HBVdb

Dataset for protein HBSP of genotype all

[Download (right click)] [Alignment] [Repertoires]

8687 sequence(s)

>gnl|hbvpro|AB014370_HBSP_P-A Product feature CHAIN AB014370_HBSP_P-A of FT:mat_peptide AB014370_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB064314_HBSP_P-A Product feature CHAIN AB064314_HBSP_P-A of FT:mat_peptide AB064314_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB076678_HBSP_P-A Product feature CHAIN AB076678_HBSP_P-A of FT:mat_peptide AB076678_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116076_HBSP_P-A Product feature CHAIN AB116076_HBSP_P-A of FT:mat_peptide AB116076_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDAGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116078_HBSP_P-A Product feature CHAIN AB116078_HBSP_P-A of FT:mat_peptide AB116078_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116079_HBSP_P-A Product feature CHAIN AB116079_HBSP_P-A of FT:mat_peptide AB116079_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116080_HBSP_P-A Product feature CHAIN AB116080_HBSP_P-A of FT:mat_peptide AB116080_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116081_HBSP_P-A Product feature CHAIN AB116081_HBSP_P-A of FT:mat_peptide AB116081_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116082_HBSP_P-A Product feature CHAIN AB116082_HBSP_P-A of FT:mat_peptide AB116082_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116083_HBSP_P-A Product feature CHAIN AB116083_HBSP_P-A of FT:mat_peptide AB116083_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARVLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116084_HBSP_P-A Product feature CHAIN AB116084_HBSP_P-A of FT:mat_peptide AB116084_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116086_HBSP_P-A Product feature CHAIN AB116086_HBSP_P-A of FT:mat_peptide AB116086_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116087_HBSP_P-A Product feature CHAIN AB116087_HBSP_P-A of FT:mat_peptide AB116087_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDESEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116088_HBSP_P-A Product feature CHAIN AB116088_HBSP_P-A of FT:mat_peptide AB116088_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116089_HBSP_P-A Product feature CHAIN AB116089_HBSP_P-A of FT:mat_peptide AB116089_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLEATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116090_HBSP_P-A Product feature CHAIN AB116090_HBSP_P-A of FT:mat_peptide AB116090_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYPHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116091_HBSP_P-A Product feature CHAIN AB116091_HBSP_P-A of FT:mat_peptide AB116091_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPAREPAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116092_HBSP_P-A Product feature CHAIN AB116092_HBSP_P-A of FT:mat_peptide AB116092_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKGTLCFPHVAVQNL
RMEIAPVFPSHHLGVSQNSYGSGPQSVSLVSVY
>gnl|hbvpro|AB116093_HBSP_P-A Product feature CHAIN AB116093_HBSP_P-A of FT:mat_peptide AB116093_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116094_HBSP_P-A Product feature CHAIN AB116094_HBSP_P-A of FT:mat_peptide AB116094_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPAREPAEPARLLLKATLRFPHVAVQNL
RVEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB126580_HBSP_P-A Product feature CHAIN AB126580_HBSP_P-A of FT:mat_peptide AB126580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHARPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB194950_HBSP_P-A Product feature CHAIN AB194950_HBSP_P-A of FT:mat_peptide AB194950_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIALVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AB194951_HBSP_P-A Product feature CHAIN AB194951_HBSP_P-A of FT:mat_peptide AB194951_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGGGPQSVSPGSVY
>gnl|hbvpro|AB194952_HBSP_P-A Product feature CHAIN AB194952_HBSP_P-A of FT:mat_peptide AB194952_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AB205118_HBSP_P-A Product feature CHAIN AB205118_HBSP_P-A of FT:mat_peptide AB205118_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKQLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB222707_HBSP_P-A Product feature CHAIN AB222707_HBSP_P-A of FT:mat_peptide AB222707_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB241114_HBSP_P-A Product feature CHAIN AB241114_HBSP_P-A of FT:mat_peptide AB241114_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB241115_HBSP_P-A Product feature CHAIN AB241115_HBSP_P-A of FT:mat_peptide AB241115_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246317_HBSP_P-A Product feature CHAIN AB246317_HBSP_P-A of FT:mat_peptide AB246317_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPAGPAQLLLKATLCFPHVAVQNL
RTEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246335_HBSP_P-A Product feature CHAIN AB246335_HBSP_P-A of FT:mat_peptide AB246335_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246336_HBSP_P-A Product feature CHAIN AB246336_HBSP_P-A of FT:mat_peptide AB246336_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246337_HBSP_P-A Product feature CHAIN AB246337_HBSP_P-A of FT:mat_peptide AB246337_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246338_HBSP_P-A Product feature CHAIN AB246338_HBSP_P-A of FT:mat_peptide AB246338_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300366_HBSP_P-A Product feature CHAIN AB300366_HBSP_P-A of FT:mat_peptide AB300366_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300367_HBSP_P-A Product feature CHAIN AB300367_HBSP_P-A of FT:mat_peptide AB300367_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB362931_HBSP_P-A Product feature CHAIN AB362931_HBSP_P-A of FT:mat_peptide AB362931_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453979_HBSP_P-A Product feature CHAIN AB453979_HBSP_P-A of FT:mat_peptide AB453979_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453980_HBSP_P-A Product feature CHAIN AB453980_HBSP_P-A of FT:mat_peptide AB453980_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453981_HBSP_P-A Product feature CHAIN AB453981_HBSP_P-A of FT:mat_peptide AB453981_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453982_HBSP_P-A Product feature CHAIN AB453982_HBSP_P-A of FT:mat_peptide AB453982_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453983_HBSP_P-A Product feature CHAIN AB453983_HBSP_P-A of FT:mat_peptide AB453983_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453984_HBSP_P-A Product feature CHAIN AB453984_HBSP_P-A of FT:mat_peptide AB453984_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453986_HBSP_P-A Product feature CHAIN AB453986_HBSP_P-A of FT:mat_peptide AB453986_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453987_HBSP_P-A Product feature CHAIN AB453987_HBSP_P-A of FT:mat_peptide AB453987_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453989_HBSP_P-A Product feature CHAIN AB453989_HBSP_P-A of FT:mat_peptide AB453989_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480036_HBSP_P-A Product feature CHAIN AB480036_HBSP_P-A of FT:mat_peptide AB480036_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480038_HBSP_P-A Product feature CHAIN AB480038_HBSP_P-A of FT:mat_peptide AB480038_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480039_HBSP_P-A Product feature CHAIN AB480039_HBSP_P-A of FT:mat_peptide AB480039_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480040_HBSP_P-A Product feature CHAIN AB480040_HBSP_P-A of FT:mat_peptide AB480040_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480041_HBSP_P-A Product feature CHAIN AB480041_HBSP_P-A of FT:mat_peptide AB480041_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB549213_HBSP_P-A Product feature CHAIN AB549213_HBSP_P-A of FT:mat_peptide AB549213_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697487_HBSP_P-A Product feature CHAIN AB697487_HBSP_P-A of FT:mat_peptide AB697487_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697488_HBSP_P-A Product feature CHAIN AB697488_HBSP_P-A of FT:mat_peptide AB697488_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697489_HBSP_P-A Product feature CHAIN AB697489_HBSP_P-A of FT:mat_peptide AB697489_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697491_HBSP_P-A Product feature CHAIN AB697491_HBSP_P-A of FT:mat_peptide AB697491_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697492_HBSP_P-A Product feature CHAIN AB697492_HBSP_P-A of FT:mat_peptide AB697492_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697493_HBSP_P-A Product feature CHAIN AB697493_HBSP_P-A of FT:mat_peptide AB697493_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|AB697495_HBSP_P-A Product feature CHAIN AB697495_HBSP_P-A of FT:mat_peptide AB697495_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697496_HBSP_P-A Product feature CHAIN AB697496_HBSP_P-A of FT:mat_peptide AB697496_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697497_HBSP_P-A Product feature CHAIN AB697497_HBSP_P-A of FT:mat_peptide AB697497_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697498_HBSP_P-A Product feature CHAIN AB697498_HBSP_P-A of FT:mat_peptide AB697498_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697499_HBSP_P-A Product feature CHAIN AB697499_HBSP_P-A of FT:mat_peptide AB697499_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697501_HBSP_P-A Product feature CHAIN AB697501_HBSP_P-A of FT:mat_peptide AB697501_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697503_HBSP_P-A Product feature CHAIN AB697503_HBSP_P-A of FT:mat_peptide AB697503_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697504_HBSP_P-A Product feature CHAIN AB697504_HBSP_P-A of FT:mat_peptide AB697504_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697505_HBSP_P-A Product feature CHAIN AB697505_HBSP_P-A of FT:mat_peptide AB697505_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697506_HBSP_P-A Product feature CHAIN AB697506_HBSP_P-A of FT:mat_peptide AB697506_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|AB697507_HBSP_P-A Product feature CHAIN AB697507_HBSP_P-A of FT:mat_peptide AB697507_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697508_HBSP_P-A Product feature CHAIN AB697508_HBSP_P-A of FT:mat_peptide AB697508_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697509_HBSP_P-A Product feature CHAIN AB697509_HBSP_P-A of FT:mat_peptide AB697509_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697511_HBSP_P-A Product feature CHAIN AB697511_HBSP_P-A of FT:mat_peptide AB697511_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCYPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697512_HBSP_P-A Product feature CHAIN AB697512_HBSP_P-A of FT:mat_peptide AB697512_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB775198_HBSP_P-A Product feature CHAIN AB775198_HBSP_P-A of FT:mat_peptide AB775198_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB775199_HBSP_P-A Product feature CHAIN AB775199_HBSP_P-A of FT:mat_peptide AB775199_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB775200_HBSP_P-A Product feature CHAIN AB775200_HBSP_P-A of FT:mat_peptide AB775200_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB775201_HBSP_P-A Product feature CHAIN AB775201_HBSP_P-A of FT:mat_peptide AB775201_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937791_HBSP_P-A Product feature CHAIN AB937791_HBSP_P-A of FT:mat_peptide AB937791_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937792_HBSP_P-A Product feature CHAIN AB937792_HBSP_P-A of FT:mat_peptide AB937792_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937793_HBSP_P-A Product feature CHAIN AB937793_HBSP_P-A of FT:mat_peptide AB937793_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937794_HBSP_P-A Product feature CHAIN AB937794_HBSP_P-A of FT:mat_peptide AB937794_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937795_HBSP_P-A Product feature CHAIN AB937795_HBSP_P-A of FT:mat_peptide AB937795_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLXFPHVAVQNL
RMEIAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|AB937796_HBSP_P-A Product feature CHAIN AB937796_HBSP_P-A of FT:mat_peptide AB937796_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937798_HBSP_P-A Product feature CHAIN AB937798_HBSP_P-A of FT:mat_peptide AB937798_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLEATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF043560_HBSP_P-A Product feature CHAIN AF043560_HBSP_P-A of FT:mat_peptide AF043560_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF043580_HBSP_P-A Product feature CHAIN AF043580_HBSP_P-A of FT:mat_peptide AF043580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090838_HBSP_P-A Product feature CHAIN AF090838_HBSP_P-A of FT:mat_peptide AF090838_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNPNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090839_HBSP_P-A Product feature CHAIN AF090839_HBSP_P-A of FT:mat_peptide AF090839_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090840_HBSP_P-A Product feature CHAIN AF090840_HBSP_P-A of FT:mat_peptide AF090840_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090841_HBSP_P-A Product feature CHAIN AF090841_HBSP_P-A of FT:mat_peptide AF090841_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090842_HBSP_P-A Product feature CHAIN AF090842_HBSP_P-A of FT:mat_peptide AF090842_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF143298_HBSP_P-A Product feature CHAIN AF143298_HBSP_P-A of FT:mat_peptide AF143298_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQQFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCCPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF143302_HBSP_P-A Product feature CHAIN AF143302_HBSP_P-A of FT:mat_peptide AF143302_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLNDQQQPVRDRAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297621_HBSP_P-A Product feature CHAIN AF297621_HBSP_P-A of FT:mat_peptide AF297621_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297622_HBSP_P-A Product feature CHAIN AF297622_HBSP_P-A of FT:mat_peptide AF297622_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297623_HBSP_P-A Product feature CHAIN AF297623_HBSP_P-A of FT:mat_peptide AF297623_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDAETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297624_HBSP_P-A Product feature CHAIN AF297624_HBSP_P-A of FT:mat_peptide AF297624_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297625_HBSP_P-A Product feature CHAIN AF297625_HBSP_P-A of FT:mat_peptide AF297625_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF536524_HBSP_P-A Product feature CHAIN AF536524_HBSP_P-A of FT:mat_peptide AF536524_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHARPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF537371_HBSP_P-A Product feature CHAIN AF537371_HBSP_P-A of FT:mat_peptide AF537371_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQRFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLDDQQQPVRNHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF537372_HBSP_P-A Product feature CHAIN AF537372_HBSP_P-A of FT:mat_peptide AF537372_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGAEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQRQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AJ012207_HBSP_P-A Product feature CHAIN AJ012207_HBSP_P-A of FT:mat_peptide AJ012207_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ309369_HBSP_P-A Product feature CHAIN AJ309369_HBSP_P-A of FT:mat_peptide AJ309369_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ309370_HBSP_P-A Product feature CHAIN AJ309370_HBSP_P-A of FT:mat_peptide AJ309370_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEEPPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ309371_HBSP_P-A Product feature CHAIN AJ309371_HBSP_P-A of FT:mat_peptide AJ309371_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ344115_HBSP_P-A Product feature CHAIN AJ344115_HBSP_P-A of FT:mat_peptide AJ344115_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARFLLAANLCFPHVAVQNL
RMEIAPVFPSHRLGLSQATYGSGPQSVSLGSVY
>gnl|hbvpro|AJ627226_HBSP_P-A Product feature CHAIN AJ627226_HBSP_P-A of FT:mat_peptide AJ627226_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20952). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|AJ627227_HBSP_P-A Product feature CHAIN AJ627227_HBSP_P-A of FT:mat_peptide AJ627227_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21077). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRXHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ627228_HBSP_P-A Product feature CHAIN AJ627228_HBSP_P-A of FT:mat_peptide AJ627228_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQFFRKLLLLDDETEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM180624_HBSP_P-A Product feature CHAIN AM180624_HBSP_P-A of FT:mat_peptide AM180624_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGXLNDPXPPVRDPAEPARLLHKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AM184125_HBSP_P-A Product feature CHAIN AM184125_HBSP_P-A of FT:mat_peptide AM184125_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLHKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AM184126_HBSP_P-A Product feature CHAIN AM184126_HBSP_P-A of FT:mat_peptide AM184126_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLHKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AM282986_HBSP_P-A Product feature CHAIN AM282986_HBSP_P-A of FT:mat_peptide AM282986_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNEQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM295795_HBSP_P-A Product feature CHAIN AM295795_HBSP_P-A of FT:mat_peptide AM295795_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM295796_HBSP_P-A Product feature CHAIN AM295796_HBSP_P-A of FT:mat_peptide AM295796_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM295797_HBSP_P-A Product feature CHAIN AM295797_HBSP_P-A of FT:mat_peptide AM295797_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM410963_HBSP_P-A Product feature CHAIN AM410963_HBSP_P-A of FT:mat_peptide AM410963_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AM494718_HBSP_P-A Product feature CHAIN AM494718_HBSP_P-A of FT:mat_peptide AM494718_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|AY034878_HBSP_P-A Product feature CHAIN AY034878_HBSP_P-A of FT:mat_peptide AY034878_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AY128092_HBSP_P-A Product feature CHAIN AY128092_HBSP_P-A of FT:mat_peptide AY128092_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY152726_HBSP_P-A Product feature CHAIN AY152726_HBSP_P-A of FT:mat_peptide AY152726_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQQVRDHAKPARLLLKATLRCPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161138_HBSP_P-A Product feature CHAIN AY161138_HBSP_P-A of FT:mat_peptide AY161138_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161139_HBSP_P-A Product feature CHAIN AY161139_HBSP_P-A of FT:mat_peptide AY161139_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161142_HBSP_P-A Product feature CHAIN AY161142_HBSP_P-A of FT:mat_peptide AY161142_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEDSLRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161143_HBSP_P-A Product feature CHAIN AY161143_HBSP_P-A of FT:mat_peptide AY161143_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161144_HBSP_P-A Product feature CHAIN AY161144_HBSP_P-A of FT:mat_peptide AY161144_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233274_HBSP_P-A Product feature CHAIN AY233274_HBSP_P-A of FT:mat_peptide AY233274_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAGDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233275_HBSP_P-A Product feature CHAIN AY233275_HBSP_P-A of FT:mat_peptide AY233275_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQRVRDLARPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233276_HBSP_P-A Product feature CHAIN AY233276_HBSP_P-A of FT:mat_peptide AY233276_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233278_HBSP_P-A Product feature CHAIN AY233278_HBSP_P-A of FT:mat_peptide AY233278_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233279_HBSP_P-A Product feature CHAIN AY233279_HBSP_P-A of FT:mat_peptide AY233279_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|AY233280_HBSP_P-A Product feature CHAIN AY233280_HBSP_P-A of FT:mat_peptide AY233280_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233281_HBSP_P-A Product feature CHAIN AY233281_HBSP_P-A of FT:mat_peptide AY233281_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQRVRDLARPARLLLKTTLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233282_HBSP_P-A Product feature CHAIN AY233282_HBSP_P-A of FT:mat_peptide AY233282_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233283_HBSP_P-A Product feature CHAIN AY233283_HBSP_P-A of FT:mat_peptide AY233283_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233284_HBSP_P-A Product feature CHAIN AY233284_HBSP_P-A of FT:mat_peptide AY233284_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQRVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233285_HBSP_P-A Product feature CHAIN AY233285_HBSP_P-A of FT:mat_peptide AY233285_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|AY233286_HBSP_P-A Product feature CHAIN AY233286_HBSP_P-A of FT:mat_peptide AY233286_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRGHAKPARLLLKATLCFPHVAVQHL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233287_HBSP_P-A Product feature CHAIN AY233287_HBSP_P-A of FT:mat_peptide AY233287_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGSQSVSLGSVY
