGEEIRLXIFVXGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873538_HBx_P-RF-CB Product feature CHAIN KF873538_HBx_P-RF-CB of FT:mat_peptide KF873538_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 059_DR_Wad). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRMA
TTVNAHMILPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873540_HBx_P-RF-CB Product feature CHAIN KF873540_HBx_P-RF-CB of FT:mat_peptide KF873540_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 003_DR_Dal). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCXLDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRMA
TTVNAHMILPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873542_HBx_P-RF-CB Product feature CHAIN KF873542_HBx_P-RF-CB of FT:mat_peptide KF873542_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 038_DR_Wad). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRMA
TTVNAHMILPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873543_HBx_P-RF-CB Product feature CHAIN KF873543_HBx_P-RF-CB of FT:mat_peptide KF873543_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 050_DR_Wad). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRMA
TTVNAHMILPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF917451_HBx_P-RF-DC Product feature CHAIN KF917451_HBx_P-RF-DC of FT:mat_peptide KF917451_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate YN.071). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173279_HBx_P-RF-CB Product feature CHAIN KJ173279_HBx_P-RF-CB of FT:mat_peptide KJ173279_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX004C(e207)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173280_HBx_P-RF-CB Product feature CHAIN KJ173280_HBx_P-RF-CB of FT:mat_peptide KJ173280_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX004M(e208)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173299_HBx_P-RF-CB Product feature CHAIN KJ173299_HBx_P-RF-CB of FT:mat_peptide KJ173299_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HS005C(e22)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADYGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173300_HBx_P-RF-CB Product feature CHAIN KJ173300_HBx_P-RF-CB of FT:mat_peptide KJ173300_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HS005M(e23)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADYGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173320_HBx_P-RF-CB Product feature CHAIN KJ173320_HBx_P-RF-CB of FT:mat_peptide KJ173320_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate NH29M(e41)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQNLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173322_HBx_P-RF-CB Product feature CHAIN KJ173322_HBx_P-RF-CB of FT:mat_peptide KJ173322_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate NH30M(e41)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQNLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173325_HBx_P-RF-CB Product feature CHAIN KJ173325_HBx_P-RF-CB of FT:mat_peptide KJ173325_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P004-C(012)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173326_HBx_P-RF-CB Product feature CHAIN KJ173326_HBx_P-RF-CB of FT:mat_peptide KJ173326_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P004-M(014)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173329_HBx_P-RF-CB Product feature CHAIN KJ173329_HBx_P-RF-CB of FT:mat_peptide KJ173329_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P011-C(b168)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173330_HBx_P-RF-CB Product feature CHAIN KJ173330_HBx_P-RF-CB of FT:mat_peptide KJ173330_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P011-M2(170)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173349_HBx_P-RF-CB Product feature CHAIN KJ173349_HBx_P-RF-CB of FT:mat_peptide KJ173349_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX017C(e226)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173350_HBx_P-RF-CB Product feature CHAIN KJ173350_HBx_P-RF-CB of FT:mat_peptide KJ173350_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX017M(e227)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173358_HBx_P-RF-CB Product feature CHAIN KJ173358_HBx_P-RF-CB of FT:mat_peptide KJ173358_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX065M(e314)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410497_HBx_P-RF-BC Product feature CHAIN KJ410497_HBx_P-RF-BC of FT:mat_peptide KJ410497_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate HK_1325). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410506_HBx_P-RF-CB Product feature CHAIN KJ410506_HBx_P-RF-CB of FT:mat_peptide KJ410506_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Occult_HK526). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410520_HBx_P-RF-CB Product feature CHAIN KJ410520_HBx_P-RF-CB of FT:mat_peptide KJ410520_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Occult_HK4869). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALHFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ470884_HBx_P-RF-DE Product feature CHAIN KJ470884_HBx_P-RF-DE of FT:mat_peptide KJ470884_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8145). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|KJ470886_HBx_P-RF-DE Product feature CHAIN KJ470886_HBx_P-RF-DE of FT:mat_peptide KJ470886_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8117). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|KJ470887_HBx_P-RF-DE Product feature CHAIN KJ470887_HBx_P-RF-DE of FT:mat_peptide KJ470887_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8064). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|KJ470888_HBx_P-RF-DE Product feature CHAIN KJ470888_HBx_P-RF-DE of FT:mat_peptide KJ470888_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8035). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|KJ470890_HBx_P-RF-DE Product feature CHAIN KJ470890_HBx_P-RF-DE of FT:mat_peptide KJ470890_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|KJ470891_HBx_P-RF-DE Product feature CHAIN KJ470891_HBx_P-RF-DE of FT:mat_peptide KJ470891_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ470892_HBx_P-RF-DE Product feature CHAIN KJ470892_HBx_P-RF-DE of FT:mat_peptide KJ470892_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8022). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQIQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ470897_HBx_P-RF-DE Product feature CHAIN KJ470897_HBx_P-RF-DE of FT:mat_peptide KJ470897_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8016). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ470898_HBx_P-RF-DE Product feature CHAIN KJ470898_HBx_P-RF-DE of FT:mat_peptide KJ470898_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8142). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ586803_HBx_P-RF-AF Product feature CHAIN KJ586803_HBx_P-RF-AF of FT:mat_peptide KJ586803_HBx_P-RF-AF of [Viruses] Hepatitis B Virus recombinant form AF. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLHFFWGSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ586810_HBx_P-RF-AF Product feature CHAIN KJ586810_HBx_P-RF-AF of FT:mat_peptide KJ586810_HBx_P-RF-AF of [Viruses] Hepatitis B Virus recombinant form AF. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KJ586811_HBx_P-RF-DF Product feature CHAIN KJ586811_HBx_P-RF-DF of FT:mat_peptide KJ586811_HBx_P-RF-DF of [Viruses] Hepatitis B Virus recombinant form DF. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHILPKVLHKRTFGLFAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ598675_HBx_P-RF-CB Product feature CHAIN KJ598675_HBx_P-RF-CB of FT:mat_peptide KJ598675_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SHB3B2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ647349_HBx_P-RF-DE Product feature CHAIN KJ647349_HBx_P-RF-DE of FT:mat_peptide KJ647349_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV156). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ647351_HBx_P-RF-DE Product feature CHAIN KJ647351_HBx_P-RF-DE of FT:mat_peptide KJ647351_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV202). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|KJ647356_HBx_P-RF-DE Product feature CHAIN KJ647356_HBx_P-RF-DE of FT:mat_peptide KJ647356_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV249). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ803753_HBx_P-RF-CB Product feature CHAIN KJ803753_HBx_P-RF-CB of FT:mat_peptide KJ803753_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY515920). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSSSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803771_HBx_P-RF-DB Product feature CHAIN KJ803771_HBx_P-RF-DB of FT:mat_peptide KJ803771_HBx_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate MY62981). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803772_HBx_P-RF-BC Product feature CHAIN KJ803772_HBx_P-RF-BC of FT:mat_peptide KJ803772_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY816598). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPSAVSTDNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803778_HBx_P-RF-BC Product feature CHAIN KJ803778_HBx_P-RF-BC of FT:mat_peptide KJ803778_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY753983). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803782_HBx_P-RF-CB Product feature CHAIN KJ803782_HBx_P-RF-CB of FT:mat_peptide KJ803782_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY34118). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIKVKVFVLGGCWHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803785_HBx_P-RF-CB Product feature CHAIN KJ803785_HBx_P-RF-CB of FT:mat_peptide KJ803785_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY34920). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803788_HBx_P-RF-CB Product feature CHAIN KJ803788_HBx_P-RF-CB of FT:mat_peptide KJ803788_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY541105). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVPGSLGALPAASSSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQDFPSGLHKRTLGLSAMSTTDVEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803791_HBx_P-RF-CB Product feature CHAIN KJ803791_HBx_P-RF-CB of FT:mat_peptide KJ803791_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY824318). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803798_HBx_P-RF-CB Product feature CHAIN KJ803798_HBx_P-RF-CB of FT:mat_peptide KJ803798_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY464961). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803802_HBx_P-RF-CB Product feature CHAIN KJ803802_HBx_P-RF-CB of FT:mat_peptide KJ803802_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY604675). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803803_HBx_P-RF-CB Product feature CHAIN KJ803803_HBx_P-RF-CB of FT:mat_peptide KJ803803_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY501032). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803804_HBx_P-RF-CB Product feature CHAIN KJ803804_HBx_P-RF-CB of FT:mat_peptide KJ803804_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY590465). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEGSMLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ803822_HBx_P-RF-CB Product feature CHAIN KJ803822_HBx_P-RF-CB of FT:mat_peptide KJ803822_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY091938). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARHMA
TTVNAHQALPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSS
>gnl|hbvpro|KJ803827_HBx_P-RF-BC Product feature CHAIN KJ803827_HBx_P-RF-BC of FT:mat_peptide KJ803827_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY830498). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQDLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM213033_HBx_P-RF-CB Product feature CHAIN KM213033_HBx_P-RF-CB of FT:mat_peptide KM213033_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WSQ-k1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KM359442_HBx_P-RF-DE Product feature CHAIN KM359442_HBx_P-RF-DE of FT:mat_peptide KM359442_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate CM4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEHRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM386676_HBx_P-RF-DE Product feature CHAIN KM386676_HBx_P-RF-DE of FT:mat_peptide KM386676_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate CM1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524336_HBx_P-RF-DE Product feature CHAIN KM524336_HBx_P-RF-DE of FT:mat_peptide KM524336_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV010_EP-CHB). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524337_HBx_P-RF-DE Product feature CHAIN KM524337_HBx_P-RF-DE of FT:mat_peptide KM524337_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV013_EP-CHB). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGVCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524357_HBx_P-RF-DE Product feature CHAIN KM524357_HBx_P-RF-DE of FT:mat_peptide KM524357_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV.I-146_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524359_HBx_P-RF-DE Product feature CHAIN KM524359_HBx_P-RF-DE of FT:mat_peptide KM524359_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EHBV.I-058_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM577663_HBx_P-RF-DE Product feature CHAIN KM577663_HBx_P-RF-DE of FT:mat_peptide KM577663_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM577664_HBx_P-RF-DE Product feature CHAIN KM577664_HBx_P-RF-DE of FT:mat_peptide KM577664_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM577665_HBx_P-RF-DE Product feature CHAIN KM577665_HBx_P-RF-DE of FT:mat_peptide KM577665_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM577666_HBx_P-RF-DE Product feature CHAIN KM577666_HBx_P-RF-DE of FT:mat_peptide KM577666_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM577667_HBx_P-RF-DE Product feature CHAIN KM577667_HBx_P-RF-DE of FT:mat_peptide KM577667_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606741_HBx_P-RF-DE Product feature CHAIN KM606741_HBx_P-RF-DE of FT:mat_peptide KM606741_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Cuba53a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606750_HBx_P-RF-DE Product feature CHAIN KM606750_HBx_P-RF-DE of FT:mat_peptide KM606750_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Cuba60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606751_HBx_P-RF-DE Product feature CHAIN KM606751_HBx_P-RF-DE of FT:mat_peptide KM606751_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Cuba64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEITLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM875422_HBx_P-RF-CB Product feature CHAIN KM875422_HBx_P-RF-CB of FT:mat_peptide KM875422_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate pt12N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148337_HBx_P-RF-BC Product feature CHAIN KP148337_HBx_P-RF-BC of FT:mat_peptide KP148337_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D282-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148352_HBx_P-RF-CB Product feature CHAIN KP148352_HBx_P-RF-CB of FT:mat_peptide KP148352_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D71-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP148441_HBx_P-RF-GC Product feature CHAIN KP148441_HBx_P-RF-GC of FT:mat_peptide KP148441_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y132-2-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHGAHLSLRGLPVCAFPSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAVSTTDLEAYFKDCVFKDWEGLGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148442_HBx_P-RF-BC Product feature CHAIN KP148442_HBx_P-RF-BC of FT:mat_peptide KP148442_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate Y132-2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAVSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148447_HBx_P-RF-GC Product feature CHAIN KP148447_HBx_P-RF-GC of FT:mat_peptide KP148447_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y132-2-22). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAVSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148449_HBx_P-RF-GC Product feature CHAIN KP148449_HBx_P-RF-GC of FT:mat_peptide KP148449_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y132-2-48). Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAVSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148450_HBx_P-RF-GC Product feature CHAIN KP148450_HBx_P-RF-GC of FT:mat_peptide KP148450_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y132-2-46). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAVSTTDLEAYFKDCVLKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP148586_HBx_P-RF-GC Product feature CHAIN KP148586_HBx_P-RF-GC of FT:mat_peptide KP148586_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate Y50-13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLEDLPSSSSSAVPSVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAVSTTDLEAYFKDCAFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTS
>gnl|hbvpro|KP168416_HBx_P-RF-DE Product feature CHAIN KP168416_HBx_P-RF-DE of FT:mat_peptide KP168416_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD422). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGVESCGRPVSGPLGAFSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168417_HBx_P-RF-DE Product feature CHAIN KP168417_HBx_P-RF-DE of FT:mat_peptide KP168417_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD429). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168418_HBx_P-RF-DE Product feature CHAIN KP168418_HBx_P-RF-DE of FT:mat_peptide KP168418_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD416). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168420_HBx_P-RF-DE Product feature CHAIN KP168420_HBx_P-RF-DE of FT:mat_peptide KP168420_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD428). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPFCAESCGRPFSGPIGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLQXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168421_HBx_P-RF-DE Product feature CHAIN KP168421_HBx_P-RF-DE of FT:mat_peptide KP168421_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD401). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPFCAESCGRPFSGPLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP274926_HBx_P-RF-GA Product feature CHAIN KP274926_HBx_P-RF-GA of FT:mat_peptide KP274926_HBx_P-RF-GA of [Viruses] Hepatitis B Virus recombinant form GA (isolate GS-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TAMNTSHHLPRQLYKRTLGLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP276253_HBx_P-RF-DC Product feature CHAIN KP276253_HBx_P-RF-DC of FT:mat_peptide KP276253_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1874). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP276254_HBx_P-RF-DC Product feature CHAIN KP276254_HBx_P-RF-DC of FT:mat_peptide KP276254_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1887). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP276255_HBx_P-RF-DC Product feature CHAIN KP276255_HBx_P-RF-DC of FT:mat_peptide KP276255_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1888). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP276256_HBx_P-RF-DC Product feature CHAIN KP276256_HBx_P-RF-DC of FT:mat_peptide KP276256_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1925). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KP288875_HBx_P-RF-DE Product feature CHAIN KP288875_HBx_P-RF-DE of FT:mat_peptide KP288875_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate PatC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP995112_HBx_P-RF-DE Product feature CHAIN KP995112_HBx_P-RF-DE of FT:mat_peptide KP995112_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 1925-HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR013806_HBx_P-RF-CB Product feature CHAIN KR013806_HBx_P-RF-CB of FT:mat_peptide KR013806_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KR013816_HBx_P-RF-CB Product feature CHAIN KR013816_HBx_P-RF-CB of FT:mat_peptide KR013816_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KR013843_HBx_P-RF-CB Product feature CHAIN KR013843_HBx_P-RF-CB of FT:mat_peptide KR013843_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KR905422_HBx_P-RF-DE Product feature CHAIN KR905422_HBx_P-RF-DE of FT:mat_peptide KR905422_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EICI-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT003704_HBx_P-RF-CB Product feature CHAIN KT003704_HBx_P-RF-CB of FT:mat_peptide KT003704_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IND-DIB-RMRC-667). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPAPHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KT366492_HBx_P-RF-DE Product feature CHAIN KT366492_HBx_P-RF-DE of FT:mat_peptide KT366492_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366503_HBx_P-RF-DE Product feature CHAIN KT366503_HBx_P-RF-DE of FT:mat_peptide KT366503_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366504_HBx_P-RF-DE Product feature CHAIN KT366504_HBx_P-RF-DE of FT:mat_peptide KT366504_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KT366505_HBx_P-RF-DE Product feature CHAIN KT366505_HBx_P-RF-DE of FT:mat_peptide KT366505_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT991417_HBx_P-RF-DC Product feature CHAIN KT991417_HBx_P-RF-DC of FT:mat_peptide KT991417_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KT991419_HBx_P-RF-DC Product feature CHAIN KT991419_HBx_P-RF-DC of FT:mat_peptide KT991419_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KT991420_HBx_P-RF-DC Product feature CHAIN KT991420_HBx_P-RF-DC of FT:mat_peptide KT991420_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KT991421_HBx_P-RF-DC Product feature CHAIN KT991421_HBx_P-RF-DC of FT:mat_peptide KT991421_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KT991423_HBx_P-RF-DC Product feature CHAIN KT991423_HBx_P-RF-DC of FT:mat_peptide KT991423_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KT991424_HBx_P-RF-DC Product feature CHAIN KT991424_HBx_P-RF-DC of FT:mat_peptide KT991424_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KT991427_HBx_P-RF-DC Product feature CHAIN KT991427_HBx_P-RF-DC of FT:mat_peptide KT991427_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113-2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU519422_HBx_P-RF-DC Product feature CHAIN KU519422_HBx_P-RF-DC of FT:mat_peptide KU519422_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLinzhi-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSFSAVPAAHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU519423_HBx_P-RF-DC Product feature CHAIN KU519423_HBx_P-RF-DC of FT:mat_peptide KU519423_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLinzhi-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU668440_HBx_P-RF-DE Product feature CHAIN KU668440_HBx_P-RF-DE of FT:mat_peptide KU668440_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-HCV169). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALCFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELEEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU679939_HBx_P-RF-CB Product feature CHAIN KU679939_HBx_P-RF-CB of FT:mat_peptide KU679939_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 083_WA_Man). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPPSSAVPADHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679940_HBx_P-RF-CB Product feature CHAIN KU679940_HBx_P-RF-CB of FT:mat_peptide KU679940_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 084_WA_Man). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679941_HBx_P-RF-CB Product feature CHAIN KU679941_HBx_P-RF-CB of FT:mat_peptide KU679941_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 087_WA_Jab). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679942_HBx_P-RF-CB Product feature CHAIN KU679942_HBx_P-RF-CB of FT:mat_peptide KU679942_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 094_CA_Mim). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679943_HBx_P-RF-BC Product feature CHAIN KU679943_HBx_P-RF-BC of FT:mat_peptide KU679943_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 096_CA_Mim). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVXXLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679944_HBx_P-RF-BC Product feature CHAIN KU679944_HBx_P-RF-BC of FT:mat_peptide KU679944_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 097_EA_Mil). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679945_HBx_P-RF-CB Product feature CHAIN KU679945_HBx_P-RF-CB of FT:mat_peptide KU679945_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 098_DR_Wad). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCELDPTRDVLRLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRMA
TTVNAHMILPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEETRLXIXVLGGCRHKLVCSPXPXNFFTSA
>gnl|hbvpro|KU679946_HBx_P-RF-BC Product feature CHAIN KU679946_HBx_P-RF-BC of FT:mat_peptide KU679946_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 100_EA_Gal). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679948_HBx_P-RF-CB Product feature CHAIN KU679948_HBx_P-RF-CB of FT:mat_peptide KU679948_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 103_EA_Gap). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLAALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIXVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679950_HBx_P-RF-CB Product feature CHAIN KU679950_HBx_P-RF-CB of FT:mat_peptide KU679950_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 108_EA_Gal). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU679952_HBx_P-RF-CB Product feature CHAIN KU679952_HBx_P-RF-CB of FT:mat_peptide KU679952_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 114_TI_Ngu). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVXRPLGDLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679953_HBx_P-RF-BC Product feature CHAIN KU679953_HBx_P-RF-BC of FT:mat_peptide KU679953_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 116_EA_Num). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTXARRME
TTVNTHMILPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679954_HBx_P-RF-CB Product feature CHAIN KU679954_HBx_P-RF-CB of FT:mat_peptide KU679954_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 119_CA_Ood). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679955_HBx_P-RF-CB Product feature CHAIN KU679955_HBx_P-RF-CB of FT:mat_peptide KU679955_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 120_K_Ngk). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPXSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679956_HBx_P-RF-CB Product feature CHAIN KU679956_HBx_P-RF-CB of FT:mat_peptide KU679956_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 121_CA_Tit). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAXPADBGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLXXMSTTDLEAYFKDCLFKDWEELGEEXRLKXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU679958_HBx_P-RF-CB Product feature CHAIN KU679958_HBx_P-RF-CB of FT:mat_peptide KU679958_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 125_WA_War). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGDVPSPSSSTVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTXNAHMSLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPXPCNFFTSA
>gnl|hbvpro|KU695741_HBx_P-RF-CB Product feature CHAIN KU695741_HBx_P-RF-CB of FT:mat_peptide KU695741_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU695742_HBx_P-RF-CB Product feature CHAIN KU695742_HBx_P-RF-CB of FT:mat_peptide KU695742_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5072). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPSRDVLCLRPVGAESRGRPVAGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU695743_HBx_P-RF-CB Product feature CHAIN KU695743_HBx_P-RF-CB of FT:mat_peptide KU695743_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5073). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU695744_HBx_P-RF-CB Product feature CHAIN KU695744_HBx_P-RF-CB of FT:mat_peptide KU695744_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5075). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPFGDVPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU695745_HBx_P-RF-CB Product feature CHAIN KU695745_HBx_P-RF-CB of FT:mat_peptide KU695745_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5081). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSXDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU695746_HBx_P-RF-CB Product feature CHAIN KU695746_HBx_P-RF-CB of FT:mat_peptide KU695746_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5093). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPLGDLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU711666_HBx_P-RF-DE Product feature CHAIN KU711666_HBx_P-RF-DE of FT:mat_peptide KU711666_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 007N). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLKSSK
>gnl|hbvpro|KU736914_HBx_P-RF-DE Product feature CHAIN KU736914_HBx_P-RF-DE of FT:mat_peptide KU736914_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736915_HBx_P-RF-DE Product feature CHAIN KU736915_HBx_P-RF-DE of FT:mat_peptide KU736915_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736916_HBx_P-RF-DE Product feature CHAIN KU736916_HBx_P-RF-DE of FT:mat_peptide KU736916_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Sudan_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPLGDLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736917_HBx_P-RF-DE Product feature CHAIN KU736917_HBx_P-RF-DE of FT:mat_peptide KU736917_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Sudan_19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSPSLPAVPTDHGAHLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736921_HBx_P-RF-DE Product feature CHAIN KU736921_HBx_P-RF-DE of FT:mat_peptide KU736921_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGTLGTLPSPSLLAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736922_HBx_P-RF-DE Product feature CHAIN KU736922_HBx_P-RF-DE of FT:mat_peptide KU736922_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGTLGTLPSPSLLAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736923_HBx_P-RF-DE Product feature CHAIN KU736923_HBx_P-RF-DE of FT:mat_peptide KU736923_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Somalia_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU963856_HBx_P-RF-CB Product feature CHAIN KU963856_HBx_P-RF-CB of FT:mat_peptide KU963856_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963857_HBx_P-RF-CB Product feature CHAIN KU963857_HBx_P-RF-CB of FT:mat_peptide KU963857_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963858_HBx_P-RF-CB Product feature CHAIN KU963858_HBx_P-RF-CB of FT:mat_peptide KU963858_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963859_HBx_P-RF-CB Product feature CHAIN KU963859_HBx_P-RF-CB of FT:mat_peptide KU963859_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963860_HBx_P-RF-CB Product feature CHAIN KU963860_HBx_P-RF-CB of FT:mat_peptide KU963860_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963861_HBx_P-RF-CB Product feature CHAIN KU963861_HBx_P-RF-CB of FT:mat_peptide KU963861_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963862_HBx_P-RF-CB Product feature CHAIN KU963862_HBx_P-RF-CB of FT:mat_peptide KU963862_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963863_HBx_P-RF-CB Product feature CHAIN KU963863_HBx_P-RF-CB of FT:mat_peptide KU963863_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963864_HBx_P-RF-CB Product feature CHAIN KU963864_HBx_P-RF-CB of FT:mat_peptide KU963864_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963865_HBx_P-RF-CB Product feature CHAIN KU963865_HBx_P-RF-CB of FT:mat_peptide KU963865_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963866_HBx_P-RF-CB Product feature CHAIN KU963866_HBx_P-RF-CB of FT:mat_peptide KU963866_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963867_HBx_P-RF-CB Product feature CHAIN KU963867_HBx_P-RF-CB of FT:mat_peptide KU963867_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963868_HBx_P-RF-CB Product feature CHAIN KU963868_HBx_P-RF-CB of FT:mat_peptide KU963868_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963869_HBx_P-RF-CB Product feature CHAIN KU963869_HBx_P-RF-CB of FT:mat_peptide KU963869_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963870_HBx_P-RF-CB Product feature CHAIN KU963870_HBx_P-RF-CB of FT:mat_peptide KU963870_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963883_HBx_P-RF-CB Product feature CHAIN KU963883_HBx_P-RF-CB of FT:mat_peptide KU963883_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 6_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU963930_HBx_P-RF-CB Product feature CHAIN KU963930_HBx_P-RF-CB of FT:mat_peptide KU963930_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963931_HBx_P-RF-CB Product feature CHAIN KU963931_HBx_P-RF-CB of FT:mat_peptide KU963931_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_2). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963932_HBx_P-RF-CB Product feature CHAIN KU963932_HBx_P-RF-CB of FT:mat_peptide KU963932_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_3). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963933_HBx_P-RF-CB Product feature CHAIN KU963933_HBx_P-RF-CB of FT:mat_peptide KU963933_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_4). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963934_HBx_P-RF-CB Product feature CHAIN KU963934_HBx_P-RF-CB of FT:mat_peptide KU963934_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_5). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963935_HBx_P-RF-CB Product feature CHAIN KU963935_HBx_P-RF-CB of FT:mat_peptide KU963935_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_6). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963936_HBx_P-RF-CB Product feature CHAIN KU963936_HBx_P-RF-CB of FT:mat_peptide KU963936_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAVSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963938_HBx_P-RF-CB Product feature CHAIN KU963938_HBx_P-RF-CB of FT:mat_peptide KU963938_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_9). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLDAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963939_HBx_P-RF-CB Product feature CHAIN KU963939_HBx_P-RF-CB of FT:mat_peptide KU963939_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_10). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963940_HBx_P-RF-CB Product feature CHAIN KU963940_HBx_P-RF-CB of FT:mat_peptide KU963940_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_11). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCELRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963941_HBx_P-RF-CB Product feature CHAIN KU963941_HBx_P-RF-CB of FT:mat_peptide KU963941_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_12). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963942_HBx_P-RF-CB Product feature CHAIN KU963942_HBx_P-RF-CB of FT:mat_peptide KU963942_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_13). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963943_HBx_P-RF-CB Product feature CHAIN KU963943_HBx_P-RF-CB of FT:mat_peptide KU963943_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_14). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963944_HBx_P-RF-CB Product feature CHAIN KU963944_HBx_P-RF-CB of FT:mat_peptide KU963944_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 10_15). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963990_HBx_P-RF-CB Product feature CHAIN KU963990_HBx_P-RF-CB of FT:mat_peptide KU963990_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963991_HBx_P-RF-CB Product feature CHAIN KU963991_HBx_P-RF-CB of FT:mat_peptide KU963991_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963993_HBx_P-RF-CB Product feature CHAIN KU963993_HBx_P-RF-CB of FT:mat_peptide KU963993_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963994_HBx_P-RF-CB Product feature CHAIN KU963994_HBx_P-RF-CB of FT:mat_peptide KU963994_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963995_HBx_P-RF-CB Product feature CHAIN KU963995_HBx_P-RF-CB of FT:mat_peptide KU963995_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963998_HBx_P-RF-CB Product feature CHAIN KU963998_HBx_P-RF-CB of FT:mat_peptide KU963998_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU963999_HBx_P-RF-CB Product feature CHAIN KU963999_HBx_P-RF-CB of FT:mat_peptide KU963999_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964001_HBx_P-RF-CB Product feature CHAIN KU964001_HBx_P-RF-CB of FT:mat_peptide KU964001_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964003_HBx_P-RF-CB Product feature CHAIN KU964003_HBx_P-RF-CB of FT:mat_peptide KU964003_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964005_HBx_P-RF-CB Product feature CHAIN KU964005_HBx_P-RF-CB of FT:mat_peptide KU964005_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964006_HBx_P-RF-CB Product feature CHAIN KU964006_HBx_P-RF-CB of FT:mat_peptide KU964006_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964007_HBx_P-RF-CB Product feature CHAIN KU964007_HBx_P-RF-CB of FT:mat_peptide KU964007_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964008_HBx_P-RF-CB Product feature CHAIN KU964008_HBx_P-RF-CB of FT:mat_peptide KU964008_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964009_HBx_P-RF-CB Product feature CHAIN KU964009_HBx_P-RF-CB of FT:mat_peptide KU964009_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964010_HBx_P-RF-CB Product feature CHAIN KU964010_HBx_P-RF-CB of FT:mat_peptide KU964010_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964303_HBx_P-RF-CB Product feature CHAIN KU964303_HBx_P-RF-CB of FT:mat_peptide KU964303_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964304_HBx_P-RF-CB Product feature CHAIN KU964304_HBx_P-RF-CB of FT:mat_peptide KU964304_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964305_HBx_P-RF-CB Product feature CHAIN KU964305_HBx_P-RF-CB of FT:mat_peptide KU964305_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964306_HBx_P-RF-CB Product feature CHAIN KU964306_HBx_P-RF-CB of FT:mat_peptide KU964306_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964307_HBx_P-RF-CB Product feature CHAIN KU964307_HBx_P-RF-CB of FT:mat_peptide KU964307_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964308_HBx_P-RF-CB Product feature CHAIN KU964308_HBx_P-RF-CB of FT:mat_peptide KU964308_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALHFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964309_HBx_P-RF-CB Product feature CHAIN KU964309_HBx_P-RF-CB of FT:mat_peptide KU964309_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964310_HBx_P-RF-CB Product feature CHAIN KU964310_HBx_P-RF-CB of FT:mat_peptide KU964310_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964311_HBx_P-RF-CB Product feature CHAIN KU964311_HBx_P-RF-CB of FT:mat_peptide KU964311_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964312_HBx_P-RF-CB Product feature CHAIN KU964312_HBx_P-RF-CB of FT:mat_peptide KU964312_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964313_HBx_P-RF-CB Product feature CHAIN KU964313_HBx_P-RF-CB of FT:mat_peptide KU964313_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964314_HBx_P-RF-CB Product feature CHAIN KU964314_HBx_P-RF-CB of FT:mat_peptide KU964314_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964315_HBx_P-RF-CB Product feature CHAIN KU964315_HBx_P-RF-CB of FT:mat_peptide KU964315_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964316_HBx_P-RF-CB Product feature CHAIN KU964316_HBx_P-RF-CB of FT:mat_peptide KU964316_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964317_HBx_P-RF-CB Product feature CHAIN KU964317_HBx_P-RF-CB of FT:mat_peptide KU964317_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964351_HBx_P-RF-CB Product feature CHAIN KU964351_HBx_P-RF-CB of FT:mat_peptide KU964351_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 39_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964366_HBx_P-RF-DC Product feature CHAIN KU964366_HBx_P-RF-DC of FT:mat_peptide KU964366_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_1). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKWTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964367_HBx_P-RF-DC Product feature CHAIN KU964367_HBx_P-RF-DC of FT:mat_peptide KU964367_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_2). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKWTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964370_HBx_P-RF-DC Product feature CHAIN KU964370_HBx_P-RF-DC of FT:mat_peptide KU964370_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_5). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKWTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964372_HBx_P-RF-DC Product feature CHAIN KU964372_HBx_P-RF-DC of FT:mat_peptide KU964372_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_7). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKWTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964374_HBx_P-RF-DC Product feature CHAIN KU964374_HBx_P-RF-DC of FT:mat_peptide KU964374_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_9). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKWTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964379_HBx_P-RF-DC Product feature CHAIN KU964379_HBx_P-RF-DC of FT:mat_peptide KU964379_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_14). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAAGLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKWTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KU964380_HBx_P-RF-DC Product feature CHAIN KU964380_HBx_P-RF-DC of FT:mat_peptide KU964380_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 40_15). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKWTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX096713_HBx_P-RF-CA Product feature CHAIN KX096713_HBx_P-RF-CA of FT:mat_peptide KX096713_HBx_P-RF-CA of [Viruses] Hepatitis B Virus recombinant form CA. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKKTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX354997_HBx_P-RF-DC Product feature CHAIN KX354997_HBx_P-RF-DC of FT:mat_peptide KX354997_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate B118_2012_CD). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVQERCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX357623_HBx_P-RF-DE Product feature CHAIN KX357623_HBx_P-RF-DE of FT:mat_peptide KX357623_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL43ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357624_HBx_P-RF-DE Product feature CHAIN KX357624_HBx_P-RF-DE of FT:mat_peptide KX357624_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GD65ETH). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357625_HBx_P-RF-DE Product feature CHAIN KX357625_HBx_P-RF-DE of FT:mat_peptide KX357625_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL60ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357626_HBx_P-RF-DE Product feature CHAIN KX357626_HBx_P-RF-DE of FT:mat_peptide KX357626_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA164ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357627_HBx_P-RF-DE Product feature CHAIN KX357627_HBx_P-RF-DE of FT:mat_peptide KX357627_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MK75ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPNHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KX357628_HBx_P-RF-DE Product feature CHAIN KX357628_HBx_P-RF-DE of FT:mat_peptide KX357628_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL70ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|KX357629_HBx_P-RF-DE Product feature CHAIN KX357629_HBx_P-RF-DE of FT:mat_peptide KX357629_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL63ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGTLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KX357630_HBx_P-RF-DE Product feature CHAIN KX357630_HBx_P-RF-DE of FT:mat_peptide KX357630_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA124ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVLVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357631_HBx_P-RF-DE Product feature CHAIN KX357631_HBx_P-RF-DE of FT:mat_peptide KX357631_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MK152ETH). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDDGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGRRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KX357632_HBx_P-RF-DE Product feature CHAIN KX357632_HBx_P-RF-DE of FT:mat_peptide KX357632_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA141ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357633_HBx_P-RF-DE Product feature CHAIN KX357633_HBx_P-RF-DE of FT:mat_peptide KX357633_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GD69ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357634_HBx_P-RF-DE Product feature CHAIN KX357634_HBx_P-RF-DE of FT:mat_peptide KX357634_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA33ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357635_HBx_P-RF-DE Product feature CHAIN KX357635_HBx_P-RF-DE of FT:mat_peptide KX357635_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GD39ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357636_HBx_P-RF-DE Product feature CHAIN KX357636_HBx_P-RF-DE of FT:mat_peptide KX357636_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MK74ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357641_HBx_P-RF-DE Product feature CHAIN KX357641_HBx_P-RF-DE of FT:mat_peptide KX357641_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MK141ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVCAESCGRPFSGPIGDLPSPSPPAVPTDHGAHLSLRGLPVCAFSSAGTCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX660674_HBx_P-RF-DC Product feature CHAIN KX660674_HBx_P-RF-DC of FT:mat_peptide KX660674_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX660675_HBx_P-RF-DC Product feature CHAIN KX660675_HBx_P-RF-DC of FT:mat_peptide KX660675_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPITGPSGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX660677_HBx_P-RF-DC Product feature CHAIN KX660677_HBx_P-RF-DC of FT:mat_peptide KX660677_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX660680_HBx_P-RF-DC Product feature CHAIN KX660680_HBx_P-RF-DC of FT:mat_peptide KX660680_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX660682_HBx_P-RF-DC Product feature CHAIN KX660682_HBx_P-RF-DC of FT:mat_peptide KX660682_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLahsa). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAAXVCCQLDPARDVLCLRPVGAESRGRPXSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGACRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX660684_HBx_P-RF-DC Product feature CHAIN KX660684_HBx_P-RF-DC of FT:mat_peptide KX660684_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetShannan-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX660685_HBx_P-RF-DC Product feature CHAIN KX660685_HBx_P-RF-DC of FT:mat_peptide KX660685_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetShannan-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLEGCRHKLVSPSAPCNFFTSA
>gnl|hbvpro|KX660686_HBx_P-RF-DC Product feature CHAIN KX660686_HBx_P-RF-DC of FT:mat_peptide KX660686_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetRikaze-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX660689_HBx_P-RF-DC Product feature CHAIN KX660689_HBx_P-RF-DC of FT:mat_peptide KX660689_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetRikaze-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX765835_HBx_P-RF-GC Product feature CHAIN KX765835_HBx_P-RF-GC of FT:mat_peptide KX765835_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate PID:0725). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNSSQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX774505_HBx_P-RF-BC Product feature CHAIN KX774505_HBx_P-RF-BC of FT:mat_peptide KX774505_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate PID:0394). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSALPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KX827299_HBx_P-RF-DE Product feature CHAIN KX827299_HBx_P-RF-DE of FT:mat_peptide KX827299_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate geno20.11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827302_HBx_P-RF-DE Product feature CHAIN KX827302_HBx_P-RF-DE of FT:mat_peptide KX827302_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate geno31.9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTADLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY363262_HBx_P-RF-CB Product feature CHAIN KY363262_HBx_P-RF-CB of FT:mat_peptide KY363262_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate geno6.1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY363263_HBx_P-RF-CB Product feature CHAIN KY363263_HBx_P-RF-CB of FT:mat_peptide KY363263_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY363272_HBx_P-RF-CB Product feature CHAIN KY363272_HBx_P-RF-CB of FT:mat_peptide KY363272_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate geno13.1). Partial genome (Contains: HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLPLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY363273_HBx_P-RF-CB Product feature CHAIN KY363273_HBx_P-RF-CB of FT:mat_peptide KY363273_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate geno13.2). Partial genome (Contains: HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470843_HBx_P-RF-DC Product feature CHAIN KY470843_HBx_P-RF-DC of FT:mat_peptide KY470843_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-10-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470844_HBx_P-RF-DC Product feature CHAIN KY470844_HBx_P-RF-DC of FT:mat_peptide KY470844_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-109). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
IAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470845_HBx_P-RF-DC Product feature CHAIN KY470845_HBx_P-RF-DC of FT:mat_peptide KY470845_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-113). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRIE
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470846_HBx_P-RF-DC Product feature CHAIN KY470846_HBx_P-RF-DC of FT:mat_peptide KY470846_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-118). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470847_HBx_P-RF-DC Product feature CHAIN KY470847_HBx_P-RF-DC of FT:mat_peptide KY470847_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470848_HBx_P-RF-DC Product feature CHAIN KY470848_HBx_P-RF-DC of FT:mat_peptide KY470848_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-122). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRIE
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470849_HBx_P-RF-DC Product feature CHAIN KY470849_HBx_P-RF-DC of FT:mat_peptide KY470849_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-123). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470850_HBx_P-RF-DC Product feature CHAIN KY470850_HBx_P-RF-DC of FT:mat_peptide KY470850_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-124). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470851_HBx_P-RF-DC Product feature CHAIN KY470851_HBx_P-RF-DC of FT:mat_peptide KY470851_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-22). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRIE
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470852_HBx_P-RF-DC Product feature CHAIN KY470852_HBx_P-RF-DC of FT:mat_peptide KY470852_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-24). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRIE
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470853_HBx_P-RF-DC Product feature CHAIN KY470853_HBx_P-RF-DC of FT:mat_peptide KY470853_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVDAESRGRPVSGPFGSLSSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGDETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470854_HBx_P-RF-DC Product feature CHAIN KY470854_HBx_P-RF-DC of FT:mat_peptide KY470854_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470855_HBx_P-RF-DC Product feature CHAIN KY470855_HBx_P-RF-DC of FT:mat_peptide KY470855_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-9-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470858_HBx_P-RF-GC Product feature CHAIN KY470858_HBx_P-RF-GC of FT:mat_peptide KY470858_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate 2-24). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAVRLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLMLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEARLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470865_HBx_P-RF-GC Product feature CHAIN KY470865_HBx_P-RF-GC of FT:mat_peptide KY470865_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate 2-C03). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGGLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKILHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGDESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470871_HBx_P-RF-GC Product feature CHAIN KY470871_HBx_P-RF-GC of FT:mat_peptide KY470871_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate 2-26). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEETRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470893_HBx_P-RF-CB Product feature CHAIN KY470893_HBx_P-RF-CB of FT:mat_peptide KY470893_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 24-B1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470996_HBx_P-RF-GC Product feature CHAIN KY470996_HBx_P-RF-GC of FT:mat_peptide KY470996_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-31). Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470997_HBx_P-RF-GC Product feature CHAIN KY470997_HBx_P-RF-GC of FT:mat_peptide KY470997_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate LMX-C4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470998_HBx_P-RF-GC Product feature CHAIN KY470998_HBx_P-RF-GC of FT:mat_peptide KY470998_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-9-1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPPGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY470999_HBx_P-RF-GC Product feature CHAIN KY470999_HBx_P-RF-GC of FT:mat_peptide KY470999_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate LMX4-7). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY471000_HBx_P-RF-GC Product feature CHAIN KY471000_HBx_P-RF-GC of FT:mat_peptide KY471000_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate LMX-6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY471001_HBx_P-RF-GC Product feature CHAIN KY471001_HBx_P-RF-GC of FT:mat_peptide KY471001_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-7-1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPPGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY471002_HBx_P-RF-GC Product feature CHAIN KY471002_HBx_P-RF-GC of FT:mat_peptide KY471002_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-6-1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY471003_HBx_P-RF-GC Product feature CHAIN KY471003_HBx_P-RF-GC of FT:mat_peptide KY471003_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCMHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY471004_HBx_P-RF-GC Product feature CHAIN KY471004_HBx_P-RF-GC of FT:mat_peptide KY471004_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-14). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY471005_HBx_P-RF-GC Product feature CHAIN KY471005_HBx_P-RF-GC of FT:mat_peptide KY471005_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-11). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY471006_HBx_P-RF-GC Product feature CHAIN KY471006_HBx_P-RF-GC of FT:mat_peptide KY471006_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-7). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCMHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY471007_HBx_P-RF-GC Product feature CHAIN KY471007_HBx_P-RF-GC of FT:mat_peptide KY471007_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate lmx-1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY629632_HBx_P-RF-DC Product feature CHAIN KY629632_HBx_P-RF-DC of FT:mat_peptide KY629632_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate GSK1901). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY670781_HBx_P-RF-DC Product feature CHAIN KY670781_HBx_P-RF-DC of FT:mat_peptide KY670781_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TYM01067). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLXAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KY881840_HBx_P-RF-CB Product feature CHAIN KY881840_HBx_P-RF-CB of FT:mat_peptide KY881840_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient-03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSPSSLPVVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279263_HBx_P-RF-CB Product feature CHAIN LC279263_HBx_P-RF-CB of FT:mat_peptide LC279263_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_child_nail). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279264_HBx_P-RF-CB Product feature CHAIN LC279264_HBx_P-RF-CB of FT:mat_peptide LC279264_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_hair). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLRKRTLGLSAMSTTDLEAYSKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279265_HBx_P-RF-CB Product feature CHAIN LC279265_HBx_P-RF-CB of FT:mat_peptide LC279265_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_nail). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279266_HBx_P-RF-CB Product feature CHAIN LC279266_HBx_P-RF-CB of FT:mat_peptide LC279266_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_serum). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC279267_HBx_P-RF-CB Product feature CHAIN LC279267_HBx_P-RF-CB of FT:mat_peptide LC279267_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi-child_serum). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC416040_HBx_P-RF-CB Product feature CHAIN LC416040_HBx_P-RF-CB of FT:mat_peptide LC416040_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CT_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|LC458432_HBx_P-RF-CB Product feature CHAIN LC458432_HBx_P-RF-CB of FT:mat_peptide LC458432_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate JRC-HE02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|M38454_HBx_P-RF-CB Product feature CHAIN M38454_HBx_P-RF-CB of FT:mat_peptide M38454_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHGAHLSLRGLPVCAFSSAGPCALPFTSARRME
TTVNAHQVLPKVLHKSTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF488699_HBx_P-RF-DE Product feature CHAIN MF488699_HBx_P-RF-DE of FT:mat_peptide MF488699_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-CRP058). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF488702_HBx_P-RF-DE Product feature CHAIN MF488702_HBx_P-RF-DE of FT:mat_peptide MF488702_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-PCP015). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGWKHKLVCAPAPCDFFTSA
>gnl|hbvpro|MF488705_HBx_P-RF-AD Product feature CHAIN MF488705_HBx_P-RF-AD of FT:mat_peptide MF488705_HBx_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate OHBV-PCP243). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF593359_HBx_P-RF-DE Product feature CHAIN MF593359_HBx_P-RF-DE of FT:mat_peptide MF593359_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_MDQ36). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF618346_HBx_P-RF-DE Product feature CHAIN MF618346_HBx_P-RF-DE of FT:mat_peptide MF618346_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-HIV076). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF925360_HBx_P-RF-DB Product feature CHAIN MF925360_HBx_P-RF-DB of FT:mat_peptide MF925360_HBx_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLITVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925370_HBx_P-RF-CB Product feature CHAIN MF925370_HBx_P-RF-CB of FT:mat_peptide MF925370_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BD-HBV14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925371_HBx_P-RF-DC Product feature CHAIN MF925371_HBx_P-RF-DC of FT:mat_peptide MF925371_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925381_HBx_P-RF-CB Product feature CHAIN MF925381_HBx_P-RF-CB of FT:mat_peptide MF925381_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BD-HBV25). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVVGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925382_HBx_P-RF-CB Product feature CHAIN MF925382_HBx_P-RF-CB of FT:mat_peptide MF925382_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BD-HBV26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925384_HBx_P-RF-DB Product feature CHAIN MF925384_HBx_P-RF-DB of FT:mat_peptide MF925384_HBx_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925386_HBx_P-RF-AC Product feature CHAIN MF925386_HBx_P-RF-AC of FT:mat_peptide MF925386_HBx_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate BD-HBV30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925388_HBx_P-RF-DC Product feature CHAIN MF925388_HBx_P-RF-DC of FT:mat_peptide MF925388_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925389_HBx_P-RF-DC Product feature CHAIN MF925389_HBx_P-RF-DC of FT:mat_peptide MF925389_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLRIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925392_HBx_P-RF-DB Product feature CHAIN MF925392_HBx_P-RF-DB of FT:mat_peptide MF925392_HBx_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLFHSLAAARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVVGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925396_HBx_P-RF-DC Product feature CHAIN MF925396_HBx_P-RF-DC of FT:mat_peptide MF925396_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925397_HBx_P-RF-DC Product feature CHAIN MF925397_HBx_P-RF-DC of FT:mat_peptide MF925397_HBx_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925401_HBx_P-RF-DB Product feature CHAIN MF925401_HBx_P-RF-DB of FT:mat_peptide MF925401_HBx_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925402_HBx_P-RF-BD Product feature CHAIN MF925402_HBx_P-RF-BD of FT:mat_peptide MF925402_HBx_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate BD-HBV48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925404_HBx_P-RF-AC Product feature CHAIN MF925404_HBx_P-RF-AC of FT:mat_peptide MF925404_HBx_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate BD-HBV50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF967563_HBx_P-RF-DE Product feature CHAIN MF967563_HBx_P-RF-DE of FT:mat_peptide MF967563_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG826141_HBx_P-RF-CB Product feature CHAIN MG826141_HBx_P-RF-CB of FT:mat_peptide MG826141_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTFARRME
TTVNAQQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG826142_HBx_P-RF-CB Product feature CHAIN MG826142_HBx_P-RF-CB of FT:mat_peptide MG826142_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM31H). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG826144_HBx_P-RF-CB Product feature CHAIN MG826144_HBx_P-RF-CB of FT:mat_peptide MG826144_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTGLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTFA
>gnl|hbvpro|MG826145_HBx_P-RF-BC Product feature CHAIN MG826145_HBx_P-RF-BC of FT:mat_peptide MG826145_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG826146_HBx_P-RF-CB Product feature CHAIN MG826146_HBx_P-RF-CB of FT:mat_peptide MG826146_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM40H). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPIGGLPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKDFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG826147_HBx_P-RF-CB Product feature CHAIN MG826147_HBx_P-RF-CB of FT:mat_peptide MG826147_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM19H). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHGAHSSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKDFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG826148_HBx_P-RF-CB Product feature CHAIN MG826148_HBx_P-RF-CB of FT:mat_peptide MG826148_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHGAHLSLRGLPVWAFSSAGPCPFRFTFARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG826149_HBx_P-RF-CB Product feature CHAIN MG826149_HBx_P-RF-CB of FT:mat_peptide MG826149_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM63). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG826150_HBx_P-RF-BC Product feature CHAIN MG826150_HBx_P-RF-BC of FT:mat_peptide MG826150_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM15H). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVGCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIYVLGGCRHKLVRSPASCNFFTSA
>gnl|hbvpro|MG826151_HBx_P-RF-BC Product feature CHAIN MG826151_HBx_P-RF-BC of FT:mat_peptide MG826151_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM26H). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG893554_HBx_P-RF-CB Product feature CHAIN MG893554_HBx_P-RF-CB of FT:mat_peptide MG893554_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14021). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFASARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG893555_HBx_P-RF-CB Product feature CHAIN MG893555_HBx_P-RF-CB of FT:mat_peptide MG893555_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG893559_HBx_P-RF-CB Product feature CHAIN MG893559_HBx_P-RF-CB of FT:mat_peptide MG893559_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14052). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG893561_HBx_P-RF-CB Product feature CHAIN MG893561_HBx_P-RF-CB of FT:mat_peptide MG893561_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14075). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MH094410_HBx_P-RF-BC Product feature CHAIN MH094410_HBx_P-RF-BC of FT:mat_peptide MH094410_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|MH368022_HBx_P-RF-GC Product feature CHAIN MH368022_HBx_P-RF-GC of FT:mat_peptide MH368022_HBx_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate 9736409). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|MH464835_HBx_P-RF-DE Product feature CHAIN MH464835_HBx_P-RF-DE of FT:mat_peptide MH464835_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISRSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH464846_HBx_P-RF-DE Product feature CHAIN MH464846_HBx_P-RF-DE of FT:mat_peptide MH464846_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA124). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH464851_HBx_P-RF-DE Product feature CHAIN MH464851_HBx_P-RF-DE of FT:mat_peptide MH464851_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA129). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH464852_HBx_P-RF-DE Product feature CHAIN MH464852_HBx_P-RF-DE of FT:mat_peptide MH464852_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH481858_HBx_P-RF-DE Product feature CHAIN MH481858_HBx_P-RF-DE of FT:mat_peptide MH481858_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCASRSPKFFTSA
>gnl|hbvpro|MH481859_HBx_P-RF-DE Product feature CHAIN MH481859_HBx_P-RF-DE of FT:mat_peptide MH481859_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSVMSTTDLEAYFKDCLFKASEELGEEIRLKVFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|MH481860_HBx_P-RF-DE Product feature CHAIN MH481860_HBx_P-RF-DE of FT:mat_peptide MH481860_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCSHKLVCASRSPKFFTSA
>gnl|hbvpro|MH481861_HBx_P-RF-DE Product feature CHAIN MH481861_HBx_P-RF-DE of FT:mat_peptide MH481861_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLRVFVLGSCSHKLVCASRSPKFFTSA
>gnl|hbvpro|MH481862_HBx_P-RF-DE Product feature CHAIN MH481862_HBx_P-RF-DE of FT:mat_peptide MH481862_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKFLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLKVFELGGCSHKLVCAPAPSNFFTSA
>gnl|hbvpro|MH685719_HBx_P-RF-DE Product feature CHAIN MH685719_HBx_P-RF-DE of FT:mat_peptide MH685719_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate E0-055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPFSGSLGTLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH746811_HBx_P-RF-BC Product feature CHAIN MH746811_HBx_P-RF-BC of FT:mat_peptide MH746811_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MH746812_HBx_P-RF-BC Product feature CHAIN MH746812_HBx_P-RF-BC of FT:mat_peptide MH746812_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MH746813_HBx_P-RF-BC Product feature CHAIN MH746813_HBx_P-RF-BC of FT:mat_peptide MH746813_HBx_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052957_HBx_P-RF-DE Product feature CHAIN MK052957_HBx_P-RF-DE of FT:mat_peptide MK052957_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NP137-11). Partial genome (Contains: HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLGPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHGAHLPLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052967_HBx_P-RF-BD Product feature CHAIN MK052967_HBx_P-RF-BD of FT:mat_peptide MK052967_HBx_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFELGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052968_HBx_P-RF-BD Product feature CHAIN MK052968_HBx_P-RF-BD of FT:mat_peptide MK052968_HBx_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052969_HBx_P-RF-DE Product feature CHAIN MK052969_HBx_P-RF-DE of FT:mat_peptide MK052969_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NP137Q-8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGGETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052970_HBx_P-RF-BD Product feature CHAIN MK052970_HBx_P-RF-BD of FT:mat_peptide MK052970_HBx_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052976_HBx_P-RF-BD Product feature CHAIN MK052976_HBx_P-RF-BD of FT:mat_peptide MK052976_HBx_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGSLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK321265_HBx_P-RF-CB Product feature CHAIN MK321265_HBx_P-RF-CB of FT:mat_peptide MK321265_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1331). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|U95551_HBx_P-RF-DE Product feature CHAIN U95551_HBx_P-RF-DE of FT:mat_peptide U95551_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X65259_HBx_P-RF-DA Product feature CHAIN X65259_HBx_P-RF-DA of FT:mat_peptide X65259_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate patient E; HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSAHCME
TTVNAHQIMPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X68292_HBx_P-RF-DA Product feature CHAIN X68292_HBx_P-RF-DA of FT:mat_peptide X68292_HBx_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate Patient D, HBV subtype ayw). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLTVCAFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X75656_HBx_P-RF-CB Product feature CHAIN X75656_HBx_P-RF-CB of FT:mat_peptide X75656_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Cha). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X80925_HBx_P-RF-DE Product feature CHAIN X80925_HBx_P-RF-DE of FT:mat_peptide X80925_HBx_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate patient 4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHILPKVLHKRALGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|Y18856_HBx_P-RF-CB Product feature CHAIN Y18856_HBx_P-RF-CB of FT:mat_peptide Y18856_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-C5). Non-functional genomic sequence. [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDILCLRPCGAESRGRPVSGSLGDLPSPSPSVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMET
TVNAHRNLPKVLHKRTLGLSAMSTTDPEAYFKDCVFTYWRELGAEGRLKVFVLGGCRHKLVRSPAPCKFFTSA
>gnl|hbvpro|Y18857_HBx_P-RF-CB Product feature CHAIN Y18857_HBx_P-RF-CB of FT:mat_peptide Y18857_HBx_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPAFSVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMET
TVNGRRGLPKVLHKRTLGLSAMSTTDPEAYFKDCVFTYWRELGAEGRLKVFVLGGCRHKLVRSPAPCKFFTSA
© 1998-2019