>gnl|hbvpro|AY233288_HBSP_P-A Product feature CHAIN AY233288_HBSP_P-A of FT:mat_peptide AY233288_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233289_HBSP_P-A Product feature CHAIN AY233289_HBSP_P-A of FT:mat_peptide AY233289_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233290_HBSP_P-A Product feature CHAIN AY233290_HBSP_P-A of FT:mat_peptide AY233290_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY373428_HBSP_P-A Product feature CHAIN AY373428_HBSP_P-A of FT:mat_peptide AY373428_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY373429_HBSP_P-A Product feature CHAIN AY373429_HBSP_P-A of FT:mat_peptide AY373429_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLVEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY373432_HBSP_P-A Product feature CHAIN AY373432_HBSP_P-A of FT:mat_peptide AY373432_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY707087_HBSP_P-A Product feature CHAIN AY707087_HBSP_P-A of FT:mat_peptide AY707087_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNEQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY738139_HBSP_P-A Product feature CHAIN AY738139_HBSP_P-A of FT:mat_peptide AY738139_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY738140_HBSP_P-A Product feature CHAIN AY738140_HBSP_P-A of FT:mat_peptide AY738140_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY738141_HBSP_P-A Product feature CHAIN AY738141_HBSP_P-A of FT:mat_peptide AY738141_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY738142_HBSP_P-A Product feature CHAIN AY738142_HBSP_P-A of FT:mat_peptide AY738142_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY738143_HBSP_P-A Product feature CHAIN AY738143_HBSP_P-A of FT:mat_peptide AY738143_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY862867_HBSP_P-A Product feature CHAIN AY862867_HBSP_P-A of FT:mat_peptide AY862867_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY862868_HBSP_P-A Product feature CHAIN AY862868_HBSP_P-A of FT:mat_peptide AY862868_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY902775_HBSP_P-A Product feature CHAIN AY902775_HBSP_P-A of FT:mat_peptide AY902775_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY903452_HBSP_P-A Product feature CHAIN AY903452_HBSP_P-A of FT:mat_peptide AY903452_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934763_HBSP_P-A Product feature CHAIN AY934763_HBSP_P-A of FT:mat_peptide AY934763_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPVRGLAEAARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHHGLSENTYGSGPQSVSPGSVY
>gnl|hbvpro|AY934764_HBSP_P-A Product feature CHAIN AY934764_HBSP_P-A of FT:mat_peptide AY934764_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHHGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AY934765_HBSP_P-A Product feature CHAIN AY934765_HBSP_P-A of FT:mat_peptide AY934765_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQDTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934766_HBSP_P-A Product feature CHAIN AY934766_HBSP_P-A of FT:mat_peptide AY934766_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934767_HBSP_P-A Product feature CHAIN AY934767_HBSP_P-A of FT:mat_peptide AY934767_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934768_HBSP_P-A Product feature CHAIN AY934768_HBSP_P-A of FT:mat_peptide AY934768_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVLDPAKPARLLLKATLWFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934769_HBSP_P-A Product feature CHAIN AY934769_HBSP_P-A of FT:mat_peptide AY934769_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934770_HBSP_P-A Product feature CHAIN AY934770_HBSP_P-A of FT:mat_peptide AY934770_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934771_HBSP_P-A Product feature CHAIN AY934771_HBSP_P-A of FT:mat_peptide AY934771_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934773_HBSP_P-A Product feature CHAIN AY934773_HBSP_P-A of FT:mat_peptide AY934773_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934774_HBSP_P-A Product feature CHAIN AY934774_HBSP_P-A of FT:mat_peptide AY934774_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ020002_HBSP_P-A Product feature CHAIN DQ020002_HBSP_P-A of FT:mat_peptide DQ020002_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ020003_HBSP_P-A Product feature CHAIN DQ020003_HBSP_P-A of FT:mat_peptide DQ020003_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDVTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298161_HBSP_P-A Product feature CHAIN DQ298161_HBSP_P-A of FT:mat_peptide DQ298161_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNDQQQPVRDHAKPARLLLKATLCFHHVAVQNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298162_HBSP_P-A Product feature CHAIN DQ298162_HBSP_P-A of FT:mat_peptide DQ298162_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADFNRRVTEDLDLGDPNDQQLPVRDHAKPARLLLKATLCFHHVAVQNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298163_HBSP_P-A Product feature CHAIN DQ298163_HBSP_P-A of FT:mat_peptide DQ298163_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNDQQQPVRDHAKPARLLLKATLCFPPVAVQNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298164_HBSP_P-A Product feature CHAIN DQ298164_HBSP_P-A of FT:mat_peptide DQ298164_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNDQQQPVRDHAKPARLLLKATLCFPPVAVRNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298165_HBSP_P-A Product feature CHAIN DQ298165_HBSP_P-A of FT:mat_peptide DQ298165_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPIEEELPRLADADPNRRVAEDLNLGDPNDQQQPVRDHAKPARLLLKATLCFPPVAVQNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ315784_HBSP_P-A Product feature CHAIN DQ315784_HBSP_P-A of FT:mat_peptide DQ315784_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|DQ315785_HBSP_P-A Product feature CHAIN DQ315785_HBSP_P-A of FT:mat_peptide DQ315785_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI0386). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDLAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ315786_HBSP_P-A Product feature CHAIN DQ315786_HBSP_P-A of FT:mat_peptide DQ315786_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ788725_HBSP_P-A Product feature CHAIN DQ788725_HBSP_P-A of FT:mat_peptide DQ788725_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEELNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ788728_HBSP_P-A Product feature CHAIN DQ788728_HBSP_P-A of FT:mat_peptide DQ788728_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 05/96). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLNDQQQPVRDRAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF103278_HBSP_P-A Product feature CHAIN EF103278_HBSP_P-A of FT:mat_peptide EF103278_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF208113_HBSP_P-A Product feature CHAIN EF208113_HBSP_P-A of FT:mat_peptide EF208113_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU054331_HBSP_C-A Product feature CHAIN EU054331_HBSP_C-A of FT:mat_peptide EU054331_HBSP_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLHKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|EU086721_HBSP_P-A Product feature CHAIN EU086721_HBSP_P-A of FT:mat_peptide EU086721_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU185787_HBSP_P-A Product feature CHAIN EU185787_HBSP_P-A of FT:mat_peptide EU185787_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RMEXAPVXXSHRPGLXQNTYGSGAQPVSLGSVY
>gnl|hbvpro|EU185789_HBSP_P-A Product feature CHAIN EU185789_HBSP_P-A of FT:mat_peptide EU185789_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RMEXAPVXXSHRPGLXQNTYGSGAQPVSLGSVY
>gnl|hbvpro|EU304331_HBSP_P-A Product feature CHAIN EU304331_HBSP_P-A of FT:mat_peptide EU304331_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA84). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADZDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU366129_HBSP_P-A Product feature CHAIN EU366129_HBSP_P-A of FT:mat_peptide EU366129_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU410082_HBSP_P-A Product feature CHAIN EU410082_HBSP_P-A of FT:mat_peptide EU410082_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU414132_HBSP_P-A Product feature CHAIN EU414132_HBSP_P-A of FT:mat_peptide EU414132_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNXNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU414133_HBSP_P-A Product feature CHAIN EU414133_HBSP_P-A of FT:mat_peptide EU414133_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594383_HBSP_P-A Product feature CHAIN EU594383_HBSP_P-A of FT:mat_peptide EU594383_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594384_HBSP_P-A Product feature CHAIN EU594384_HBSP_P-A of FT:mat_peptide EU594384_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594385_HBSP_P-A Product feature CHAIN EU594385_HBSP_P-A of FT:mat_peptide EU594385_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594386_HBSP_P-A Product feature CHAIN EU594386_HBSP_P-A of FT:mat_peptide EU594386_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKHARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594387_HBSP_P-A Product feature CHAIN EU594387_HBSP_P-A of FT:mat_peptide EU594387_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594388_HBSP_P-A Product feature CHAIN EU594388_HBSP_P-A of FT:mat_peptide EU594388_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594389_HBSP_P-A Product feature CHAIN EU594389_HBSP_P-A of FT:mat_peptide EU594389_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594390_HBSP_P-A Product feature CHAIN EU594390_HBSP_P-A of FT:mat_peptide EU594390_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594391_HBSP_P-A Product feature CHAIN EU594391_HBSP_P-A of FT:mat_peptide EU594391_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594392_HBSP_P-A Product feature CHAIN EU594392_HBSP_P-A of FT:mat_peptide EU594392_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594393_HBSP_P-A Product feature CHAIN EU594393_HBSP_P-A of FT:mat_peptide EU594393_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594394_HBSP_P-A Product feature CHAIN EU594394_HBSP_P-A of FT:mat_peptide EU594394_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594395_HBSP_P-A Product feature CHAIN EU594395_HBSP_P-A of FT:mat_peptide EU594395_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU747320_HBSP_P-A Product feature CHAIN EU747320_HBSP_P-A of FT:mat_peptide EU747320_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V51). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU859898_HBSP_P-A Product feature CHAIN EU859898_HBSP_P-A of FT:mat_peptide EU859898_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859899_HBSP_P-A Product feature CHAIN EU859899_HBSP_P-A of FT:mat_peptide EU859899_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859900_HBSP_P-A Product feature CHAIN EU859900_HBSP_P-A of FT:mat_peptide EU859900_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859901_HBSP_P-A Product feature CHAIN EU859901_HBSP_P-A of FT:mat_peptide EU859901_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859902_HBSP_P-A Product feature CHAIN EU859902_HBSP_P-A of FT:mat_peptide EU859902_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859903_HBSP_P-A Product feature CHAIN EU859903_HBSP_P-A of FT:mat_peptide EU859903_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859904_HBSP_P-A Product feature CHAIN EU859904_HBSP_P-A of FT:mat_peptide EU859904_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859905_HBSP_P-A Product feature CHAIN EU859905_HBSP_P-A of FT:mat_peptide EU859905_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859906_HBSP_P-A Product feature CHAIN EU859906_HBSP_P-A of FT:mat_peptide EU859906_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859907_HBSP_P-A Product feature CHAIN EU859907_HBSP_P-A of FT:mat_peptide EU859907_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859908_HBSP_P-A Product feature CHAIN EU859908_HBSP_P-A of FT:mat_peptide EU859908_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859909_HBSP_P-A Product feature CHAIN EU859909_HBSP_P-A of FT:mat_peptide EU859909_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859910_HBSP_P-A Product feature CHAIN EU859910_HBSP_P-A of FT:mat_peptide EU859910_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859911_HBSP_P-A Product feature CHAIN EU859911_HBSP_P-A of FT:mat_peptide EU859911_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859912_HBSP_P-A Product feature CHAIN EU859912_HBSP_P-A of FT:mat_peptide EU859912_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLVDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859913_HBSP_P-A Product feature CHAIN EU859913_HBSP_P-A of FT:mat_peptide EU859913_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859914_HBSP_P-A Product feature CHAIN EU859914_HBSP_P-A of FT:mat_peptide EU859914_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859915_HBSP_P-A Product feature CHAIN EU859915_HBSP_P-A of FT:mat_peptide EU859915_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859916_HBSP_P-A Product feature CHAIN EU859916_HBSP_P-A of FT:mat_peptide EU859916_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859917_HBSP_P-A Product feature CHAIN EU859917_HBSP_P-A of FT:mat_peptide EU859917_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859918_HBSP_P-A Product feature CHAIN EU859918_HBSP_P-A of FT:mat_peptide EU859918_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859919_HBSP_P-A Product feature CHAIN EU859919_HBSP_P-A of FT:mat_peptide EU859919_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859920_HBSP_P-A Product feature CHAIN EU859920_HBSP_P-A of FT:mat_peptide EU859920_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859921_HBSP_P-A Product feature CHAIN EU859921_HBSP_P-A of FT:mat_peptide EU859921_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859922_HBSP_P-A Product feature CHAIN EU859922_HBSP_P-A of FT:mat_peptide EU859922_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859923_HBSP_P-A Product feature CHAIN EU859923_HBSP_P-A of FT:mat_peptide EU859923_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859924_HBSP_P-A Product feature CHAIN EU859924_HBSP_P-A of FT:mat_peptide EU859924_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859925_HBSP_P-A Product feature CHAIN EU859925_HBSP_P-A of FT:mat_peptide EU859925_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859926_HBSP_P-A Product feature CHAIN EU859926_HBSP_P-A of FT:mat_peptide EU859926_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859927_HBSP_P-A Product feature CHAIN EU859927_HBSP_P-A of FT:mat_peptide EU859927_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859928_HBSP_P-A Product feature CHAIN EU859928_HBSP_P-A of FT:mat_peptide EU859928_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859929_HBSP_P-A Product feature CHAIN EU859929_HBSP_P-A of FT:mat_peptide EU859929_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859930_HBSP_P-A Product feature CHAIN EU859930_HBSP_P-A of FT:mat_peptide EU859930_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859931_HBSP_P-A Product feature CHAIN EU859931_HBSP_P-A of FT:mat_peptide EU859931_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859932_HBSP_P-A Product feature CHAIN EU859932_HBSP_P-A of FT:mat_peptide EU859932_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859933_HBSP_P-A Product feature CHAIN EU859933_HBSP_P-A of FT:mat_peptide EU859933_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859934_HBSP_P-A Product feature CHAIN EU859934_HBSP_P-A of FT:mat_peptide EU859934_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMQIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EU859935_HBSP_P-A Product feature CHAIN EU859935_HBSP_P-A of FT:mat_peptide EU859935_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859936_HBSP_P-A Product feature CHAIN EU859936_HBSP_P-A of FT:mat_peptide EU859936_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859937_HBSP_P-A Product feature CHAIN EU859937_HBSP_P-A of FT:mat_peptide EU859937_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859938_HBSP_P-A Product feature CHAIN EU859938_HBSP_P-A of FT:mat_peptide EU859938_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C133). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859939_HBSP_P-A Product feature CHAIN EU859939_HBSP_P-A of FT:mat_peptide EU859939_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859940_HBSP_P-A Product feature CHAIN EU859940_HBSP_P-A of FT:mat_peptide EU859940_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859941_HBSP_P-A Product feature CHAIN EU859941_HBSP_P-A of FT:mat_peptide EU859941_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859942_HBSP_P-A Product feature CHAIN EU859942_HBSP_P-A of FT:mat_peptide EU859942_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859943_HBSP_P-A Product feature CHAIN EU859943_HBSP_P-A of FT:mat_peptide EU859943_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859944_HBSP_P-A Product feature CHAIN EU859944_HBSP_P-A of FT:mat_peptide EU859944_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMETAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859945_HBSP_P-A Product feature CHAIN EU859945_HBSP_P-A of FT:mat_peptide EU859945_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859946_HBSP_P-A Product feature CHAIN EU859946_HBSP_P-A of FT:mat_peptide EU859946_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859947_HBSP_P-A Product feature CHAIN EU859947_HBSP_P-A of FT:mat_peptide EU859947_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859948_HBSP_P-A Product feature CHAIN EU859948_HBSP_P-A of FT:mat_peptide EU859948_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859949_HBSP_P-A Product feature CHAIN EU859949_HBSP_P-A of FT:mat_peptide EU859949_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859950_HBSP_P-A Product feature CHAIN EU859950_HBSP_P-A of FT:mat_peptide EU859950_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859951_HBSP_P-A Product feature CHAIN EU859951_HBSP_P-A of FT:mat_peptide EU859951_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EU859952_HBSP_P-A Product feature CHAIN EU859952_HBSP_P-A of FT:mat_peptide EU859952_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNLNEPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|EU859953_HBSP_P-A Product feature CHAIN EU859953_HBSP_P-A of FT:mat_peptide EU859953_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859954_HBSP_P-A Product feature CHAIN EU859954_HBSP_P-A of FT:mat_peptide EU859954_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EU859955_HBSP_P-A Product feature CHAIN EU859955_HBSP_P-A of FT:mat_peptide EU859955_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|EU859956_HBSP_P-A Product feature CHAIN EU859956_HBSP_P-A of FT:mat_peptide EU859956_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|FJ349222_HBSP_P-A Product feature CHAIN FJ349222_HBSP_P-A of FT:mat_peptide FJ349222_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ349224_HBSP_P-A Product feature CHAIN FJ349224_HBSP_P-A of FT:mat_peptide FJ349224_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ349296_HBSP_P-A Product feature CHAIN FJ349296_HBSP_P-A of FT:mat_peptide FJ349296_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FJ692554_HBSP_P-A Product feature CHAIN FJ692554_HBSP_P-A of FT:mat_peptide FJ692554_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAKAARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ692557_HBSP_P-A Product feature CHAIN FJ692557_HBSP_P-A of FT:mat_peptide FJ692557_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692558_HBSP_P-A Product feature CHAIN FJ692558_HBSP_P-A of FT:mat_peptide FJ692558_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETVAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692559_HBSP_P-A Product feature CHAIN FJ692559_HBSP_P-A of FT:mat_peptide FJ692559_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQXFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGXLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692561_HBSP_P-A Product feature CHAIN FJ692561_HBSP_P-A of FT:mat_peptide FJ692561_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRXLLLLDVEPEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692562_HBSP_P-A Product feature CHAIN FJ692562_HBSP_P-A of FT:mat_peptide FJ692562_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692563_HBSP_P-A Product feature CHAIN FJ692563_HBSP_P-A of FT:mat_peptide FJ692563_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692564_HBSP_P-A Product feature CHAIN FJ692564_HBSP_P-A of FT:mat_peptide FJ692564_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692565_HBSP_P-A Product feature CHAIN FJ692565_HBSP_P-A of FT:mat_peptide FJ692565_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEXEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692566_HBSP_P-A Product feature CHAIN FJ692566_HBSP_P-A of FT:mat_peptide FJ692566_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692567_HBSP_P-A Product feature CHAIN FJ692567_HBSP_P-A of FT:mat_peptide FJ692567_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNXNDQQPPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692570_HBSP_P-A Product feature CHAIN FJ692570_HBSP_P-A of FT:mat_peptide FJ692570_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50010). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPAXLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692571_HBSP_P-A Product feature CHAIN FJ692571_HBSP_P-A of FT:mat_peptide FJ692571_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRHVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692572_HBSP_P-A Product feature CHAIN FJ692572_HBSP_P-A of FT:mat_peptide FJ692572_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50013). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLXFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692574_HBSP_P-A Product feature CHAIN FJ692574_HBSP_P-A of FT:mat_peptide FJ692574_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692575_HBSP_P-A Product feature CHAIN FJ692575_HBSP_P-A of FT:mat_peptide FJ692575_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692576_HBSP_P-A Product feature CHAIN FJ692576_HBSP_P-A of FT:mat_peptide FJ692576_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLEDDPEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692577_HBSP_P-A Product feature CHAIN FJ692577_HBSP_P-A of FT:mat_peptide FJ692577_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692578_HBSP_P-A Product feature CHAIN FJ692578_HBSP_P-A of FT:mat_peptide FJ692578_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692579_HBSP_P-A Product feature CHAIN FJ692579_HBSP_P-A of FT:mat_peptide FJ692579_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692580_HBSP_P-A Product feature CHAIN FJ692580_HBSP_P-A of FT:mat_peptide FJ692580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692581_HBSP_P-A Product feature CHAIN FJ692581_HBSP_P-A of FT:mat_peptide FJ692581_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692582_HBSP_P-A Product feature CHAIN FJ692582_HBSP_P-A of FT:mat_peptide FJ692582_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692583_HBSP_P-A Product feature CHAIN FJ692583_HBSP_P-A of FT:mat_peptide FJ692583_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692584_HBSP_P-A Product feature CHAIN FJ692584_HBSP_P-A of FT:mat_peptide FJ692584_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692585_HBSP_P-A Product feature CHAIN FJ692585_HBSP_P-A of FT:mat_peptide FJ692585_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692586_HBSP_P-A Product feature CHAIN FJ692586_HBSP_P-A of FT:mat_peptide FJ692586_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEXLNRRVAEDLNLGNLNDQQRPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692587_HBSP_P-A Product feature CHAIN FJ692587_HBSP_P-A of FT:mat_peptide FJ692587_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692588_HBSP_P-A Product feature CHAIN FJ692588_HBSP_P-A of FT:mat_peptide FJ692588_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=114 residues).
MPLSYQHFRKLLLLDDETGKAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQN
LRMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692590_HBSP_P-A Product feature CHAIN FJ692590_HBSP_P-A of FT:mat_peptide FJ692590_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692591_HBSP_P-A Product feature CHAIN FJ692591_HBSP_P-A of FT:mat_peptide FJ692591_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692592_HBSP_P-A Product feature CHAIN FJ692592_HBSP_P-A of FT:mat_peptide FJ692592_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692593_HBSP_P-A Product feature CHAIN FJ692593_HBSP_P-A of FT:mat_peptide FJ692593_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNLRT
EIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692595_HBSP_P-A Product feature CHAIN FJ692595_HBSP_P-A of FT:mat_peptide FJ692595_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNDTEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692596_HBSP_P-A Product feature CHAIN FJ692596_HBSP_P-A of FT:mat_peptide FJ692596_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692597_HBSP_P-A Product feature CHAIN FJ692597_HBSP_P-A of FT:mat_peptide FJ692597_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXXSEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692598_HBSP_P-A Product feature CHAIN FJ692598_HBSP_P-A of FT:mat_peptide FJ692598_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692599_HBSP_P-A Product feature CHAIN FJ692599_HBSP_P-A of FT:mat_peptide FJ692599_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYRHFLKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692600_HBSP_P-A Product feature CHAIN FJ692600_HBSP_P-A of FT:mat_peptide FJ692600_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDXTEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692601_HBSP_P-A Product feature CHAIN FJ692601_HBSP_P-A of FT:mat_peptide FJ692601_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692602_HBSP_P-A Product feature CHAIN FJ692602_HBSP_P-A of FT:mat_peptide FJ692602_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692603_HBSP_P-A Product feature CHAIN FJ692603_HBSP_P-A of FT:mat_peptide FJ692603_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEELNHRVAEDLNLGNLNDPQPPVRDPAEPALLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692604_HBSP_P-A Product feature CHAIN FJ692604_HBSP_P-A of FT:mat_peptide FJ692604_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692605_HBSP_P-A Product feature CHAIN FJ692605_HBSP_P-A of FT:mat_peptide FJ692605_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692606_HBSP_P-A Product feature CHAIN FJ692606_HBSP_P-A of FT:mat_peptide FJ692606_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPXVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692607_HBSP_P-A Product feature CHAIN FJ692607_HBSP_P-A of FT:mat_peptide FJ692607_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692608_HBSP_P-A Product feature CHAIN FJ692608_HBSP_P-A of FT:mat_peptide FJ692608_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692609_HBSP_P-A Product feature CHAIN FJ692609_HBSP_P-A of FT:mat_peptide FJ692609_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50098). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
WTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692610_HBSP_P-A Product feature CHAIN FJ692610_HBSP_P-A of FT:mat_peptide FJ692610_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50104). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEXEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
WTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692611_HBSP_P-A Product feature CHAIN FJ692611_HBSP_P-A of FT:mat_peptide FJ692611_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692612_HBSP_P-A Product feature CHAIN FJ692612_HBSP_P-A of FT:mat_peptide FJ692612_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692613_HBSP_P-A Product feature CHAIN FJ692613_HBSP_P-A of FT:mat_peptide FJ692613_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDEIEAGPLEDELPRLADEDLNHRVAEDLNLGNLTDPQPPVRDPAEPARLLLKATLYYPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ904411_HBSP_P-A Product feature CHAIN FJ904411_HBSP_P-A of FT:mat_peptide FJ904411_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A55). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ904434_HBSP_P-A Product feature CHAIN FJ904434_HBSP_P-A of FT:mat_peptide FJ904434_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMETAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199974_HBSP_P-A Product feature CHAIN FM199974_HBSP_P-A of FT:mat_peptide FM199974_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199975_HBSP_P-A Product feature CHAIN FM199975_HBSP_P-A of FT:mat_peptide FM199975_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSXQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199976_HBSP_P-A Product feature CHAIN FM199976_HBSP_P-A of FT:mat_peptide FM199976_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199977_HBSP_P-A Product feature CHAIN FM199977_HBSP_P-A of FT:mat_peptide FM199977_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199978_HBSP_P-A Product feature CHAIN FM199978_HBSP_P-A of FT:mat_peptide FM199978_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199979_HBSP_P-A Product feature CHAIN FM199979_HBSP_P-A of FT:mat_peptide FM199979_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199980_HBSP_P-A Product feature CHAIN FM199980_HBSP_P-A of FT:mat_peptide FM199980_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAXLCFPHVAVQNL
RLEIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|FM199981_HBSP_P-A Product feature CHAIN FM199981_HBSP_P-A of FT:mat_peptide FM199981_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRXVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FN545825_HBSP_P-A Product feature CHAIN FN545825_HBSP_P-A of FT:mat_peptide FN545825_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEXLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545826_HBSP_P-A Product feature CHAIN FN545826_HBSP_P-A of FT:mat_peptide FN545826_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQRPVQDPAKPARLLLKATLCFPHVXVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545828_HBSP_P-A Product feature CHAIN FN545828_HBSP_P-A of FT:mat_peptide FN545828_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTQAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHHGLSQNTYGSGPQSVSXGSVY
>gnl|hbvpro|FN545829_HBSP_P-A Product feature CHAIN FN545829_HBSP_P-A of FT:mat_peptide FN545829_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTELGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCSPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545830_HBSP_P-A Product feature CHAIN FN545830_HBSP_P-A of FT:mat_peptide FN545830_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPRPPXRDPAEPARLLLKATLCFPPVVVQNL
RTEIAPVFPSPHHGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545831_HBSP_P-A Product feature CHAIN FN545831_HBSP_P-A of FT:mat_peptide FN545831_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDPQPPARDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545833_HBSP_P-A Product feature CHAIN FN545833_HBSP_P-A of FT:mat_peptide FN545833_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPPVVVQNL
RTEIAPVFPSHXPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545834_HBSP_P-A Product feature CHAIN FN545834_HBSP_P-A of FT:mat_peptide FN545834_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPPVVVQNL
RTEIAPVFPSHRPGLSQBXYGSGPQSVSPGSVY
>gnl|hbvpro|FN545835_HBSP_P-A Product feature CHAIN FN545835_HBSP_P-A of FT:mat_peptide FN545835_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHHGLSQNTYGGGPQSVSPGSVY
>gnl|hbvpro|FN545836_HBSP_P-A Product feature CHAIN FN545836_HBSP_P-A of FT:mat_peptide FN545836_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDPQLPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545837_HBSP_P-A Product feature CHAIN FN545837_HBSP_P-A of FT:mat_peptide FN545837_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARXPAKPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545838_HBSP_P-A Product feature CHAIN FN545838_HBSP_P-A of FT:mat_peptide FN545838_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDYGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545839_HBSP_P-A Product feature CHAIN FN545839_HBSP_P-A of FT:mat_peptide FN545839_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLXVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545840_HBSP_P-A Product feature CHAIN FN545840_HBSP_P-A of FT:mat_peptide FN545840_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ161813_HBSP_P-A Product feature CHAIN GQ161813_HBSP_P-A of FT:mat_peptide GQ161813_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHHGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ184323_HBSP_P-A Product feature CHAIN GQ184323_HBSP_P-A of FT:mat_peptide GQ184323_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ184324_HBSP_P-A Product feature CHAIN GQ184324_HBSP_P-A of FT:mat_peptide GQ184324_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|GQ331046_HBSP_P-A Product feature CHAIN GQ331046_HBSP_P-A of FT:mat_peptide GQ331046_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPNEPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ331047_HBSP_P-A Product feature CHAIN GQ331047_HBSP_P-A of FT:mat_peptide GQ331047_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNPNEPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ414522_HBSP_P-A Product feature CHAIN GQ414522_HBSP_P-A of FT:mat_peptide GQ414522_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477461_HBSP_P-A Product feature CHAIN GQ477461_HBSP_P-A of FT:mat_peptide GQ477461_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477462_HBSP_P-A Product feature CHAIN GQ477462_HBSP_P-A of FT:mat_peptide GQ477462_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLHLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477463_HBSP_P-A Product feature CHAIN GQ477463_HBSP_P-A of FT:mat_peptide GQ477463_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=114 residues).
MPLSYQLFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVYW
>gnl|hbvpro|GQ477464_HBSP_P-A Product feature CHAIN GQ477464_HBSP_P-A of FT:mat_peptide GQ477464_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477465_HBSP_P-A Product feature CHAIN GQ477465_HBSP_P-A of FT:mat_peptide GQ477465_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLFVDDGSEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477466_HBSP_P-A Product feature CHAIN GQ477466_HBSP_P-A of FT:mat_peptide GQ477466_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477467_HBSP_P-A Product feature CHAIN GQ477467_HBSP_P-A of FT:mat_peptide GQ477467_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477468_HBSP_P-A Product feature CHAIN GQ477468_HBSP_P-A of FT:mat_peptide GQ477468_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477469_HBSP_P-A Product feature CHAIN GQ477469_HBSP_P-A of FT:mat_peptide GQ477469_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQSFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477470_HBSP_P-A Product feature CHAIN GQ477470_HBSP_P-A of FT:mat_peptide GQ477470_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477472_HBSP_P-A Product feature CHAIN GQ477472_HBSP_P-A of FT:mat_peptide GQ477472_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQYFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477473_HBSP_P-A Product feature CHAIN GQ477473_HBSP_P-A of FT:mat_peptide GQ477473_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477475_HBSP_P-A Product feature CHAIN GQ477475_HBSP_P-A of FT:mat_peptide GQ477475_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477476_HBSP_P-A Product feature CHAIN GQ477476_HBSP_P-A of FT:mat_peptide GQ477476_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|GQ477477_HBSP_P-A Product feature CHAIN GQ477477_HBSP_P-A of FT:mat_peptide GQ477477_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNEQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477478_HBSP_P-A Product feature CHAIN GQ477478_HBSP_P-A of FT:mat_peptide GQ477478_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKILLLDHGAEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARFLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477479_HBSP_P-A Product feature CHAIN GQ477479_HBSP_P-A of FT:mat_peptide GQ477479_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477480_HBSP_P-A Product feature CHAIN GQ477480_HBSP_P-A of FT:mat_peptide GQ477480_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477482_HBSP_P-A Product feature CHAIN GQ477482_HBSP_P-A of FT:mat_peptide GQ477482_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477484_HBSP_P-A Product feature CHAIN GQ477484_HBSP_P-A of FT:mat_peptide GQ477484_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDSTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477487_HBSP_P-A Product feature CHAIN GQ477487_HBSP_P-A of FT:mat_peptide GQ477487_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477488_HBSP_P-A Product feature CHAIN GQ477488_HBSP_P-A of FT:mat_peptide GQ477488_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477490_HBSP_P-A Product feature CHAIN GQ477490_HBSP_P-A of FT:mat_peptide GQ477490_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477491_HBSP_P-A Product feature CHAIN GQ477491_HBSP_P-A of FT:mat_peptide GQ477491_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477493_HBSP_P-A Product feature CHAIN GQ477493_HBSP_P-A of FT:mat_peptide GQ477493_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477494_HBSP_P-A Product feature CHAIN GQ477494_HBSP_P-A of FT:mat_peptide GQ477494_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P80). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRGHAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477495_HBSP_P-A Product feature CHAIN GQ477495_HBSP_P-A of FT:mat_peptide GQ477495_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKTALCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477496_HBSP_P-A Product feature CHAIN GQ477496_HBSP_P-A of FT:mat_peptide GQ477496_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477497_HBSP_P-A Product feature CHAIN GQ477497_HBSP_P-A of FT:mat_peptide GQ477497_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLTDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477498_HBSP_P-A Product feature CHAIN GQ477498_HBSP_P-A of FT:mat_peptide GQ477498_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477499_HBSP_P-A Product feature CHAIN GQ477499_HBSP_P-A of FT:mat_peptide GQ477499_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P105). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADANLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477500_HBSP_P-A Product feature CHAIN GQ477500_HBSP_P-A of FT:mat_peptide GQ477500_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|GQ477501_HBSP_P-A Product feature CHAIN GQ477501_HBSP_P-A of FT:mat_peptide GQ477501_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHCPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477502_HBSP_P-A Product feature CHAIN GQ477502_HBSP_P-A of FT:mat_peptide GQ477502_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDHETEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMETAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477503_HBSP_P-A Product feature CHAIN GQ477503_HBSP_P-A of FT:mat_peptide GQ477503_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477504_HBSP_P-A Product feature CHAIN GQ477504_HBSP_P-A of FT:mat_peptide GQ477504_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVQDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563545_HBSP_P-A Product feature CHAIN GU563545_HBSP_P-A of FT:mat_peptide GU563545_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563546_HBSP_P-A Product feature CHAIN GU563546_HBSP_P-A of FT:mat_peptide GU563546_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563547_HBSP_P-A Product feature CHAIN GU563547_HBSP_P-A of FT:mat_peptide GU563547_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563548_HBSP_P-A Product feature CHAIN GU563548_HBSP_P-A of FT:mat_peptide GU563548_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563550_HBSP_P-A Product feature CHAIN GU563550_HBSP_P-A of FT:mat_peptide GU563550_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|GU563551_HBSP_P-A Product feature CHAIN GU563551_HBSP_P-A of FT:mat_peptide GU563551_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-124). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563553_HBSP_P-A Product feature CHAIN GU563553_HBSP_P-A of FT:mat_peptide GU563553_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563554_HBSP_P-A Product feature CHAIN GU563554_HBSP_P-A of FT:mat_peptide GU563554_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563555_HBSP_P-A Product feature CHAIN GU563555_HBSP_P-A of FT:mat_peptide GU563555_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563557_HBSP_P-A Product feature CHAIN GU563557_HBSP_P-A of FT:mat_peptide GU563557_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563558_HBSP_P-A Product feature CHAIN GU563558_HBSP_P-A of FT:mat_peptide GU563558_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563562_HBSP_P-A Product feature CHAIN GU563562_HBSP_P-A of FT:mat_peptide GU563562_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HE576988_HBSP_P-A Product feature CHAIN HE576988_HBSP_P-A of FT:mat_peptide HE576988_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RKEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HE576989_HBSP_P-A Product feature CHAIN HE576989_HBSP_P-A of FT:mat_peptide HE576989_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RKEIAPVFPSHCPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011485_HBSP_P-A Product feature CHAIN HM011485_HBSP_P-A of FT:mat_peptide HM011485_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETKAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM363612_HBSP_P-A Product feature CHAIN HM363612_HBSP_P-A of FT:mat_peptide HM363612_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM363613_HBSP_P-A Product feature CHAIN HM363613_HBSP_P-A of FT:mat_peptide HM363613_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|HM535200_HBSP_P-A Product feature CHAIN HM535200_HBSP_P-A of FT:mat_peptide HM535200_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM535205_HBSP_P-A Product feature CHAIN HM535205_HBSP_P-A of FT:mat_peptide HM535205_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|JF439720_HBSP_P-A Product feature CHAIN JF439720_HBSP_P-A of FT:mat_peptide JF439720_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL437). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439721_HBSP_P-A Product feature CHAIN JF439721_HBSP_P-A of FT:mat_peptide JF439721_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439722_HBSP_P-A Product feature CHAIN JF439722_HBSP_P-A of FT:mat_peptide JF439722_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439723_HBSP_P-A Product feature CHAIN JF439723_HBSP_P-A of FT:mat_peptide JF439723_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439724_HBSP_P-A Product feature CHAIN JF439724_HBSP_P-A of FT:mat_peptide JF439724_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439725_HBSP_P-A Product feature CHAIN JF439725_HBSP_P-A of FT:mat_peptide JF439725_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL451). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439727_HBSP_P-A Product feature CHAIN JF439727_HBSP_P-A of FT:mat_peptide JF439727_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL453). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439728_HBSP_P-A Product feature CHAIN JF439728_HBSP_P-A of FT:mat_peptide JF439728_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL454). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439729_HBSP_P-A Product feature CHAIN JF439729_HBSP_P-A of FT:mat_peptide JF439729_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439730_HBSP_P-A Product feature CHAIN JF439730_HBSP_P-A of FT:mat_peptide JF439730_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439732_HBSP_P-A Product feature CHAIN JF439732_HBSP_P-A of FT:mat_peptide JF439732_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439733_HBSP_P-A Product feature CHAIN JF439733_HBSP_P-A of FT:mat_peptide JF439733_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439735_HBSP_P-A Product feature CHAIN JF439735_HBSP_P-A of FT:mat_peptide JF439735_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439736_HBSP_P-A Product feature CHAIN JF439736_HBSP_P-A of FT:mat_peptide JF439736_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439737_HBSP_P-A Product feature CHAIN JF439737_HBSP_P-A of FT:mat_peptide JF439737_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439738_HBSP_P-A Product feature CHAIN JF439738_HBSP_P-A of FT:mat_peptide JF439738_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439739_HBSP_P-A Product feature CHAIN JF439739_HBSP_P-A of FT:mat_peptide JF439739_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL467). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLEATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439740_HBSP_P-A Product feature CHAIN JF439740_HBSP_P-A of FT:mat_peptide JF439740_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL468). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439741_HBSP_P-A Product feature CHAIN JF439741_HBSP_P-A of FT:mat_peptide JF439741_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439742_HBSP_P-A Product feature CHAIN JF439742_HBSP_P-A of FT:mat_peptide JF439742_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439743_HBSP_P-A Product feature CHAIN JF439743_HBSP_P-A of FT:mat_peptide JF439743_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439745_HBSP_P-A Product feature CHAIN JF439745_HBSP_P-A of FT:mat_peptide JF439745_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL474). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439746_HBSP_P-A Product feature CHAIN JF439746_HBSP_P-A of FT:mat_peptide JF439746_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439747_HBSP_P-A Product feature CHAIN JF439747_HBSP_P-A of FT:mat_peptide JF439747_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYRHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439748_HBSP_P-A Product feature CHAIN JF439748_HBSP_P-A of FT:mat_peptide JF439748_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDPNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439750_HBSP_P-A Product feature CHAIN JF439750_HBSP_P-A of FT:mat_peptide JF439750_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL498). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439751_HBSP_P-A Product feature CHAIN JF439751_HBSP_P-A of FT:mat_peptide JF439751_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439752_HBSP_P-A Product feature CHAIN JF439752_HBSP_P-A of FT:mat_peptide JF439752_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439753_HBSP_P-A Product feature CHAIN JF439753_HBSP_P-A of FT:mat_peptide JF439753_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439754_HBSP_P-A Product feature CHAIN JF439754_HBSP_P-A of FT:mat_peptide JF439754_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439755_HBSP_P-A Product feature CHAIN JF439755_HBSP_P-A of FT:mat_peptide JF439755_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439756_HBSP_P-A Product feature CHAIN JF439756_HBSP_P-A of FT:mat_peptide JF439756_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439757_HBSP_P-A Product feature CHAIN JF439757_HBSP_P-A of FT:mat_peptide JF439757_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439758_HBSP_P-A Product feature CHAIN JF439758_HBSP_P-A of FT:mat_peptide JF439758_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439759_HBSP_P-A Product feature CHAIN JF439759_HBSP_P-A of FT:mat_peptide JF439759_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439760_HBSP_P-A Product feature CHAIN JF439760_HBSP_P-A of FT:mat_peptide JF439760_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439761_HBSP_P-A Product feature CHAIN JF439761_HBSP_P-A of FT:mat_peptide JF439761_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439762_HBSP_P-A Product feature CHAIN JF439762_HBSP_P-A of FT:mat_peptide JF439762_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439763_HBSP_P-A Product feature CHAIN JF439763_HBSP_P-A of FT:mat_peptide JF439763_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439764_HBSP_P-A Product feature CHAIN JF439764_HBSP_P-A of FT:mat_peptide JF439764_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439765_HBSP_P-A Product feature CHAIN JF439765_HBSP_P-A of FT:mat_peptide JF439765_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439766_HBSP_P-A Product feature CHAIN JF439766_HBSP_P-A of FT:mat_peptide JF439766_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439767_HBSP_P-A Product feature CHAIN JF439767_HBSP_P-A of FT:mat_peptide JF439767_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439768_HBSP_P-A Product feature CHAIN JF439768_HBSP_P-A of FT:mat_peptide JF439768_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439769_HBSP_P-A Product feature CHAIN JF439769_HBSP_P-A of FT:mat_peptide JF439769_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439770_HBSP_P-A Product feature CHAIN JF439770_HBSP_P-A of FT:mat_peptide JF439770_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439771_HBSP_P-A Product feature CHAIN JF439771_HBSP_P-A of FT:mat_peptide JF439771_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439772_HBSP_P-A Product feature CHAIN JF439772_HBSP_P-A of FT:mat_peptide JF439772_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439773_HBSP_P-A Product feature CHAIN JF439773_HBSP_P-A of FT:mat_peptide JF439773_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439774_HBSP_P-A Product feature CHAIN JF439774_HBSP_P-A of FT:mat_peptide JF439774_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439775_HBSP_P-A Product feature CHAIN JF439775_HBSP_P-A of FT:mat_peptide JF439775_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C9). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439777_HBSP_P-A Product feature CHAIN JF439777_HBSP_P-A of FT:mat_peptide JF439777_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439778_HBSP_P-A Product feature CHAIN JF439778_HBSP_P-A of FT:mat_peptide JF439778_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439819_HBSP_P-A Product feature CHAIN JF439819_HBSP_P-A of FT:mat_peptide JF439819_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97A1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPERDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439820_HBSP_P-A Product feature CHAIN JF439820_HBSP_P-A of FT:mat_peptide JF439820_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRGHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439821_HBSP_P-A Product feature CHAIN JF439821_HBSP_P-A of FT:mat_peptide JF439821_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTDAGSLKEELPRLADADLNRRVAEDLXLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSIGSVY
>gnl|hbvpro|JF439822_HBSP_P-A Product feature CHAIN JF439822_HBSP_P-A of FT:mat_peptide JF439822_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439823_HBSP_P-A Product feature CHAIN JF439823_HBSP_P-A of FT:mat_peptide JF439823_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPERDHAKPARLLLKATLCFPHVAVQNL
RMEVAPVSPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439824_HBSP_P-A Product feature CHAIN JF439824_HBSP_P-A of FT:mat_peptide JF439824_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439825_HBSP_P-A Product feature CHAIN JF439825_HBSP_P-A of FT:mat_peptide JF439825_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439826_HBSP_P-A Product feature CHAIN JF439826_HBSP_P-A of FT:mat_peptide JF439826_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439827_HBSP_P-A Product feature CHAIN JF439827_HBSP_P-A of FT:mat_peptide JF439827_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPERDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439828_HBSP_P-A Product feature CHAIN JF439828_HBSP_P-A of FT:mat_peptide JF439828_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439829_HBSP_P-A Product feature CHAIN JF439829_HBSP_P-A of FT:mat_peptide JF439829_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439830_HBSP_P-A Product feature CHAIN JF439830_HBSP_P-A of FT:mat_peptide JF439830_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97G2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439831_HBSP_P-A Product feature CHAIN JF439831_HBSP_P-A of FT:mat_peptide JF439831_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439832_HBSP_P-A Product feature CHAIN JF439832_HBSP_P-A of FT:mat_peptide JF439832_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDRQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439833_HBSP_P-A Product feature CHAIN JF439833_HBSP_P-A of FT:mat_peptide JF439833_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439834_HBSP_P-A Product feature CHAIN JF439834_HBSP_P-A of FT:mat_peptide JF439834_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99A4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439835_HBSP_P-A Product feature CHAIN JF439835_HBSP_P-A of FT:mat_peptide JF439835_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439836_HBSP_P-A Product feature CHAIN JF439836_HBSP_P-A of FT:mat_peptide JF439836_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDNAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439837_HBSP_P-A Product feature CHAIN JF439837_HBSP_P-A of FT:mat_peptide JF439837_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439838_HBSP_P-A Product feature CHAIN JF439838_HBSP_P-A of FT:mat_peptide JF439838_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPAFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439839_HBSP_P-A Product feature CHAIN JF439839_HBSP_P-A of FT:mat_peptide JF439839_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439840_HBSP_P-A Product feature CHAIN JF439840_HBSP_P-A of FT:mat_peptide JF439840_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDNAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439841_HBSP_P-A Product feature CHAIN JF439841_HBSP_P-A of FT:mat_peptide JF439841_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439842_HBSP_P-A Product feature CHAIN JF439842_HBSP_P-A of FT:mat_peptide JF439842_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSISHGSVY
>gnl|hbvpro|JF439843_HBSP_P-A Product feature CHAIN JF439843_HBSP_P-A of FT:mat_peptide JF439843_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLPLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439844_HBSP_P-A Product feature CHAIN JF439844_HBSP_P-A of FT:mat_peptide JF439844_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439845_HBSP_P-A Product feature CHAIN JF439845_HBSP_P-A of FT:mat_peptide JF439845_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439846_HBSP_P-A Product feature CHAIN JF439846_HBSP_P-A of FT:mat_peptide JF439846_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLYFPHVAVQNL
RMEIAPVFPSHRPGLSQSTYGSGPQSASHGSVY
>gnl|hbvpro|JF439847_HBSP_P-A Product feature CHAIN JF439847_HBSP_P-A of FT:mat_peptide JF439847_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439848_HBSP_P-A Product feature CHAIN JF439848_HBSP_P-A of FT:mat_peptide JF439848_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439849_HBSP_P-A Product feature CHAIN JF439849_HBSP_P-A of FT:mat_peptide JF439849_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439850_HBSP_P-A Product feature CHAIN JF439850_HBSP_P-A of FT:mat_peptide JF439850_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDNAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439851_HBSP_P-A Product feature CHAIN JF439851_HBSP_P-A of FT:mat_peptide JF439851_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439852_HBSP_P-A Product feature CHAIN JF439852_HBSP_P-A of FT:mat_peptide JF439852_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439853_HBSP_P-A Product feature CHAIN JF439853_HBSP_P-A of FT:mat_peptide JF439853_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439854_HBSP_P-A Product feature CHAIN JF439854_HBSP_P-A of FT:mat_peptide JF439854_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSRRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439855_HBSP_P-A Product feature CHAIN JF439855_HBSP_P-A of FT:mat_peptide JF439855_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDNAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439856_HBSP_P-A Product feature CHAIN JF439856_HBSP_P-A of FT:mat_peptide JF439856_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSRRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439857_HBSP_P-A Product feature CHAIN JF439857_HBSP_P-A of FT:mat_peptide JF439857_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439858_HBSP_P-A Product feature CHAIN JF439858_HBSP_P-A of FT:mat_peptide JF439858_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPAFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439859_HBSP_P-A Product feature CHAIN JF439859_HBSP_P-A of FT:mat_peptide JF439859_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439860_HBSP_P-A Product feature CHAIN JF439860_HBSP_P-A of FT:mat_peptide JF439860_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPAFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439861_HBSP_P-A Product feature CHAIN JF439861_HBSP_P-A of FT:mat_peptide JF439861_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439862_HBSP_P-A Product feature CHAIN JF439862_HBSP_P-A of FT:mat_peptide JF439862_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05B7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439864_HBSP_P-A Product feature CHAIN JF439864_HBSP_P-A of FT:mat_peptide JF439864_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHSRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439865_HBSP_P-A Product feature CHAIN JF439865_HBSP_P-A of FT:mat_peptide JF439865_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHIAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439866_HBSP_P-A Product feature CHAIN JF439866_HBSP_P-A of FT:mat_peptide JF439866_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05F7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439867_HBSP_P-A Product feature CHAIN JF439867_HBSP_P-A of FT:mat_peptide JF439867_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05G8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439868_HBSP_P-A Product feature CHAIN JF439868_HBSP_P-A of FT:mat_peptide JF439868_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSIY
>gnl|hbvpro|JF439886_HBSP_P-A Product feature CHAIN JF439886_HBSP_P-A of FT:mat_peptide JF439886_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F1). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLRCPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439887_HBSP_P-A Product feature CHAIN JF439887_HBSP_P-A of FT:mat_peptide JF439887_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F2_rev_comp). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439888_HBSP_P-A Product feature CHAIN JF439888_HBSP_P-A of FT:mat_peptide JF439888_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F3). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439889_HBSP_P-A Product feature CHAIN JF439889_HBSP_P-A of FT:mat_peptide JF439889_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F4). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439890_HBSP_P-A Product feature CHAIN JF439890_HBSP_P-A of FT:mat_peptide JF439890_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F5). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLRCPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439891_HBSP_P-A Product feature CHAIN JF439891_HBSP_P-A of FT:mat_peptide JF439891_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F6). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439892_HBSP_P-A Product feature CHAIN JF439892_HBSP_P-A of FT:mat_peptide JF439892_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F8). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439893_HBSP_P-A Product feature CHAIN JF439893_HBSP_P-A of FT:mat_peptide JF439893_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F9). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439894_HBSP_P-A Product feature CHAIN JF439894_HBSP_P-A of FT:mat_peptide JF439894_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F11). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439895_HBSP_P-A Product feature CHAIN JF439895_HBSP_P-A of FT:mat_peptide JF439895_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F12). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439896_HBSP_P-A Product feature CHAIN JF439896_HBSP_P-A of FT:mat_peptide JF439896_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439897_HBSP_P-A Product feature CHAIN JF439897_HBSP_P-A of FT:mat_peptide JF439897_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439898_HBSP_P-A Product feature CHAIN JF439898_HBSP_P-A of FT:mat_peptide JF439898_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439899_HBSP_P-A Product feature CHAIN JF439899_HBSP_P-A of FT:mat_peptide JF439899_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439900_HBSP_P-A Product feature CHAIN JF439900_HBSP_P-A of FT:mat_peptide JF439900_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439901_HBSP_P-A Product feature CHAIN JF439901_HBSP_P-A of FT:mat_peptide JF439901_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439902_HBSP_P-A Product feature CHAIN JF439902_HBSP_P-A of FT:mat_peptide JF439902_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439903_HBSP_P-A Product feature CHAIN JF439903_HBSP_P-A of FT:mat_peptide JF439903_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439904_HBSP_P-A Product feature CHAIN JF439904_HBSP_P-A of FT:mat_peptide JF439904_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439905_HBSP_P-A Product feature CHAIN JF439905_HBSP_P-A of FT:mat_peptide JF439905_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439906_HBSP_P-A Product feature CHAIN JF439906_HBSP_P-A of FT:mat_peptide JF439906_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439907_HBSP_P-A Product feature CHAIN JF439907_HBSP_P-A of FT:mat_peptide JF439907_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439908_HBSP_P-A Product feature CHAIN JF439908_HBSP_P-A of FT:mat_peptide JF439908_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439909_HBSP_P-A Product feature CHAIN JF439909_HBSP_P-A of FT:mat_peptide JF439909_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439910_HBSP_P-A Product feature CHAIN JF439910_HBSP_P-A of FT:mat_peptide JF439910_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439911_HBSP_P-A Product feature CHAIN JF439911_HBSP_P-A of FT:mat_peptide JF439911_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439912_HBSP_P-A Product feature CHAIN JF439912_HBSP_P-A of FT:mat_peptide JF439912_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439913_HBSP_P-A Product feature CHAIN JF439913_HBSP_P-A of FT:mat_peptide JF439913_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439914_HBSP_P-A Product feature CHAIN JF439914_HBSP_P-A of FT:mat_peptide JF439914_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSYRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439915_HBSP_P-A Product feature CHAIN JF439915_HBSP_P-A of FT:mat_peptide JF439915_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439916_HBSP_P-A Product feature CHAIN JF439916_HBSP_P-A of FT:mat_peptide JF439916_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439917_HBSP_P-A Product feature CHAIN JF439917_HBSP_P-A of FT:mat_peptide JF439917_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLPKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439918_HBSP_P-A Product feature CHAIN JF439918_HBSP_P-A of FT:mat_peptide JF439918_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439919_HBSP_P-A Product feature CHAIN JF439919_HBSP_P-A of FT:mat_peptide JF439919_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRGHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439920_HBSP_P-A Product feature CHAIN JF439920_HBSP_P-A of FT:mat_peptide JF439920_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439921_HBSP_P-A Product feature CHAIN JF439921_HBSP_P-A of FT:mat_peptide JF439921_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439922_HBSP_P-A Product feature CHAIN JF439922_HBSP_P-A of FT:mat_peptide JF439922_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439923_HBSP_P-A Product feature CHAIN JF439923_HBSP_P-A of FT:mat_peptide JF439923_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439924_HBSP_P-A Product feature CHAIN JF439924_HBSP_P-A of FT:mat_peptide JF439924_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439925_HBSP_P-A Product feature CHAIN JF439925_HBSP_P-A of FT:mat_peptide JF439925_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MLLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439926_HBSP_P-A Product feature CHAIN JF439926_HBSP_P-A of FT:mat_peptide JF439926_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B4). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MSLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLDSVY
>gnl|hbvpro|JF439927_HBSP_P-A Product feature CHAIN JF439927_HBSP_P-A of FT:mat_peptide JF439927_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439928_HBSP_P-A Product feature CHAIN JF439928_HBSP_P-A of FT:mat_peptide JF439928_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439929_HBSP_P-A Product feature CHAIN JF439929_HBSP_P-A of FT:mat_peptide JF439929_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439930_HBSP_P-A Product feature CHAIN JF439930_HBSP_P-A of FT:mat_peptide JF439930_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439931_HBSP_P-A Product feature CHAIN JF439931_HBSP_P-A of FT:mat_peptide JF439931_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTRAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439932_HBSP_P-A Product feature CHAIN JF439932_HBSP_P-A of FT:mat_peptide JF439932_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTESGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439933_HBSP_P-A Product feature CHAIN JF439933_HBSP_P-A of FT:mat_peptide JF439933_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439934_HBSP_P-A Product feature CHAIN JF439934_HBSP_P-A of FT:mat_peptide JF439934_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439935_HBSP_P-A Product feature CHAIN JF439935_HBSP_P-A of FT:mat_peptide JF439935_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTRAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439936_HBSP_P-A Product feature CHAIN JF439936_HBSP_P-A of FT:mat_peptide JF439936_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439937_HBSP_P-A Product feature CHAIN JF439937_HBSP_P-A of FT:mat_peptide JF439937_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSRRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439938_HBSP_P-A Product feature CHAIN JF439938_HBSP_P-A of FT:mat_peptide JF439938_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPIFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439939_HBSP_P-A Product feature CHAIN JF439939_HBSP_P-A of FT:mat_peptide JF439939_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439940_HBSP_P-A Product feature CHAIN JF439940_HBSP_P-A of FT:mat_peptide JF439940_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439941_HBSP_P-A Product feature CHAIN JF439941_HBSP_P-A of FT:mat_peptide JF439941_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439942_HBSP_P-A Product feature CHAIN JF439942_HBSP_P-A of FT:mat_peptide JF439942_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQSTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439943_HBSP_P-A Product feature CHAIN JF439943_HBSP_P-A of FT:mat_peptide JF439943_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439944_HBSP_P-A Product feature CHAIN JF439944_HBSP_P-A of FT:mat_peptide JF439944_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439945_HBSP_P-A Product feature CHAIN JF439945_HBSP_P-A of FT:mat_peptide JF439945_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439946_HBSP_P-A Product feature CHAIN JF439946_HBSP_P-A of FT:mat_peptide JF439946_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439947_HBSP_P-A Product feature CHAIN JF439947_HBSP_P-A of FT:mat_peptide JF439947_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439948_HBSP_P-A Product feature CHAIN JF439948_HBSP_P-A of FT:mat_peptide JF439948_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439949_HBSP_P-A Product feature CHAIN JF439949_HBSP_P-A of FT:mat_peptide JF439949_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439950_HBSP_P-A Product feature CHAIN JF439950_HBSP_P-A of FT:mat_peptide JF439950_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439951_HBSP_P-A Product feature CHAIN JF439951_HBSP_P-A of FT:mat_peptide JF439951_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAAQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439952_HBSP_P-A Product feature CHAIN JF439952_HBSP_P-A of FT:mat_peptide JF439952_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439953_HBSP_P-A Product feature CHAIN JF439953_HBSP_P-A of FT:mat_peptide JF439953_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439954_HBSP_P-A Product feature CHAIN JF439954_HBSP_P-A of FT:mat_peptide JF439954_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRILLLLDDETEAGPLEEELPRLADADLNRRVAEDLDLGNLNDRQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439955_HBSP_P-A Product feature CHAIN JF439955_HBSP_P-A of FT:mat_peptide JF439955_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439956_HBSP_P-A Product feature CHAIN JF439956_HBSP_P-A of FT:mat_peptide JF439956_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439957_HBSP_P-A Product feature CHAIN JF439957_HBSP_P-A of FT:mat_peptide JF439957_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439958_HBSP_P-A Product feature CHAIN JF439958_HBSP_P-A of FT:mat_peptide JF439958_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439959_HBSP_P-A Product feature CHAIN JF439959_HBSP_P-A of FT:mat_peptide JF439959_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439960_HBSP_P-A Product feature CHAIN JF439960_HBSP_P-A of FT:mat_peptide JF439960_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439961_HBSP_P-A Product feature CHAIN JF439961_HBSP_P-A of FT:mat_peptide JF439961_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439962_HBSP_P-A Product feature CHAIN JF439962_HBSP_P-A of FT:mat_peptide JF439962_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439963_HBSP_P-A Product feature CHAIN JF439963_HBSP_P-A of FT:mat_peptide JF439963_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLYDETEAGPLEEELPRLADADLNRRVAEDLNLGNFNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439964_HBSP_P-A Product feature CHAIN JF439964_HBSP_P-A of FT:mat_peptide JF439964_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLDRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439965_HBSP_P-A Product feature CHAIN JF439965_HBSP_P-A of FT:mat_peptide JF439965_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHVKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439966_HBSP_P-A Product feature CHAIN JF439966_HBSP_P-A of FT:mat_peptide JF439966_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c8). Partial genome (Contains: HBe, HBc, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADPNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439967_HBSP_P-A Product feature CHAIN JF439967_HBSP_P-A of FT:mat_peptide JF439967_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEARPLQQELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439968_HBSP_P-A Product feature CHAIN JF439968_HBSP_P-A of FT:mat_peptide JF439968_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439969_HBSP_P-A Product feature CHAIN JF439969_HBSP_P-A of FT:mat_peptide JF439969_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLHDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439970_HBSP_P-A Product feature CHAIN JF439970_HBSP_P-A of FT:mat_peptide JF439970_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLGDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439971_HBSP_P-A Product feature CHAIN JF439971_HBSP_P-A of FT:mat_peptide JF439971_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEGLPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439972_HBSP_P-A Product feature CHAIN JF439972_HBSP_P-A of FT:mat_peptide JF439972_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439973_HBSP_P-A Product feature CHAIN JF439973_HBSP_P-A of FT:mat_peptide JF439973_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439974_HBSP_P-A Product feature CHAIN JF439974_HBSP_P-A of FT:mat_peptide JF439974_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439975_HBSP_P-A Product feature CHAIN JF439975_HBSP_P-A of FT:mat_peptide JF439975_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELSRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439976_HBSP_P-A Product feature CHAIN JF439976_HBSP_P-A of FT:mat_peptide JF439976_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELSRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439977_HBSP_P-A Product feature CHAIN JF439977_HBSP_P-A of FT:mat_peptide JF439977_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439978_HBSP_P-A Product feature CHAIN JF439978_HBSP_P-A of FT:mat_peptide JF439978_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439979_HBSP_P-A Product feature CHAIN JF439979_HBSP_P-A of FT:mat_peptide JF439979_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RVEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439980_HBSP_P-A Product feature CHAIN JF439980_HBSP_P-A of FT:mat_peptide JF439980_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439981_HBSP_P-A Product feature CHAIN JF439981_HBSP_P-A of FT:mat_peptide JF439981_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439982_HBSP_P-A Product feature CHAIN JF439982_HBSP_P-A of FT:mat_peptide JF439982_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNPNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439983_HBSP_P-A Product feature CHAIN JF439983_HBSP_P-A of FT:mat_peptide JF439983_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439984_HBSP_P-A Product feature CHAIN JF439984_HBSP_P-A of FT:mat_peptide JF439984_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439985_HBSP_P-A Product feature CHAIN JF439985_HBSP_P-A of FT:mat_peptide JF439985_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439986_HBSP_P-A Product feature CHAIN JF439986_HBSP_P-A of FT:mat_peptide JF439986_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439987_HBSP_P-A Product feature CHAIN JF439987_HBSP_P-A of FT:mat_peptide JF439987_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQDL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439988_HBSP_P-A Product feature CHAIN JF439988_HBSP_P-A of FT:mat_peptide JF439988_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439989_HBSP_P-A Product feature CHAIN JF439989_HBSP_P-A of FT:mat_peptide JF439989_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439990_HBSP_P-A Product feature CHAIN JF439990_HBSP_P-A of FT:mat_peptide JF439990_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439991_HBSP_P-A Product feature CHAIN JF439991_HBSP_P-A of FT:mat_peptide JF439991_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439992_HBSP_P-A Product feature CHAIN JF439992_HBSP_P-A of FT:mat_peptide JF439992_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439993_HBSP_P-A Product feature CHAIN JF439993_HBSP_P-A of FT:mat_peptide JF439993_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF440016_HBSP_P-A Product feature CHAIN JF440016_HBSP_P-A of FT:mat_peptide JF440016_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B11). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF440018_HBSP_P-A Product feature CHAIN JF440018_HBSP_P-A of FT:mat_peptide JF440018_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF440020_HBSP_P-A Product feature CHAIN JF440020_HBSP_P-A of FT:mat_peptide JF440020_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JN182318_HBSP_P-A Product feature CHAIN JN182318_HBSP_P-A of FT:mat_peptide JN182318_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182319_HBSP_P-A Product feature CHAIN JN182319_HBSP_P-A of FT:mat_peptide JN182319_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182320_HBSP_P-A Product feature CHAIN JN182320_HBSP_P-A of FT:mat_peptide JN182320_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182321_HBSP_P-A Product feature CHAIN JN182321_HBSP_P-A of FT:mat_peptide JN182321_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182322_HBSP_P-A Product feature CHAIN JN182322_HBSP_P-A of FT:mat_peptide JN182322_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182323_HBSP_P-A Product feature CHAIN JN182323_HBSP_P-A of FT:mat_peptide JN182323_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182324_HBSP_P-A Product feature CHAIN JN182324_HBSP_P-A of FT:mat_peptide JN182324_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182325_HBSP_P-A Product feature CHAIN JN182325_HBSP_P-A of FT:mat_peptide JN182325_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182326_HBSP_P-A Product feature CHAIN JN182326_HBSP_P-A of FT:mat_peptide JN182326_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182327_HBSP_P-A Product feature CHAIN JN182327_HBSP_P-A of FT:mat_peptide JN182327_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182328_HBSP_P-A Product feature CHAIN JN182328_HBSP_P-A of FT:mat_peptide JN182328_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182329_HBSP_P-A Product feature CHAIN JN182329_HBSP_P-A of FT:mat_peptide JN182329_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182330_HBSP_P-A Product feature CHAIN JN182330_HBSP_P-A of FT:mat_peptide JN182330_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182332_HBSP_P-A Product feature CHAIN JN182332_HBSP_P-A of FT:mat_peptide JN182332_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182333_HBSP_P-A Product feature CHAIN JN182333_HBSP_P-A of FT:mat_peptide JN182333_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182334_HBSP_P-A Product feature CHAIN JN182334_HBSP_P-A of FT:mat_peptide JN182334_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAVDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ023660_HBSP_P-A Product feature CHAIN JQ023660_HBSP_P-A of FT:mat_peptide JQ023660_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
RPLSYQHFRKLLLLDDETEASPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ023661_HBSP_P-A Product feature CHAIN JQ023661_HBSP_P-A of FT:mat_peptide JQ023661_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=113 residues).
RPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ023662_HBSP_P-A Product feature CHAIN JQ023662_HBSP_P-A of FT:mat_peptide JQ023662_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1164). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
RPLSYQHFRKLLLFDDETEAGPLKEELPRLADENLNRRVAKDLNLGNLNDPQQPVRDPCKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ023663_HBSP_P-A Product feature CHAIN JQ023663_HBSP_P-A of FT:mat_peptide JQ023663_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1159). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
RPLSYQHFRKLLLFDDETEAGPLKEELPRLANENLNRRVAKNLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ687529_HBSP_P-A Product feature CHAIN JQ687529_HBSP_P-A of FT:mat_peptide JQ687529_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707299_HBSP_P-A Product feature CHAIN JQ707299_HBSP_P-A of FT:mat_peptide JQ707299_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707300_HBSP_P-A Product feature CHAIN JQ707300_HBSP_P-A of FT:mat_peptide JQ707300_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRIAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707301_HBSP_P-A Product feature CHAIN JQ707301_HBSP_P-A of FT:mat_peptide JQ707301_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707302_HBSP_P-A Product feature CHAIN JQ707302_HBSP_P-A of FT:mat_peptide JQ707302_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707303_HBSP_P-A Product feature CHAIN JQ707303_HBSP_P-A of FT:mat_peptide JQ707303_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707304_HBSP_P-A Product feature CHAIN JQ707304_HBSP_P-A of FT:mat_peptide JQ707304_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707305_HBSP_P-A Product feature CHAIN JQ707305_HBSP_P-A of FT:mat_peptide JQ707305_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSLSLGSVY
>gnl|hbvpro|JQ707306_HBSP_P-A Product feature CHAIN JQ707306_HBSP_P-A of FT:mat_peptide JQ707306_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C17). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707307_HBSP_P-A Product feature CHAIN JQ707307_HBSP_P-A of FT:mat_peptide JQ707307_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707308_HBSP_P-A Product feature CHAIN JQ707308_HBSP_P-A of FT:mat_peptide JQ707308_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707309_HBSP_P-A Product feature CHAIN JQ707309_HBSP_P-A of FT:mat_peptide JQ707309_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707310_HBSP_P-A Product feature CHAIN JQ707310_HBSP_P-A of FT:mat_peptide JQ707310_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707311_HBSP_P-A Product feature CHAIN JQ707311_HBSP_P-A of FT:mat_peptide JQ707311_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707312_HBSP_P-A Product feature CHAIN JQ707312_HBSP_P-A of FT:mat_peptide JQ707312_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707313_HBSP_P-A Product feature CHAIN JQ707313_HBSP_P-A of FT:mat_peptide JQ707313_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707314_HBSP_P-A Product feature CHAIN JQ707314_HBSP_P-A of FT:mat_peptide JQ707314_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707315_HBSP_P-A Product feature CHAIN JQ707315_HBSP_P-A of FT:mat_peptide JQ707315_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707316_HBSP_P-A Product feature CHAIN JQ707316_HBSP_P-A of FT:mat_peptide JQ707316_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707317_HBSP_P-A Product feature CHAIN JQ707317_HBSP_P-A of FT:mat_peptide JQ707317_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707318_HBSP_P-A Product feature CHAIN JQ707318_HBSP_P-A of FT:mat_peptide JQ707318_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707319_HBSP_P-A Product feature CHAIN JQ707319_HBSP_P-A of FT:mat_peptide JQ707319_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707320_HBSP_P-A Product feature CHAIN JQ707320_HBSP_P-A of FT:mat_peptide JQ707320_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707321_HBSP_P-A Product feature CHAIN JQ707321_HBSP_P-A of FT:mat_peptide JQ707321_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707322_HBSP_P-A Product feature CHAIN JQ707322_HBSP_P-A of FT:mat_peptide JQ707322_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707323_HBSP_P-A Product feature CHAIN JQ707323_HBSP_P-A of FT:mat_peptide JQ707323_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707324_HBSP_P-A Product feature CHAIN JQ707324_HBSP_P-A of FT:mat_peptide JQ707324_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHCLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707325_HBSP_P-A Product feature CHAIN JQ707325_HBSP_P-A of FT:mat_peptide JQ707325_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLMLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707326_HBSP_P-A Product feature CHAIN JQ707326_HBSP_P-A of FT:mat_peptide JQ707326_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHCLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707327_HBSP_P-A Product feature CHAIN JQ707327_HBSP_P-A of FT:mat_peptide JQ707327_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707328_HBSP_P-A Product feature CHAIN JQ707328_HBSP_P-A of FT:mat_peptide JQ707328_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707329_HBSP_P-A Product feature CHAIN JQ707329_HBSP_P-A of FT:mat_peptide JQ707329_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C39). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQNFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707330_HBSP_P-A Product feature CHAIN JQ707330_HBSP_P-A of FT:mat_peptide JQ707330_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707331_HBSP_P-A Product feature CHAIN JQ707331_HBSP_P-A of FT:mat_peptide JQ707331_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707332_HBSP_P-A Product feature CHAIN JQ707332_HBSP_P-A of FT:mat_peptide JQ707332_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707333_HBSP_P-A Product feature CHAIN JQ707333_HBSP_P-A of FT:mat_peptide JQ707333_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707334_HBSP_P-A Product feature CHAIN JQ707334_HBSP_P-A of FT:mat_peptide JQ707334_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C43). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707336_HBSP_P-A Product feature CHAIN JQ707336_HBSP_P-A of FT:mat_peptide JQ707336_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707337_HBSP_P-A Product feature CHAIN JQ707337_HBSP_P-A of FT:mat_peptide JQ707337_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707338_HBSP_P-A Product feature CHAIN JQ707338_HBSP_P-A of FT:mat_peptide JQ707338_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707339_HBSP_P-A Product feature CHAIN JQ707339_HBSP_P-A of FT:mat_peptide JQ707339_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707341_HBSP_P-A Product feature CHAIN JQ707341_HBSP_P-A of FT:mat_peptide JQ707341_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707342_HBSP_P-A Product feature CHAIN JQ707342_HBSP_P-A of FT:mat_peptide JQ707342_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707343_HBSP_P-A Product feature CHAIN JQ707343_HBSP_P-A of FT:mat_peptide JQ707343_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707344_HBSP_P-A Product feature CHAIN JQ707344_HBSP_P-A of FT:mat_peptide JQ707344_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHCLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707345_HBSP_P-A Product feature CHAIN JQ707345_HBSP_P-A of FT:mat_peptide JQ707345_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707346_HBSP_P-A Product feature CHAIN JQ707346_HBSP_P-A of FT:mat_peptide JQ707346_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707347_HBSP_P-A Product feature CHAIN JQ707347_HBSP_P-A of FT:mat_peptide JQ707347_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707348_HBSP_P-A Product feature CHAIN JQ707348_HBSP_P-A of FT:mat_peptide JQ707348_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707349_HBSP_P-A Product feature CHAIN JQ707349_HBSP_P-A of FT:mat_peptide JQ707349_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707350_HBSP_P-A Product feature CHAIN JQ707350_HBSP_P-A of FT:mat_peptide JQ707350_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707351_HBSP_P-A Product feature CHAIN JQ707351_HBSP_P-A of FT:mat_peptide JQ707351_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707352_HBSP_P-A Product feature CHAIN JQ707352_HBSP_P-A of FT:mat_peptide JQ707352_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707353_HBSP_P-A Product feature CHAIN JQ707353_HBSP_P-A of FT:mat_peptide JQ707353_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707354_HBSP_P-A Product feature CHAIN JQ707354_HBSP_P-A of FT:mat_peptide JQ707354_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707355_HBSP_P-A Product feature CHAIN JQ707355_HBSP_P-A of FT:mat_peptide JQ707355_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707356_HBSP_P-A Product feature CHAIN JQ707356_HBSP_P-A of FT:mat_peptide JQ707356_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707357_HBSP_P-A Product feature CHAIN JQ707357_HBSP_P-A of FT:mat_peptide JQ707357_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707358_HBSP_P-A Product feature CHAIN JQ707358_HBSP_P-A of FT:mat_peptide JQ707358_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707359_HBSP_P-A Product feature CHAIN JQ707359_HBSP_P-A of FT:mat_peptide JQ707359_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707360_HBSP_P-A Product feature CHAIN JQ707360_HBSP_P-A of FT:mat_peptide JQ707360_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707361_HBSP_P-A Product feature CHAIN JQ707361_HBSP_P-A of FT:mat_peptide JQ707361_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707362_HBSP_P-A Product feature CHAIN JQ707362_HBSP_P-A of FT:mat_peptide JQ707362_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707363_HBSP_P-A Product feature CHAIN JQ707363_HBSP_P-A of FT:mat_peptide JQ707363_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707364_HBSP_P-A Product feature CHAIN JQ707364_HBSP_P-A of FT:mat_peptide JQ707364_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707365_HBSP_P-A Product feature CHAIN JQ707365_HBSP_P-A of FT:mat_peptide JQ707365_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707366_HBSP_P-A Product feature CHAIN JQ707366_HBSP_P-A of FT:mat_peptide JQ707366_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707367_HBSP_P-A Product feature CHAIN JQ707367_HBSP_P-A of FT:mat_peptide JQ707367_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707368_HBSP_P-A Product feature CHAIN JQ707368_HBSP_P-A of FT:mat_peptide JQ707368_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707369_HBSP_P-A Product feature CHAIN JQ707369_HBSP_P-A of FT:mat_peptide JQ707369_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707370_HBSP_P-A Product feature CHAIN JQ707370_HBSP_P-A of FT:mat_peptide JQ707370_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707371_HBSP_P-A Product feature CHAIN JQ707371_HBSP_P-A of FT:mat_peptide JQ707371_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707372_HBSP_P-A Product feature CHAIN JQ707372_HBSP_P-A of FT:mat_peptide JQ707372_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707373_HBSP_P-A Product feature CHAIN JQ707373_HBSP_P-A of FT:mat_peptide JQ707373_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707374_HBSP_P-A Product feature CHAIN JQ707374_HBSP_P-A of FT:mat_peptide JQ707374_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707375_HBSP_P-A Product feature CHAIN JQ707375_HBSP_P-A of FT:mat_peptide JQ707375_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707376_HBSP_P-A Product feature CHAIN JQ707376_HBSP_P-A of FT:mat_peptide JQ707376_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707377_HBSP_P-A Product feature CHAIN JQ707377_HBSP_P-A of FT:mat_peptide JQ707377_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707378_HBSP_P-A Product feature CHAIN JQ707378_HBSP_P-A of FT:mat_peptide JQ707378_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707379_HBSP_P-A Product feature CHAIN JQ707379_HBSP_P-A of FT:mat_peptide JQ707379_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707380_HBSP_P-A Product feature CHAIN JQ707380_HBSP_P-A of FT:mat_peptide JQ707380_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707381_HBSP_P-A Product feature CHAIN JQ707381_HBSP_P-A of FT:mat_peptide JQ707381_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707382_HBSP_P-A Product feature CHAIN JQ707382_HBSP_P-A of FT:mat_peptide JQ707382_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707383_HBSP_P-A Product feature CHAIN JQ707383_HBSP_P-A of FT:mat_peptide JQ707383_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707384_HBSP_P-A Product feature CHAIN JQ707384_HBSP_P-A of FT:mat_peptide JQ707384_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C32). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707385_HBSP_P-A Product feature CHAIN JQ707385_HBSP_P-A of FT:mat_peptide JQ707385_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707386_HBSP_P-A Product feature CHAIN JQ707386_HBSP_P-A of FT:mat_peptide JQ707386_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707387_HBSP_P-A Product feature CHAIN JQ707387_HBSP_P-A of FT:mat_peptide JQ707387_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707388_HBSP_P-A Product feature CHAIN JQ707388_HBSP_P-A of FT:mat_peptide JQ707388_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707389_HBSP_P-A Product feature CHAIN JQ707389_HBSP_P-A of FT:mat_peptide JQ707389_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707390_HBSP_P-A Product feature CHAIN JQ707390_HBSP_P-A of FT:mat_peptide JQ707390_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707391_HBSP_P-A Product feature CHAIN JQ707391_HBSP_P-A of FT:mat_peptide JQ707391_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707392_HBSP_P-A Product feature CHAIN JQ707392_HBSP_P-A of FT:mat_peptide JQ707392_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707393_HBSP_P-A Product feature CHAIN JQ707393_HBSP_P-A of FT:mat_peptide JQ707393_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707394_HBSP_P-A Product feature CHAIN JQ707394_HBSP_P-A of FT:mat_peptide JQ707394_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707395_HBSP_P-A Product feature CHAIN JQ707395_HBSP_P-A of FT:mat_peptide JQ707395_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTAAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHPPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707396_HBSP_P-A Product feature CHAIN JQ707396_HBSP_P-A of FT:mat_peptide JQ707396_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707397_HBSP_P-A Product feature CHAIN JQ707397_HBSP_P-A of FT:mat_peptide JQ707397_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707398_HBSP_P-A Product feature CHAIN JQ707398_HBSP_P-A of FT:mat_peptide JQ707398_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKHARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707399_HBSP_P-A Product feature CHAIN JQ707399_HBSP_P-A of FT:mat_peptide JQ707399_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707400_HBSP_P-A Product feature CHAIN JQ707400_HBSP_P-A of FT:mat_peptide JQ707400_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707401_HBSP_P-A Product feature CHAIN JQ707401_HBSP_P-A of FT:mat_peptide JQ707401_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPIFPSHRLGLSQNTYGSEPQSVSHGSVY
>gnl|hbvpro|JQ707402_HBSP_P-A Product feature CHAIN JQ707402_HBSP_P-A of FT:mat_peptide JQ707402_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707403_HBSP_P-A Product feature CHAIN JQ707403_HBSP_P-A of FT:mat_peptide JQ707403_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707404_HBSP_P-A Product feature CHAIN JQ707404_HBSP_P-A of FT:mat_peptide JQ707404_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707405_HBSP_P-A Product feature CHAIN JQ707405_HBSP_P-A of FT:mat_peptide JQ707405_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707406_HBSP_P-A Product feature CHAIN JQ707406_HBSP_P-A of FT:mat_peptide JQ707406_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707407_HBSP_P-A Product feature CHAIN JQ707407_HBSP_P-A of FT:mat_peptide JQ707407_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707408_HBSP_P-A Product feature CHAIN JQ707408_HBSP_P-A of FT:mat_peptide JQ707408_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707409_HBSP_P-A Product feature CHAIN JQ707409_HBSP_P-A of FT:mat_peptide JQ707409_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707410_HBSP_P-A Product feature CHAIN JQ707410_HBSP_P-A of FT:mat_peptide JQ707410_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707411_HBSP_P-A Product feature CHAIN JQ707411_HBSP_P-A of FT:mat_peptide JQ707411_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707412_HBSP_P-A Product feature CHAIN JQ707412_HBSP_P-A of FT:mat_peptide JQ707412_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707413_HBSP_P-A Product feature CHAIN JQ707413_HBSP_P-A of FT:mat_peptide JQ707413_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707414_HBSP_P-A Product feature CHAIN JQ707414_HBSP_P-A of FT:mat_peptide JQ707414_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707415_HBSP_P-A Product feature CHAIN JQ707415_HBSP_P-A of FT:mat_peptide JQ707415_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707416_HBSP_P-A Product feature CHAIN JQ707416_HBSP_P-A of FT:mat_peptide JQ707416_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707417_HBSP_P-A Product feature CHAIN JQ707417_HBSP_P-A of FT:mat_peptide JQ707417_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707418_HBSP_P-A Product feature CHAIN JQ707418_HBSP_P-A of FT:mat_peptide JQ707418_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707419_HBSP_P-A Product feature CHAIN JQ707419_HBSP_P-A of FT:mat_peptide JQ707419_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707420_HBSP_P-A Product feature CHAIN JQ707420_HBSP_P-A of FT:mat_peptide JQ707420_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707531_HBSP_P-A Product feature CHAIN JQ707531_HBSP_P-A of FT:mat_peptide JQ707531_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707532_HBSP_P-A Product feature CHAIN JQ707532_HBSP_P-A of FT:mat_peptide JQ707532_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQKQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707533_HBSP_P-A Product feature CHAIN JQ707533_HBSP_P-A of FT:mat_peptide JQ707533_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707534_HBSP_P-A Product feature CHAIN JQ707534_HBSP_P-A of FT:mat_peptide JQ707534_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707535_HBSP_P-A Product feature CHAIN JQ707535_HBSP_P-A of FT:mat_peptide JQ707535_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707536_HBSP_P-A Product feature CHAIN JQ707536_HBSP_P-A of FT:mat_peptide JQ707536_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQKQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707537_HBSP_P-A Product feature CHAIN JQ707537_HBSP_P-A of FT:mat_peptide JQ707537_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707538_HBSP_P-A Product feature CHAIN JQ707538_HBSP_P-A of FT:mat_peptide JQ707538_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707539_HBSP_P-A Product feature CHAIN JQ707539_HBSP_P-A of FT:mat_peptide JQ707539_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707540_HBSP_P-A Product feature CHAIN JQ707540_HBSP_P-A of FT:mat_peptide JQ707540_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707541_HBSP_P-A Product feature CHAIN JQ707541_HBSP_P-A of FT:mat_peptide JQ707541_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707542_HBSP_P-A Product feature CHAIN JQ707542_HBSP_P-A of FT:mat_peptide JQ707542_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707543_HBSP_P-A Product feature CHAIN JQ707543_HBSP_P-A of FT:mat_peptide JQ707543_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707544_HBSP_P-A Product feature CHAIN JQ707544_HBSP_P-A of FT:mat_peptide JQ707544_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707545_HBSP_P-A Product feature CHAIN JQ707545_HBSP_P-A of FT:mat_peptide JQ707545_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707546_HBSP_P-A Product feature CHAIN JQ707546_HBSP_P-A of FT:mat_peptide JQ707546_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707547_HBSP_P-A Product feature CHAIN JQ707547_HBSP_P-A of FT:mat_peptide JQ707547_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707548_HBSP_P-A Product feature CHAIN JQ707548_HBSP_P-A of FT:mat_peptide JQ707548_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707549_HBSP_P-A Product feature CHAIN JQ707549_HBSP_P-A of FT:mat_peptide JQ707549_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707550_HBSP_P-A Product feature CHAIN JQ707550_HBSP_P-A of FT:mat_peptide JQ707550_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGIEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707551_HBSP_P-A Product feature CHAIN JQ707551_HBSP_P-A of FT:mat_peptide JQ707551_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707552_HBSP_P-A Product feature CHAIN JQ707552_HBSP_P-A of FT:mat_peptide JQ707552_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707553_HBSP_P-A Product feature CHAIN JQ707553_HBSP_P-A of FT:mat_peptide JQ707553_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707554_HBSP_P-A Product feature CHAIN JQ707554_HBSP_P-A of FT:mat_peptide JQ707554_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707555_HBSP_P-A Product feature CHAIN JQ707555_HBSP_P-A of FT:mat_peptide JQ707555_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707556_HBSP_P-A Product feature CHAIN JQ707556_HBSP_P-A of FT:mat_peptide JQ707556_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707557_HBSP_P-A Product feature CHAIN JQ707557_HBSP_P-A of FT:mat_peptide JQ707557_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707558_HBSP_P-A Product feature CHAIN JQ707558_HBSP_P-A of FT:mat_peptide JQ707558_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707559_HBSP_P-A Product feature CHAIN JQ707559_HBSP_P-A of FT:mat_peptide JQ707559_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707560_HBSP_P-A Product feature CHAIN JQ707560_HBSP_P-A of FT:mat_peptide JQ707560_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707561_HBSP_P-A Product feature CHAIN JQ707561_HBSP_P-A of FT:mat_peptide JQ707561_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707562_HBSP_P-A Product feature CHAIN JQ707562_HBSP_P-A of FT:mat_peptide JQ707562_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707563_HBSP_P-A Product feature CHAIN JQ707563_HBSP_P-A of FT:mat_peptide JQ707563_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707564_HBSP_P-A Product feature CHAIN JQ707564_HBSP_P-A of FT:mat_peptide JQ707564_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707565_HBSP_P-A Product feature CHAIN JQ707565_HBSP_P-A of FT:mat_peptide JQ707565_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707566_HBSP_P-A Product feature CHAIN JQ707566_HBSP_P-A of FT:mat_peptide JQ707566_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707567_HBSP_P-A Product feature CHAIN JQ707567_HBSP_P-A of FT:mat_peptide JQ707567_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707568_HBSP_P-A Product feature CHAIN JQ707568_HBSP_P-A of FT:mat_peptide JQ707568_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707569_HBSP_P-A Product feature CHAIN JQ707569_HBSP_P-A of FT:mat_peptide JQ707569_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707570_HBSP_P-A Product feature CHAIN JQ707570_HBSP_P-A of FT:mat_peptide JQ707570_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707571_HBSP_P-A Product feature CHAIN JQ707571_HBSP_P-A of FT:mat_peptide JQ707571_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C7). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707572_HBSP_P-A Product feature CHAIN JQ707572_HBSP_P-A of FT:mat_peptide JQ707572_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707573_HBSP_P-A Product feature CHAIN JQ707573_HBSP_P-A of FT:mat_peptide JQ707573_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707574_HBSP_P-A Product feature CHAIN JQ707574_HBSP_P-A of FT:mat_peptide JQ707574_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707575_HBSP_P-A Product feature CHAIN JQ707575_HBSP_P-A of FT:mat_peptide JQ707575_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707576_HBSP_P-A Product feature CHAIN JQ707576_HBSP_P-A of FT:mat_peptide JQ707576_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707577_HBSP_P-A Product feature CHAIN JQ707577_HBSP_P-A of FT:mat_peptide JQ707577_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707578_HBSP_P-A Product feature CHAIN JQ707578_HBSP_P-A of FT:mat_peptide JQ707578_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707579_HBSP_P-A Product feature CHAIN JQ707579_HBSP_P-A of FT:mat_peptide JQ707579_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707580_HBSP_P-A Product feature CHAIN JQ707580_HBSP_P-A of FT:mat_peptide JQ707580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707581_HBSP_P-A Product feature CHAIN JQ707581_HBSP_P-A of FT:mat_peptide JQ707581_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHHPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707582_HBSP_P-A Product feature CHAIN JQ707582_HBSP_P-A of FT:mat_peptide JQ707582_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C2). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707583_HBSP_P-A Product feature CHAIN JQ707583_HBSP_P-A of FT:mat_peptide JQ707583_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707584_HBSP_P-A Product feature CHAIN JQ707584_HBSP_P-A of FT:mat_peptide JQ707584_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C22). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707585_HBSP_P-A Product feature CHAIN JQ707585_HBSP_P-A of FT:mat_peptide JQ707585_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707586_HBSP_P-A Product feature CHAIN JQ707586_HBSP_P-A of FT:mat_peptide JQ707586_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707587_HBSP_P-A Product feature CHAIN JQ707587_HBSP_P-A of FT:mat_peptide JQ707587_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707588_HBSP_P-A Product feature CHAIN JQ707588_HBSP_P-A of FT:mat_peptide JQ707588_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C26). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707589_HBSP_P-A Product feature CHAIN JQ707589_HBSP_P-A of FT:mat_peptide JQ707589_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707590_HBSP_P-A Product feature CHAIN JQ707590_HBSP_P-A of FT:mat_peptide JQ707590_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707591_HBSP_P-A Product feature CHAIN JQ707591_HBSP_P-A of FT:mat_peptide JQ707591_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C29). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707592_HBSP_P-A Product feature CHAIN JQ707592_HBSP_P-A of FT:mat_peptide JQ707592_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707593_HBSP_P-A Product feature CHAIN JQ707593_HBSP_P-A of FT:mat_peptide JQ707593_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707594_HBSP_P-A Product feature CHAIN JQ707594_HBSP_P-A of FT:mat_peptide JQ707594_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707595_HBSP_P-A Product feature CHAIN JQ707595_HBSP_P-A of FT:mat_peptide JQ707595_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707596_HBSP_P-A Product feature CHAIN JQ707596_HBSP_P-A of FT:mat_peptide JQ707596_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707597_HBSP_P-A Product feature CHAIN JQ707597_HBSP_P-A of FT:mat_peptide JQ707597_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707598_HBSP_P-A Product feature CHAIN JQ707598_HBSP_P-A of FT:mat_peptide JQ707598_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707599_HBSP_P-A Product feature CHAIN JQ707599_HBSP_P-A of FT:mat_peptide JQ707599_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGAGPQSVSHGSVY
>gnl|hbvpro|JQ707600_HBSP_P-A Product feature CHAIN JQ707600_HBSP_P-A of FT:mat_peptide JQ707600_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C40). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707601_HBSP_P-A Product feature CHAIN JQ707601_HBSP_P-A of FT:mat_peptide JQ707601_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707602_HBSP_P-A Product feature CHAIN JQ707602_HBSP_P-A of FT:mat_peptide JQ707602_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C42). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707603_HBSP_P-A Product feature CHAIN JQ707603_HBSP_P-A of FT:mat_peptide JQ707603_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707604_HBSP_P-A Product feature CHAIN JQ707604_HBSP_P-A of FT:mat_peptide JQ707604_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707605_HBSP_P-A Product feature CHAIN JQ707605_HBSP_P-A of FT:mat_peptide JQ707605_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707606_HBSP_P-A Product feature CHAIN JQ707606_HBSP_P-A of FT:mat_peptide JQ707606_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707607_HBSP_P-A Product feature CHAIN JQ707607_HBSP_P-A of FT:mat_peptide JQ707607_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707608_HBSP_P-A Product feature CHAIN JQ707608_HBSP_P-A of FT:mat_peptide JQ707608_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707609_HBSP_P-A Product feature CHAIN JQ707609_HBSP_P-A of FT:mat_peptide JQ707609_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707610_HBSP_P-A Product feature CHAIN JQ707610_HBSP_P-A of FT:mat_peptide JQ707610_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707611_HBSP_P-A Product feature CHAIN JQ707611_HBSP_P-A of FT:mat_peptide JQ707611_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707612_HBSP_P-A Product feature CHAIN JQ707612_HBSP_P-A of FT:mat_peptide JQ707612_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707613_HBSP_P-A Product feature CHAIN JQ707613_HBSP_P-A of FT:mat_peptide JQ707613_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707614_HBSP_P-A Product feature CHAIN JQ707614_HBSP_P-A of FT:mat_peptide JQ707614_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707615_HBSP_P-A Product feature CHAIN JQ707615_HBSP_P-A of FT:mat_peptide JQ707615_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707616_HBSP_P-A Product feature CHAIN JQ707616_HBSP_P-A of FT:mat_peptide JQ707616_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707617_HBSP_P-A Product feature CHAIN JQ707617_HBSP_P-A of FT:mat_peptide JQ707617_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707618_HBSP_P-A Product feature CHAIN JQ707618_HBSP_P-A of FT:mat_peptide JQ707618_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707619_HBSP_P-A Product feature CHAIN JQ707619_HBSP_P-A of FT:mat_peptide JQ707619_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707620_HBSP_P-A Product feature CHAIN JQ707620_HBSP_P-A of FT:mat_peptide JQ707620_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707621_HBSP_P-A Product feature CHAIN JQ707621_HBSP_P-A of FT:mat_peptide JQ707621_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707622_HBSP_P-A Product feature CHAIN JQ707622_HBSP_P-A of FT:mat_peptide JQ707622_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707623_HBSP_P-A Product feature CHAIN JQ707623_HBSP_P-A of FT:mat_peptide JQ707623_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707624_HBSP_P-A Product feature CHAIN JQ707624_HBSP_P-A of FT:mat_peptide JQ707624_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707625_HBSP_P-A Product feature CHAIN JQ707625_HBSP_P-A of FT:mat_peptide JQ707625_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707626_HBSP_P-A Product feature CHAIN JQ707626_HBSP_P-A of FT:mat_peptide JQ707626_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707627_HBSP_P-A Product feature CHAIN JQ707627_HBSP_P-A of FT:mat_peptide JQ707627_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707628_HBSP_P-A Product feature CHAIN JQ707628_HBSP_P-A of FT:mat_peptide JQ707628_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707629_HBSP_P-A Product feature CHAIN JQ707629_HBSP_P-A of FT:mat_peptide JQ707629_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707630_HBSP_P-A Product feature CHAIN JQ707630_HBSP_P-A of FT:mat_peptide JQ707630_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707631_HBSP_P-A Product feature CHAIN JQ707631_HBSP_P-A of FT:mat_peptide JQ707631_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707632_HBSP_P-A Product feature CHAIN JQ707632_HBSP_P-A of FT:mat_peptide JQ707632_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707633_HBSP_P-A Product feature CHAIN JQ707633_HBSP_P-A of FT:mat_peptide JQ707633_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707634_HBSP_P-A Product feature CHAIN JQ707634_HBSP_P-A of FT:mat_peptide JQ707634_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707635_HBSP_P-A Product feature CHAIN JQ707635_HBSP_P-A of FT:mat_peptide JQ707635_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRHADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEMAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707636_HBSP_P-A Product feature CHAIN JQ707636_HBSP_P-A of FT:mat_peptide JQ707636_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707637_HBSP_P-A Product feature CHAIN JQ707637_HBSP_P-A of FT:mat_peptide JQ707637_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707638_HBSP_P-A Product feature CHAIN JQ707638_HBSP_P-A of FT:mat_peptide JQ707638_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707639_HBSP_P-A Product feature CHAIN JQ707639_HBSP_P-A of FT:mat_peptide JQ707639_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707640_HBSP_P-A Product feature CHAIN JQ707640_HBSP_P-A of FT:mat_peptide JQ707640_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707641_HBSP_P-A Product feature CHAIN JQ707641_HBSP_P-A of FT:mat_peptide JQ707641_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707642_HBSP_P-A Product feature CHAIN JQ707642_HBSP_P-A of FT:mat_peptide JQ707642_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707643_HBSP_P-A Product feature CHAIN JQ707643_HBSP_P-A of FT:mat_peptide JQ707643_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707644_HBSP_P-A Product feature CHAIN JQ707644_HBSP_P-A of FT:mat_peptide JQ707644_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707645_HBSP_P-A Product feature CHAIN JQ707645_HBSP_P-A of FT:mat_peptide JQ707645_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707646_HBSP_P-A Product feature CHAIN JQ707646_HBSP_P-A of FT:mat_peptide JQ707646_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707647_HBSP_P-A Product feature CHAIN JQ707647_HBSP_P-A of FT:mat_peptide JQ707647_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707648_HBSP_P-A Product feature CHAIN JQ707648_HBSP_P-A of FT:mat_peptide JQ707648_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707649_HBSP_P-A Product feature CHAIN JQ707649_HBSP_P-A of FT:mat_peptide JQ707649_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707650_HBSP_P-A Product feature CHAIN JQ707650_HBSP_P-A of FT:mat_peptide JQ707650_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707651_HBSP_P-A Product feature CHAIN JQ707651_HBSP_P-A of FT:mat_peptide JQ707651_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707652_HBSP_P-A Product feature CHAIN JQ707652_HBSP_P-A of FT:mat_peptide JQ707652_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707653_HBSP_P-A Product feature CHAIN JQ707653_HBSP_P-A of FT:mat_peptide JQ707653_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707654_HBSP_P-A Product feature CHAIN JQ707654_HBSP_P-A of FT:mat_peptide JQ707654_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707655_HBSP_P-A Product feature CHAIN JQ707655_HBSP_P-A of FT:mat_peptide JQ707655_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707656_HBSP_P-A Product feature CHAIN JQ707656_HBSP_P-A of FT:mat_peptide JQ707656_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707658_HBSP_P-A Product feature CHAIN JQ707658_HBSP_P-A of FT:mat_peptide JQ707658_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707659_HBSP_P-A Product feature CHAIN JQ707659_HBSP_P-A of FT:mat_peptide JQ707659_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707661_HBSP_P-A Product feature CHAIN JQ707661_HBSP_P-A of FT:mat_peptide JQ707661_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707662_HBSP_P-A Product feature CHAIN JQ707662_HBSP_P-A of FT:mat_peptide JQ707662_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707663_HBSP_P-A Product feature CHAIN JQ707663_HBSP_P-A of FT:mat_peptide JQ707663_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707664_HBSP_P-A Product feature CHAIN JQ707664_HBSP_P-A of FT:mat_peptide JQ707664_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707665_HBSP_P-A Product feature CHAIN JQ707665_HBSP_P-A of FT:mat_peptide JQ707665_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707667_HBSP_P-A Product feature CHAIN JQ707667_HBSP_P-A of FT:mat_peptide JQ707667_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707669_HBSP_P-A Product feature CHAIN JQ707669_HBSP_P-A of FT:mat_peptide JQ707669_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707670_HBSP_P-A Product feature CHAIN JQ707670_HBSP_P-A of FT:mat_peptide JQ707670_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707672_HBSP_P-A Product feature CHAIN JQ707672_HBSP_P-A of FT:mat_peptide JQ707672_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707674_HBSP_P-A Product feature CHAIN JQ707674_HBSP_P-A of FT:mat_peptide JQ707674_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGNGPQSVSHGSVY
>gnl|hbvpro|JQ707675_HBSP_P-A Product feature CHAIN JQ707675_HBSP_P-A of FT:mat_peptide JQ707675_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707676_HBSP_P-A Product feature CHAIN JQ707676_HBSP_P-A of FT:mat_peptide JQ707676_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707681_HBSP_P-A Product feature CHAIN JQ707681_HBSP_P-A of FT:mat_peptide JQ707681_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JX096952_HBSP_P-A Product feature CHAIN JX096952_HBSP_P-A of FT:mat_peptide JX096952_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGNGPQSVSLGSVY
>gnl|hbvpro|JX096953_HBSP_P-A Product feature CHAIN JX096953_HBSP_P-A of FT:mat_peptide JX096953_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX154579_HBSP_P-A Product feature CHAIN JX154579_HBSP_P-A of FT:mat_peptide JX154579_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX154580_HBSP_P-A Product feature CHAIN JX154580_HBSP_P-A of FT:mat_peptide JX154580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX154581_HBSP_P-A Product feature CHAIN JX154581_HBSP_P-A of FT:mat_peptide JX154581_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX154582_HBSP_P-A Product feature CHAIN JX154582_HBSP_P-A of FT:mat_peptide JX154582_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310721_HBSP_P-A Product feature CHAIN JX310721_HBSP_P-A of FT:mat_peptide JX310721_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310722_HBSP_P-A Product feature CHAIN JX310722_HBSP_P-A of FT:mat_peptide JX310722_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310723_HBSP_P-A Product feature CHAIN JX310723_HBSP_P-A of FT:mat_peptide JX310723_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310724_HBSP_P-A Product feature CHAIN JX310724_HBSP_P-A of FT:mat_peptide JX310724_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310725_HBSP_P-A Product feature CHAIN JX310725_HBSP_P-A of FT:mat_peptide JX310725_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875251_HBSP_P-A Product feature CHAIN KC875251_HBSP_P-A of FT:mat_peptide KC875251_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875252_HBSP_P-A Product feature CHAIN KC875252_HBSP_P-A of FT:mat_peptide KC875252_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875253_HBSP_P-A Product feature CHAIN KC875253_HBSP_P-A of FT:mat_peptide KC875253_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875254_HBSP_P-A Product feature CHAIN KC875254_HBSP_P-A of FT:mat_peptide KC875254_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV12). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875255_HBSP_P-A Product feature CHAIN KC875255_HBSP_P-A of FT:mat_peptide KC875255_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875256_HBSP_P-A Product feature CHAIN KC875256_HBSP_P-A of FT:mat_peptide KC875256_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875259_HBSP_P-A Product feature CHAIN KC875259_HBSP_P-A of FT:mat_peptide KC875259_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLVLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875260_HBSP_P-A Product feature CHAIN KC875260_HBSP_P-A of FT:mat_peptide KC875260_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214657_HBSP_P-A Product feature CHAIN KF214657_HBSP_P-A of FT:mat_peptide KF214657_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214658_HBSP_P-A Product feature CHAIN KF214658_HBSP_P-A of FT:mat_peptide KF214658_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214659_HBSP_P-A Product feature CHAIN KF214659_HBSP_P-A of FT:mat_peptide KF214659_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKETLCFPPVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214660_HBSP_P-A Product feature CHAIN KF214660_HBSP_P-A of FT:mat_peptide KF214660_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214661_HBSP_P-A Product feature CHAIN KF214661_HBSP_P-A of FT:mat_peptide KF214661_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214662_HBSP_P-A Product feature CHAIN KF214662_HBSP_P-A of FT:mat_peptide KF214662_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKAPLCFPPVAVQNL
RMETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214663_HBSP_P-A Product feature CHAIN KF214663_HBSP_P-A of FT:mat_peptide KF214663_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214665_HBSP_P-A Product feature CHAIN KF214665_HBSP_P-A of FT:mat_peptide KF214665_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214666_HBSP_P-A Product feature CHAIN KF214666_HBSP_P-A of FT:mat_peptide KF214666_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779210_HBSP_P-A Product feature CHAIN KF779210_HBSP_P-A of FT:mat_peptide KF779210_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5547). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRSLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779211_HBSP_P-A Product feature CHAIN KF779211_HBSP_P-A of FT:mat_peptide KF779211_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5691). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779213_HBSP_P-A Product feature CHAIN KF779213_HBSP_P-A of FT:mat_peptide KF779213_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5744). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779215_HBSP_P-A Product feature CHAIN KF779215_HBSP_P-A of FT:mat_peptide KF779215_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5763). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779221_HBSP_P-A Product feature CHAIN KF779221_HBSP_P-A of FT:mat_peptide KF779221_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5934). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADSDRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779227_HBSP_P-A Product feature CHAIN KF779227_HBSP_P-A of FT:mat_peptide KF779227_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779231_HBSP_P-A Product feature CHAIN KF779231_HBSP_P-A of FT:mat_peptide KF779231_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779232_HBSP_P-A Product feature CHAIN KF779232_HBSP_P-A of FT:mat_peptide KF779232_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779234_HBSP_P-A Product feature CHAIN KF779234_HBSP_P-A of FT:mat_peptide KF779234_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779238_HBSP_P-A Product feature CHAIN KF779238_HBSP_P-A of FT:mat_peptide KF779238_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779239_HBSP_P-A Product feature CHAIN KF779239_HBSP_P-A of FT:mat_peptide KF779239_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6120). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779240_HBSP_P-A Product feature CHAIN KF779240_HBSP_P-A of FT:mat_peptide KF779240_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6123). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779243_HBSP_P-A Product feature CHAIN KF779243_HBSP_P-A of FT:mat_peptide KF779243_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779244_HBSP_P-A Product feature CHAIN KF779244_HBSP_P-A of FT:mat_peptide KF779244_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779245_HBSP_P-A Product feature CHAIN KF779245_HBSP_P-A of FT:mat_peptide KF779245_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779246_HBSP_P-A Product feature CHAIN KF779246_HBSP_P-A of FT:mat_peptide KF779246_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6163). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779247_HBSP_P-A Product feature CHAIN KF779247_HBSP_P-A of FT:mat_peptide KF779247_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779248_HBSP_P-A Product feature CHAIN KF779248_HBSP_P-A of FT:mat_peptide KF779248_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779249_HBSP_P-A Product feature CHAIN KF779249_HBSP_P-A of FT:mat_peptide KF779249_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779251_HBSP_P-A Product feature CHAIN KF779251_HBSP_P-A of FT:mat_peptide KF779251_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779252_HBSP_P-A Product feature CHAIN KF779252_HBSP_P-A of FT:mat_peptide KF779252_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779253_HBSP_P-A Product feature CHAIN KF779253_HBSP_P-A of FT:mat_peptide KF779253_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3817). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779254_HBSP_P-A Product feature CHAIN KF779254_HBSP_P-A of FT:mat_peptide KF779254_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3820). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779255_HBSP_P-A Product feature CHAIN KF779255_HBSP_P-A of FT:mat_peptide KF779255_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3825). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779256_HBSP_P-A Product feature CHAIN KF779256_HBSP_P-A of FT:mat_peptide KF779256_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3829). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779257_HBSP_P-A Product feature CHAIN KF779257_HBSP_P-A of FT:mat_peptide KF779257_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3857). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779258_HBSP_P-A Product feature CHAIN KF779258_HBSP_P-A of FT:mat_peptide KF779258_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779259_HBSP_P-A Product feature CHAIN KF779259_HBSP_P-A of FT:mat_peptide KF779259_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3892). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779260_HBSP_P-A Product feature CHAIN KF779260_HBSP_P-A of FT:mat_peptide KF779260_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3894). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779261_HBSP_P-A Product feature CHAIN KF779261_HBSP_P-A of FT:mat_peptide KF779261_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3896). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVPNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779262_HBSP_P-A Product feature CHAIN KF779262_HBSP_P-A of FT:mat_peptide KF779262_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3898). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779263_HBSP_P-A Product feature CHAIN KF779263_HBSP_P-A of FT:mat_peptide KF779263_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3903). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779264_HBSP_P-A Product feature CHAIN KF779264_HBSP_P-A of FT:mat_peptide KF779264_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3945). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARFLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779265_HBSP_P-A Product feature CHAIN KF779265_HBSP_P-A of FT:mat_peptide KF779265_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3946). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAYLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779266_HBSP_P-A Product feature CHAIN KF779266_HBSP_P-A of FT:mat_peptide KF779266_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3949). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779268_HBSP_P-A Product feature CHAIN KF779268_HBSP_P-A of FT:mat_peptide KF779268_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3966). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADASLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779269_HBSP_P-A Product feature CHAIN KF779269_HBSP_P-A of FT:mat_peptide KF779269_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779270_HBSP_P-A Product feature CHAIN KF779270_HBSP_P-A of FT:mat_peptide KF779270_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4219). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779271_HBSP_P-A Product feature CHAIN KF779271_HBSP_P-A of FT:mat_peptide KF779271_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4233). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779272_HBSP_P-A Product feature CHAIN KF779272_HBSP_P-A of FT:mat_peptide KF779272_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFTSHRPGLSQNTYGSGPQSASLGSVY
>gnl|hbvpro|KF779273_HBSP_P-A Product feature CHAIN KF779273_HBSP_P-A of FT:mat_peptide KF779273_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779274_HBSP_P-A Product feature CHAIN KF779274_HBSP_P-A of FT:mat_peptide KF779274_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779275_HBSP_P-A Product feature CHAIN KF779275_HBSP_P-A of FT:mat_peptide KF779275_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779276_HBSP_P-A Product feature CHAIN KF779276_HBSP_P-A of FT:mat_peptide KF779276_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4314). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KF779277_HBSP_P-A Product feature CHAIN KF779277_HBSP_P-A of FT:mat_peptide KF779277_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779279_HBSP_P-A Product feature CHAIN KF779279_HBSP_P-A of FT:mat_peptide KF779279_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779280_HBSP_P-A Product feature CHAIN KF779280_HBSP_P-A of FT:mat_peptide KF779280_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4364). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSASLGSVY
>gnl|hbvpro|KF779281_HBSP_P-A Product feature CHAIN KF779281_HBSP_P-A of FT:mat_peptide KF779281_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4390). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779282_HBSP_P-A Product feature CHAIN KF779282_HBSP_P-A of FT:mat_peptide KF779282_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4392). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779283_HBSP_P-A Product feature CHAIN KF779283_HBSP_P-A of FT:mat_peptide KF779283_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779284_HBSP_P-A Product feature CHAIN KF779284_HBSP_P-A of FT:mat_peptide KF779284_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0574). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAVSHINRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779286_HBSP_P-A Product feature CHAIN KF779286_HBSP_P-A of FT:mat_peptide KF779286_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0606). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779287_HBSP_P-A Product feature CHAIN KF779287_HBSP_P-A of FT:mat_peptide KF779287_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0613). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779290_HBSP_P-A Product feature CHAIN KF779290_HBSP_P-A of FT:mat_peptide KF779290_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779291_HBSP_P-A Product feature CHAIN KF779291_HBSP_P-A of FT:mat_peptide KF779291_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0765). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779293_HBSP_P-A Product feature CHAIN KF779293_HBSP_P-A of FT:mat_peptide KF779293_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVLPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779294_HBSP_P-A Product feature CHAIN KF779294_HBSP_P-A of FT:mat_peptide KF779294_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0796). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779295_HBSP_P-A Product feature CHAIN KF779295_HBSP_P-A of FT:mat_peptide KF779295_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KF779297_HBSP_P-A Product feature CHAIN KF779297_HBSP_P-A of FT:mat_peptide KF779297_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0874). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLYRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779298_HBSP_P-A Product feature CHAIN KF779298_HBSP_P-A of FT:mat_peptide KF779298_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0908). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779299_HBSP_P-A Product feature CHAIN KF779299_HBSP_P-A of FT:mat_peptide KF779299_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0943). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779304_HBSP_P-A Product feature CHAIN KF779304_HBSP_P-A of FT:mat_peptide KF779304_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779305_HBSP_P-A Product feature CHAIN KF779305_HBSP_P-A of FT:mat_peptide KF779305_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1043). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779306_HBSP_P-A Product feature CHAIN KF779306_HBSP_P-A of FT:mat_peptide KF779306_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779307_HBSP_P-A Product feature CHAIN KF779307_HBSP_P-A of FT:mat_peptide KF779307_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779308_HBSP_P-A Product feature CHAIN KF779308_HBSP_P-A of FT:mat_peptide KF779308_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1293). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779309_HBSP_P-A Product feature CHAIN KF779309_HBSP_P-A of FT:mat_peptide KF779309_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1294). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779310_HBSP_P-A Product feature CHAIN KF779310_HBSP_P-A of FT:mat_peptide KF779310_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3845). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779311_HBSP_P-A Product feature CHAIN KF779311_HBSP_P-A of FT:mat_peptide KF779311_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3863). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779312_HBSP_P-A Product feature CHAIN KF779312_HBSP_P-A of FT:mat_peptide KF779312_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3907). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779313_HBSP_P-A Product feature CHAIN KF779313_HBSP_P-A of FT:mat_peptide KF779313_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3958). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779314_HBSP_P-A Product feature CHAIN KF779314_HBSP_P-A of FT:mat_peptide KF779314_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3985). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779315_HBSP_P-A Product feature CHAIN KF779315_HBSP_P-A of FT:mat_peptide KF779315_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779316_HBSP_P-A Product feature CHAIN KF779316_HBSP_P-A of FT:mat_peptide KF779316_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779317_HBSP_P-A Product feature CHAIN KF779317_HBSP_P-A of FT:mat_peptide KF779317_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779319_HBSP_P-A Product feature CHAIN KF779319_HBSP_P-A of FT:mat_peptide KF779319_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779320_HBSP_P-A Product feature CHAIN KF779320_HBSP_P-A of FT:mat_peptide KF779320_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779321_HBSP_P-A Product feature CHAIN KF779321_HBSP_P-A of FT:mat_peptide KF779321_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4362). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779322_HBSP_P-A Product feature CHAIN KF779322_HBSP_P-A of FT:mat_peptide KF779322_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779323_HBSP_P-A Product feature CHAIN KF779323_HBSP_P-A of FT:mat_peptide KF779323_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779324_HBSP_P-A Product feature CHAIN KF779324_HBSP_P-A of FT:mat_peptide KF779324_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4416). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779325_HBSP_P-A Product feature CHAIN KF779325_HBSP_P-A of FT:mat_peptide KF779325_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779326_HBSP_P-A Product feature CHAIN KF779326_HBSP_P-A of FT:mat_peptide KF779326_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4424). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779328_HBSP_P-A Product feature CHAIN KF779328_HBSP_P-A of FT:mat_peptide KF779328_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4532). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779329_HBSP_P-A Product feature CHAIN KF779329_HBSP_P-A of FT:mat_peptide KF779329_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4540). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVPEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779330_HBSP_P-A Product feature CHAIN KF779330_HBSP_P-A of FT:mat_peptide KF779330_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4541). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779331_HBSP_P-A Product feature CHAIN KF779331_HBSP_P-A of FT:mat_peptide KF779331_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4543). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779332_HBSP_P-A Product feature CHAIN KF779332_HBSP_P-A of FT:mat_peptide KF779332_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4549). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSENTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779333_HBSP_P-A Product feature CHAIN KF779333_HBSP_P-A of FT:mat_peptide KF779333_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4661). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779334_HBSP_P-A Product feature CHAIN KF779334_HBSP_P-A of FT:mat_peptide KF779334_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4673). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAAPYRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779335_HBSP_P-A Product feature CHAIN KF779335_HBSP_P-A of FT:mat_peptide KF779335_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4687). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779336_HBSP_P-A Product feature CHAIN KF779336_HBSP_P-A of FT:mat_peptide KF779336_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779337_HBSP_P-A Product feature CHAIN KF779337_HBSP_P-A of FT:mat_peptide KF779337_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4733). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779338_HBSP_P-A Product feature CHAIN KF779338_HBSP_P-A of FT:mat_peptide KF779338_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779339_HBSP_P-A Product feature CHAIN KF779339_HBSP_P-A of FT:mat_peptide KF779339_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4804). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779342_HBSP_P-A Product feature CHAIN KF779342_HBSP_P-A of FT:mat_peptide KF779342_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4865). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779344_HBSP_P-A Product feature CHAIN KF779344_HBSP_P-A of FT:mat_peptide KF779344_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4928). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779345_HBSP_P-A Product feature CHAIN KF779345_HBSP_P-A of FT:mat_peptide KF779345_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4936). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779346_HBSP_P-A Product feature CHAIN KF779346_HBSP_P-A of FT:mat_peptide KF779346_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4938). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779347_HBSP_P-A Product feature CHAIN KF779347_HBSP_P-A of FT:mat_peptide KF779347_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4950). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779348_HBSP_P-A Product feature CHAIN KF779348_HBSP_P-A of FT:mat_peptide KF779348_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4951). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779349_HBSP_P-A Product feature CHAIN KF779349_HBSP_P-A of FT:mat_peptide KF779349_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4999). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779350_HBSP_P-A Product feature CHAIN KF779350_HBSP_P-A of FT:mat_peptide KF779350_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779351_HBSP_P-A Product feature CHAIN KF779351_HBSP_P-A of FT:mat_peptide KF779351_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779352_HBSP_P-A Product feature CHAIN KF779352_HBSP_P-A of FT:mat_peptide KF779352_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779354_HBSP_P-A Product feature CHAIN KF779354_HBSP_P-A of FT:mat_peptide KF779354_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779355_HBSP_P-A Product feature CHAIN KF779355_HBSP_P-A of FT:mat_peptide KF779355_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779356_HBSP_P-A Product feature CHAIN KF779356_HBSP_P-A of FT:mat_peptide KF779356_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5185). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779358_HBSP_P-A Product feature CHAIN KF779358_HBSP_P-A of FT:mat_peptide KF779358_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5263). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779359_HBSP_P-A Product feature CHAIN KF779359_HBSP_P-A of FT:mat_peptide KF779359_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5268). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779360_HBSP_P-A Product feature CHAIN KF779360_HBSP_P-A of FT:mat_peptide KF779360_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5279). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MLLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779361_HBSP_P-A Product feature CHAIN KF779361_HBSP_P-A of FT:mat_peptide KF779361_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779362_HBSP_P-A Product feature CHAIN KF779362_HBSP_P-A of FT:mat_peptide KF779362_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779363_HBSP_P-A Product feature CHAIN KF779363_HBSP_P-A of FT:mat_peptide KF779363_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779364_HBSP_P-A Product feature CHAIN KF779364_HBSP_P-A of FT:mat_peptide KF779364_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5374). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779365_HBSP_P-A Product feature CHAIN KF779365_HBSP_P-A of FT:mat_peptide KF779365_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5380). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KF779366_HBSP_P-A Product feature CHAIN KF779366_HBSP_P-A of FT:mat_peptide KF779366_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5383). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779367_HBSP_P-A Product feature CHAIN KF779367_HBSP_P-A of FT:mat_peptide KF779367_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5403). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779368_HBSP_P-A Product feature CHAIN KF779368_HBSP_P-A of FT:mat_peptide KF779368_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5421). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779369_HBSP_P-A Product feature CHAIN KF779369_HBSP_P-A of FT:mat_peptide KF779369_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5521). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779370_HBSP_P-A Product feature CHAIN KF779370_HBSP_P-A of FT:mat_peptide KF779370_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5594). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779371_HBSP_P-A Product feature CHAIN KF779371_HBSP_P-A of FT:mat_peptide KF779371_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5608). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779372_HBSP_P-A Product feature CHAIN KF779372_HBSP_P-A of FT:mat_peptide KF779372_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5654). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779373_HBSP_P-A Product feature CHAIN KF779373_HBSP_P-A of FT:mat_peptide KF779373_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5680). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779374_HBSP_P-A Product feature CHAIN KF779374_HBSP_P-A of FT:mat_peptide KF779374_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5743). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779375_HBSP_P-A Product feature CHAIN KF779375_HBSP_P-A of FT:mat_peptide KF779375_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5760). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779378_HBSP_P-A Product feature CHAIN KF779378_HBSP_P-A of FT:mat_peptide KF779378_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6064). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779379_HBSP_P-A Product feature CHAIN KF779379_HBSP_P-A of FT:mat_peptide KF779379_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779381_HBSP_P-A Product feature CHAIN KF779381_HBSP_P-A of FT:mat_peptide KF779381_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6268). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779383_HBSP_P-A Product feature CHAIN KF779383_HBSP_P-A of FT:mat_peptide KF779383_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779384_HBSP_P-A Product feature CHAIN KF779384_HBSP_P-A of FT:mat_peptide KF779384_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KF779385_HBSP_P-A Product feature CHAIN KF779385_HBSP_P-A of FT:mat_peptide KF779385_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779386_HBSP_P-A Product feature CHAIN KF779386_HBSP_P-A of FT:mat_peptide KF779386_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0138). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922406_HBSP_P-A Product feature CHAIN KF922406_HBSP_P-A of FT:mat_peptide KF922406_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922407_HBSP_P-A Product feature CHAIN KF922407_HBSP_P-A of FT:mat_peptide KF922407_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922408_HBSP_P-A Product feature CHAIN KF922408_HBSP_P-A of FT:mat_peptide KF922408_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922409_HBSP_P-A Product feature CHAIN KF922409_HBSP_P-A of FT:mat_peptide KF922409_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922414_HBSP_P-A Product feature CHAIN KF922414_HBSP_P-A of FT:mat_peptide KF922414_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAETGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922415_HBSP_P-A Product feature CHAIN KF922415_HBSP_P-A of FT:mat_peptide KF922415_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922416_HBSP_P-A Product feature CHAIN KF922416_HBSP_P-A of FT:mat_peptide KF922416_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922417_HBSP_P-A Product feature CHAIN KF922417_HBSP_P-A of FT:mat_peptide KF922417_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v4). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922418_HBSP_P-A Product feature CHAIN KF922418_HBSP_P-A of FT:mat_peptide KF922418_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922419_HBSP_P-A Product feature CHAIN KF922419_HBSP_P-A of FT:mat_peptide KF922419_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922420_HBSP_P-A Product feature CHAIN KF922420_HBSP_P-A of FT:mat_peptide KF922420_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922421_HBSP_P-A Product feature CHAIN KF922421_HBSP_P-A of FT:mat_peptide KF922421_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922424_HBSP_P-A Product feature CHAIN KF922424_HBSP_P-A of FT:mat_peptide KF922424_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922425_HBSP_P-A Product feature CHAIN KF922425_HBSP_P-A of FT:mat_peptide KF922425_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922426_HBSP_P-A Product feature CHAIN KF922426_HBSP_P-A of FT:mat_peptide KF922426_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922427_HBSP_P-A Product feature CHAIN KF922427_HBSP_P-A of FT:mat_peptide KF922427_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922428_HBSP_P-A Product feature CHAIN KF922428_HBSP_P-A of FT:mat_peptide KF922428_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922429_HBSP_P-A Product feature CHAIN KF922429_HBSP_P-A of FT:mat_peptide KF922429_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922430_HBSP_P-A Product feature CHAIN KF922430_HBSP_P-A of FT:mat_peptide KF922430_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922431_HBSP_P-A Product feature CHAIN KF922431_HBSP_P-A of FT:mat_peptide KF922431_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v3). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922433_HBSP_P-A Product feature CHAIN KF922433_HBSP_P-A of FT:mat_peptide KF922433_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQRVRDPAKPARLLLRTTLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922434_HBSP_P-A Product feature CHAIN KF922434_HBSP_P-A of FT:mat_peptide KF922434_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQRVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922435_HBSP_P-A Product feature CHAIN KF922435_HBSP_P-A of FT:mat_peptide KF922435_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922436_HBSP_P-A Product feature CHAIN KF922436_HBSP_P-A of FT:mat_peptide KF922436_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922437_HBSP_P-A Product feature CHAIN KF922437_HBSP_P-A of FT:mat_peptide KF922437_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ010776_HBSP_P-A Product feature CHAIN KJ010776_HBSP_P-A of FT:mat_peptide KJ010776_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ010777_HBSP_P-A Product feature CHAIN KJ010777_HBSP_P-A of FT:mat_peptide KJ010777_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ010778_HBSP_P-A Product feature CHAIN KJ010778_HBSP_P-A of FT:mat_peptide KJ010778_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ194506_HBSP_P-A Product feature CHAIN KJ194506_HBSP_P-A of FT:mat_peptide KJ194506_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV_Amsterdam_1_1994). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ586809_HBSP_P-A Product feature CHAIN KJ586809_HBSP_P-A of FT:mat_peptide KJ586809_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843166_HBSP_P-A Product feature CHAIN KJ843166_HBSP_P-A of FT:mat_peptide KJ843166_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843172_HBSP_P-A Product feature CHAIN KJ843172_HBSP_P-A of FT:mat_peptide KJ843172_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RLEIAPVFPSHRPGLSQNTYGSGSQSVSLGSVY
>gnl|hbvpro|KJ843173_HBSP_P-A Product feature CHAIN KJ843173_HBSP_P-A of FT:mat_peptide KJ843173_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843182_HBSP_P-A Product feature CHAIN KJ843182_HBSP_P-A of FT:mat_peptide KJ843182_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843183_HBSP_P-A Product feature CHAIN KJ843183_HBSP_P-A of FT:mat_peptide KJ843183_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843184_HBSP_P-A Product feature CHAIN KJ843184_HBSP_P-A of FT:mat_peptide KJ843184_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843186_HBSP_P-A Product feature CHAIN KJ843186_HBSP_P-A of FT:mat_peptide KJ843186_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843188_HBSP_P-A Product feature CHAIN KJ843188_HBSP_P-A of FT:mat_peptide KJ843188_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843192_HBSP_P-A Product feature CHAIN KJ843192_HBSP_P-A of FT:mat_peptide KJ843192_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843214_HBSP_P-A Product feature CHAIN KJ843214_HBSP_P-A of FT:mat_peptide KJ843214_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843215_HBSP_P-A Product feature CHAIN KJ843215_HBSP_P-A of FT:mat_peptide KJ843215_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843216_HBSP_P-A Product feature CHAIN KJ843216_HBSP_P-A of FT:mat_peptide KJ843216_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPIRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843217_HBSP_P-A Product feature CHAIN KJ843217_HBSP_P-A of FT:mat_peptide KJ843217_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADGDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843218_HBSP_P-A Product feature CHAIN KJ843218_HBSP_P-A of FT:mat_peptide KJ843218_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854685_HBSP_P-A Product feature CHAIN KJ854685_HBSP_P-A of FT:mat_peptide KJ854685_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854686_HBSP_P-A Product feature CHAIN KJ854686_HBSP_P-A of FT:mat_peptide KJ854686_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854687_HBSP_P-A Product feature CHAIN KJ854687_HBSP_P-A of FT:mat_peptide KJ854687_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854688_HBSP_P-A Product feature CHAIN KJ854688_HBSP_P-A of FT:mat_peptide KJ854688_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854689_HBSP_P-A Product feature CHAIN KJ854689_HBSP_P-A of FT:mat_peptide KJ854689_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPARPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQPVSLGSIY
>gnl|hbvpro|KJ854690_HBSP_P-A Product feature CHAIN KJ854690_HBSP_P-A of FT:mat_peptide KJ854690_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854691_HBSP_P-A Product feature CHAIN KJ854691_HBSP_P-A of FT:mat_peptide KJ854691_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854692_HBSP_P-A Product feature CHAIN KJ854692_HBSP_P-A of FT:mat_peptide KJ854692_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854693_HBSP_P-A Product feature CHAIN KJ854693_HBSP_P-A of FT:mat_peptide KJ854693_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17545-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854694_HBSP_P-A Product feature CHAIN KJ854694_HBSP_P-A of FT:mat_peptide KJ854694_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854695_HBSP_P-A Product feature CHAIN KJ854695_HBSP_P-A of FT:mat_peptide KJ854695_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1814-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854696_HBSP_P-A Product feature CHAIN KJ854696_HBSP_P-A of FT:mat_peptide KJ854696_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854697_HBSP_P-A Product feature CHAIN KJ854697_HBSP_P-A of FT:mat_peptide KJ854697_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854698_HBSP_P-A Product feature CHAIN KJ854698_HBSP_P-A of FT:mat_peptide KJ854698_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1993-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854699_HBSP_P-A Product feature CHAIN KJ854699_HBSP_P-A of FT:mat_peptide KJ854699_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340-N-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|KJ854700_HBSP_P-A Product feature CHAIN KJ854700_HBSP_P-A of FT:mat_peptide KJ854700_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313-N-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854701_HBSP_P-A Product feature CHAIN KJ854701_HBSP_P-A of FT:mat_peptide KJ854701_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854702_HBSP_P-A Product feature CHAIN KJ854702_HBSP_P-A of FT:mat_peptide KJ854702_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41-CW-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854703_HBSP_P-A Product feature CHAIN KJ854703_HBSP_P-A of FT:mat_peptide KJ854703_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPARPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854704_HBSP_P-A Product feature CHAIN KJ854704_HBSP_P-A of FT:mat_peptide KJ854704_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66-CW-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854705_HBSP_P-A Product feature CHAIN KJ854705_HBSP_P-A of FT:mat_peptide KJ854705_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67-CW-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854706_HBSP_P-A Product feature CHAIN KJ854706_HBSP_P-A of FT:mat_peptide KJ854706_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753-CW-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQRFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854707_HBSP_P-A Product feature CHAIN KJ854707_HBSP_P-A of FT:mat_peptide KJ854707_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895-N-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854708_HBSP_P-A Product feature CHAIN KJ854708_HBSP_P-A of FT:mat_peptide KJ854708_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16-S-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854709_HBSP_P-A Product feature CHAIN KJ854709_HBSP_P-A of FT:mat_peptide KJ854709_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24-S-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDXTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854710_HBSP_P-A Product feature CHAIN KJ854710_HBSP_P-A of FT:mat_peptide KJ854710_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM243029_HBSP_P-A Product feature CHAIN KM243029_HBSP_P-A of FT:mat_peptide KM243029_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TAC455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM519452_HBSP_P-A Product feature CHAIN KM519452_HBSP_P-A of FT:mat_peptide KM519452_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM519453_HBSP_P-A Product feature CHAIN KM519453_HBSP_P-A of FT:mat_peptide KM519453_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM519454_HBSP_P-A Product feature CHAIN KM519454_HBSP_P-A of FT:mat_peptide KM519454_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|KM606737_HBSP_P-A Product feature CHAIN KM606737_HBSP_P-A of FT:mat_peptide KM606737_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KM606742_HBSP_P-A Product feature CHAIN KM606742_HBSP_P-A of FT:mat_peptide KM606742_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM606746_HBSP_P-A Product feature CHAIN KM606746_HBSP_P-A of FT:mat_peptide KM606746_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM606748_HBSP_P-A Product feature CHAIN KM606748_HBSP_P-A of FT:mat_peptide KM606748_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba51). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM606749_HBSP_P-A Product feature CHAIN KM606749_HBSP_P-A of FT:mat_peptide KM606749_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168422_HBSP_P-A Product feature CHAIN KP168422_HBSP_P-A of FT:mat_peptide KP168422_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN136). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDLAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168423_HBSP_P-A Product feature CHAIN KP168423_HBSP_P-A of FT:mat_peptide KP168423_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168424_HBSP_P-A Product feature CHAIN KP168424_HBSP_P-A of FT:mat_peptide KP168424_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVX
>gnl|hbvpro|KP168425_HBSP_P-A Product feature CHAIN KP168425_HBSP_P-A of FT:mat_peptide KP168425_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168426_HBSP_P-A Product feature CHAIN KP168426_HBSP_P-A of FT:mat_peptide KP168426_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|KP168427_HBSP_P-A Product feature CHAIN KP168427_HBSP_P-A of FT:mat_peptide KP168427_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPARDPAKPARLLLKATLCFPHVAVQNL
RXEIAPVFPSHHLGLSQNXYGXGPQSVSLGSVY
>gnl|hbvpro|KP168428_HBSP_P-A Product feature CHAIN KP168428_HBSP_P-A of FT:mat_peptide KP168428_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVATEXGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHAAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168429_HBSP_P-A Product feature CHAIN KP168429_HBSP_P-A of FT:mat_peptide KP168429_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP168430_HBSP_P-A Product feature CHAIN KP168430_HBSP_P-A of FT:mat_peptide KP168430_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168431_HBSP_P-A Product feature CHAIN KP168431_HBSP_P-A of FT:mat_peptide KP168431_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM03). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARGPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168432_HBSP_P-A Product feature CHAIN KP168432_HBSP_P-A of FT:mat_peptide KP168432_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168433_HBSP_P-A Product feature CHAIN KP168433_HBSP_P-A of FT:mat_peptide KP168433_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168434_HBSP_P-A Product feature CHAIN KP168434_HBSP_P-A of FT:mat_peptide KP168434_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168435_HBSP_P-A Product feature CHAIN KP168435_HBSP_P-A of FT:mat_peptide KP168435_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEELNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RXEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP274925_HBSP_P-A Product feature CHAIN KP274925_HBSP_P-A of FT:mat_peptide KP274925_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADGDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP274927_HBSP_P-A Product feature CHAIN KP274927_HBSP_P-A of FT:mat_peptide KP274927_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP274928_HBSP_P-A Product feature CHAIN KP274928_HBSP_P-A of FT:mat_peptide KP274928_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718085_HBSP_P-A Product feature CHAIN KP718085_HBSP_P-A of FT:mat_peptide KP718085_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-12-1-26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718086_HBSP_P-A Product feature CHAIN KP718086_HBSP_P-A of FT:mat_peptide KP718086_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-03-02-1-60). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718087_HBSP_P-A Product feature CHAIN KP718087_HBSP_P-A of FT:mat_peptide KP718087_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1897). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718088_HBSP_P-A Product feature CHAIN KP718088_HBSP_P-A of FT:mat_peptide KP718088_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1162). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718089_HBSP_P-A Product feature CHAIN KP718089_HBSP_P-A of FT:mat_peptide KP718089_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1249). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KP718090_HBSP_P-A Product feature CHAIN KP718090_HBSP_P-A of FT:mat_peptide KP718090_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1348). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718091_HBSP_P-A Product feature CHAIN KP718091_HBSP_P-A of FT:mat_peptide KP718091_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1771). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718092_HBSP_P-A Product feature CHAIN KP718092_HBSP_P-A of FT:mat_peptide KP718092_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1891). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718093_HBSP_P-A Product feature CHAIN KP718093_HBSP_P-A of FT:mat_peptide KP718093_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1202). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718094_HBSP_P-A Product feature CHAIN KP718094_HBSP_P-A of FT:mat_peptide KP718094_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718095_HBSP_P-A Product feature CHAIN KP718095_HBSP_P-A of FT:mat_peptide KP718095_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAEAGPLEEEPPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718096_HBSP_P-A Product feature CHAIN KP718096_HBSP_P-A of FT:mat_peptide KP718096_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-0004). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718097_HBSP_P-A Product feature CHAIN KP718097_HBSP_P-A of FT:mat_peptide KP718097_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-1943). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718098_HBSP_P-A Product feature CHAIN KP718098_HBSP_P-A of FT:mat_peptide KP718098_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718099_HBSP_P-A Product feature CHAIN KP718099_HBSP_P-A of FT:mat_peptide KP718099_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-378). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718100_HBSP_P-A Product feature CHAIN KP718100_HBSP_P-A of FT:mat_peptide KP718100_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718101_HBSP_P-A Product feature CHAIN KP718101_HBSP_P-A of FT:mat_peptide KP718101_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11-3018). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718102_HBSP_P-A Product feature CHAIN KP718102_HBSP_P-A of FT:mat_peptide KP718102_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP12-1400). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELXRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP995108_HBSP_P-A Product feature CHAIN KP995108_HBSP_P-A of FT:mat_peptide KP995108_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203-Cirrhosis). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR905425_HBSP_P-A Product feature CHAIN KR905425_HBSP_P-A of FT:mat_peptide KR905425_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLYFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGGGPQSVSLGSVH
>gnl|hbvpro|KR905426_HBSP_P-A Product feature CHAIN KR905426_HBSP_P-A of FT:mat_peptide KR905426_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGGGPQPVSLGSVY
>gnl|hbvpro|KR905427_HBSP_P-A Product feature CHAIN KR905427_HBSP_P-A of FT:mat_peptide KR905427_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDQQQPALDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR905429_HBSP_P-A Product feature CHAIN KR905429_HBSP_P-A of FT:mat_peptide KR905429_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGVSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KR905430_HBSP_P-A Product feature CHAIN KR905430_HBSP_P-A of FT:mat_peptide KR905430_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR905431_HBSP_P-A Product feature CHAIN KR905431_HBSP_P-A of FT:mat_peptide KR905431_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-77). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151611_HBSP_P-A Product feature CHAIN KT151611_HBSP_P-A of FT:mat_peptide KT151611_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 398). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151612_HBSP_P-A Product feature CHAIN KT151612_HBSP_P-A of FT:mat_peptide KT151612_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLEEEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151613_HBSP_P-A Product feature CHAIN KT151613_HBSP_P-A of FT:mat_peptide KT151613_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 792). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151614_HBSP_P-A Product feature CHAIN KT151614_HBSP_P-A of FT:mat_peptide KT151614_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151615_HBSP_P-A Product feature CHAIN KT151615_HBSP_P-A of FT:mat_peptide KT151615_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151616_HBSP_P-A Product feature CHAIN KT151616_HBSP_P-A of FT:mat_peptide KT151616_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 655). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151617_HBSP_P-A Product feature CHAIN KT151617_HBSP_P-A of FT:mat_peptide KT151617_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLEEEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151618_HBSP_P-A Product feature CHAIN KT151618_HBSP_P-A of FT:mat_peptide KT151618_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 590). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT347087_HBSP_P-A Product feature CHAIN KT347087_HBSP_P-A of FT:mat_peptide KT347087_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQRVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT347088_HBSP_P-A Product feature CHAIN KT347088_HBSP_P-A of FT:mat_peptide KT347088_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT347091_HBSP_P-A Product feature CHAIN KT347091_HBSP_P-A of FT:mat_peptide KT347091_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT347092_HBSP_P-A Product feature CHAIN KT347092_HBSP_P-A of FT:mat_peptide KT347092_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT366466_HBSP_P-A Product feature CHAIN KT366466_HBSP_P-A of FT:mat_peptide KT366466_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLYFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGGGPQSVSLGSVH
>gnl|hbvpro|KT366467_HBSP_P-A Product feature CHAIN KT366467_HBSP_P-A of FT:mat_peptide KT366467_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGGGPQPVSLGSIY
>gnl|hbvpro|KT366468_HBSP_P-A Product feature CHAIN KT366468_HBSP_P-A of FT:mat_peptide KT366468_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT366469_HBSP_P-A Product feature CHAIN KT366469_HBSP_P-A of FT:mat_peptide KT366469_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT366470_HBSP_P-A Product feature CHAIN KT366470_HBSP_P-A of FT:mat_peptide KT366470_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT366471_HBSP_P-A Product feature CHAIN KT366471_HBSP_P-A of FT:mat_peptide KT366471_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.50). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749822_HBSP_P-A Product feature CHAIN KT749822_HBSP_P-A of FT:mat_peptide KT749822_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDTGTEAGLLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKLARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749824_HBSP_P-A Product feature CHAIN KT749824_HBSP_P-A of FT:mat_peptide KT749824_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749825_HBSP_P-A Product feature CHAIN KT749825_HBSP_P-A of FT:mat_peptide KT749825_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KT749826_HBSP_P-A Product feature CHAIN KT749826_HBSP_P-A of FT:mat_peptide KT749826_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KT749829_HBSP_P-A Product feature CHAIN KT749829_HBSP_P-A of FT:mat_peptide KT749829_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749830_HBSP_P-A Product feature CHAIN KT749830_HBSP_P-A of FT:mat_peptide KT749830_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749831_HBSP_P-A Product feature CHAIN KT749831_HBSP_P-A of FT:mat_peptide KT749831_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749832_HBSP_P-A Product feature CHAIN KT749832_HBSP_P-A of FT:mat_peptide KT749832_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749833_HBSP_P-A Product feature CHAIN KT749833_HBSP_P-A of FT:mat_peptide KT749833_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9b). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RKEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749834_HBSP_P-A Product feature CHAIN KT749834_HBSP_P-A of FT:mat_peptide KT749834_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749835_HBSP_P-A Product feature CHAIN KT749835_HBSP_P-A of FT:mat_peptide KT749835_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749836_HBSP_P-A Product feature CHAIN KT749836_HBSP_P-A of FT:mat_peptide KT749836_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749837_HBSP_P-A Product feature CHAIN KT749837_HBSP_P-A of FT:mat_peptide KT749837_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749838_HBSP_P-A Product feature CHAIN KT749838_HBSP_P-A of FT:mat_peptide KT749838_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749839_HBSP_P-A Product feature CHAIN KT749839_HBSP_P-A of FT:mat_peptide KT749839_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEQELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749840_HBSP_P-A Product feature CHAIN KT749840_HBSP_P-A of FT:mat_peptide KT749840_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749842_HBSP_P-A Product feature CHAIN KT749842_HBSP_P-A of FT:mat_peptide KT749842_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KT749843_HBSP_P-A Product feature CHAIN KT749843_HBSP_P-A of FT:mat_peptide KT749843_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749844_HBSP_P-A Product feature CHAIN KT749844_HBSP_P-A of FT:mat_peptide KT749844_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749846_HBSP_P-A Product feature CHAIN KT749846_HBSP_P-A of FT:mat_peptide KT749846_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749847_HBSP_P-A Product feature CHAIN KT749847_HBSP_P-A of FT:mat_peptide KT749847_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749849_HBSP_P-A Product feature CHAIN KT749849_HBSP_P-A of FT:mat_peptide KT749849_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749850_HBSP_P-A Product feature CHAIN KT749850_HBSP_P-A of FT:mat_peptide KT749850_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605532_HBSP_P-A Product feature CHAIN KU605532_HBSP_P-A of FT:mat_peptide KU605532_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605533_HBSP_P-A Product feature CHAIN KU605533_HBSP_P-A of FT:mat_peptide KU605533_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605534_HBSP_P-A Product feature CHAIN KU605534_HBSP_P-A of FT:mat_peptide KU605534_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605535_HBSP_P-A Product feature CHAIN KU605535_HBSP_P-A of FT:mat_peptide KU605535_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605536_HBSP_P-A Product feature CHAIN KU605536_HBSP_P-A of FT:mat_peptide KU605536_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQPQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605537_HBSP_P-A Product feature CHAIN KU605537_HBSP_P-A of FT:mat_peptide KU605537_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQPQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605538_HBSP_P-A Product feature CHAIN KU605538_HBSP_P-A of FT:mat_peptide KU605538_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQPQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605539_HBSP_P-A Product feature CHAIN KU605539_HBSP_P-A of FT:mat_peptide KU605539_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQPQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU736918_HBSP_P-A Product feature CHAIN KU736918_HBSP_P-A of FT:mat_peptide KU736918_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU736919_HBSP_P-A Product feature CHAIN KU736919_HBSP_P-A of FT:mat_peptide KU736919_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU736920_HBSP_P-A Product feature CHAIN KU736920_HBSP_P-A of FT:mat_peptide KU736920_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276769_HBSP_P-A Product feature CHAIN KX276769_HBSP_P-A of FT:mat_peptide KX276769_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEELNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGXSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357640_HBSP_P-A Product feature CHAIN KX357640_HBSP_P-A of FT:mat_peptide KX357640_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA11ETH). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357642_HBSP_P-A Product feature CHAIN KX357642_HBSP_P-A of FT:mat_peptide KX357642_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357643_HBSP_P-A Product feature CHAIN KX357643_HBSP_P-A of FT:mat_peptide KX357643_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQRPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357644_HBSP_P-A Product feature CHAIN KX357644_HBSP_P-A of FT:mat_peptide KX357644_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA152ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357645_HBSP_P-A Product feature CHAIN KX357645_HBSP_P-A of FT:mat_peptide KX357645_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357646_HBSP_P-A Product feature CHAIN KX357646_HBSP_P-A of FT:mat_peptide KX357646_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357647_HBSP_P-A Product feature CHAIN KX357647_HBSP_P-A of FT:mat_peptide KX357647_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357649_HBSP_P-A Product feature CHAIN KX357649_HBSP_P-A of FT:mat_peptide KX357649_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357650_HBSP_P-A Product feature CHAIN KX357650_HBSP_P-A of FT:mat_peptide KX357650_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA46ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX648547_HBSP_P-A Product feature CHAIN KX648547_HBSP_P-A of FT:mat_peptide KX648547_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi12_103). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAAAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLFFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KX648548_HBSP_P-A Product feature CHAIN KX648548_HBSP_P-A of FT:mat_peptide KX648548_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KX648549_HBSP_P-A Product feature CHAIN KX648549_HBSP_P-A of FT:mat_peptide KX648549_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_172). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|KX827293_HBSP_P-A Product feature CHAIN KX827293_HBSP_P-A of FT:mat_peptide KX827293_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5.4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827294_HBSP_P-A Product feature CHAIN KX827294_HBSP_P-A of FT:mat_peptide KX827294_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827295_HBSP_P-A Product feature CHAIN KX827295_HBSP_P-A of FT:mat_peptide KX827295_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827296_HBSP_P-A Product feature CHAIN KX827296_HBSP_P-A of FT:mat_peptide KX827296_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827297_HBSP_P-A Product feature CHAIN KX827297_HBSP_P-A of FT:mat_peptide KX827297_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.1). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLSRRVAEDLNLGNLNDQQQPVRDHARPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827298_HBSP_P-A Product feature CHAIN KX827298_HBSP_P-A of FT:mat_peptide KX827298_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY003230_HBSP_P-A Product feature CHAIN KY003230_HBSP_P-A of FT:mat_peptide KY003230_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20160922). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY382410_HBSP_P-A Product feature CHAIN KY382410_HBSP_P-A of FT:mat_peptide KY382410_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY886219_HBSP_P-A Product feature CHAIN KY886219_HBSP_P-A of FT:mat_peptide KY886219_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|L13994_HBSP_P-A Product feature CHAIN L13994_HBSP_P-A of FT:mat_peptide L13994_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC051141_HBSP_P-A Product feature CHAIN LC051141_HBSP_P-A of FT:mat_peptide LC051141_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0620). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC074724_HBSP_P-A Product feature CHAIN LC074724_HBSP_P-A of FT:mat_peptide LC074724_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC311241_HBSP_P-A Product feature CHAIN LC311241_HBSP_P-A of FT:mat_peptide LC311241_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC311242_HBSP_P-A Product feature CHAIN LC311242_HBSP_P-A of FT:mat_peptide LC311242_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC311243_HBSP_P-A Product feature CHAIN LC311243_HBSP_P-A of FT:mat_peptide LC311243_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC458430_HBSP_P-A Product feature CHAIN LC458430_HBSP_P-A of FT:mat_peptide LC458430_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB01). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC458431_HBSP_P-A Product feature CHAIN LC458431_HBSP_P-A of FT:mat_peptide LC458431_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB03). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LT992440_HBSP_P-A Product feature CHAIN LT992440_HBSP_P-A of FT:mat_peptide LT992440_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA119). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|LT992441_HBSP_P-A Product feature CHAIN LT992441_HBSP_P-A of FT:mat_peptide LT992441_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDQQRPVRDHAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|LT992448_HBSP_P-A Product feature CHAIN LT992448_HBSP_P-A of FT:mat_peptide LT992448_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RISE386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|M57663_HBSP_P-A Product feature CHAIN M57663_HBSP_P-A of FT:mat_peptide M57663_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772344_HBSP_P-A Product feature CHAIN MF772344_HBSP_P-A of FT:mat_peptide MF772344_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRAHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772345_HBSP_P-A Product feature CHAIN MF772345_HBSP_P-A of FT:mat_peptide MF772345_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1959). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLVLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHARPAQLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772346_HBSP_P-A Product feature CHAIN MF772346_HBSP_P-A of FT:mat_peptide MF772346_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLVLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772347_HBSP_P-A Product feature CHAIN MF772347_HBSP_P-A of FT:mat_peptide MF772347_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 970). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLQFPHVAVQNL
RMEIAPVFPSRRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772348_HBSP_P-A Product feature CHAIN MF772348_HBSP_P-A of FT:mat_peptide MF772348_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772350_HBSP_P-A Product feature CHAIN MF772350_HBSP_P-A of FT:mat_peptide MF772350_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772351_HBSP_P-A Product feature CHAIN MF772351_HBSP_P-A of FT:mat_peptide MF772351_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772353_HBSP_P-A Product feature CHAIN MF772353_HBSP_P-A of FT:mat_peptide MF772353_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQDTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925361_HBSP_P-A Product feature CHAIN MF925361_HBSP_P-A of FT:mat_peptide MF925361_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV04). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925362_HBSP_P-A Product feature CHAIN MF925362_HBSP_P-A of FT:mat_peptide MF925362_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV05). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAKAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925368_HBSP_P-A Product feature CHAIN MF925368_HBSP_P-A of FT:mat_peptide MF925368_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925372_HBSP_P-A Product feature CHAIN MF925372_HBSP_P-A of FT:mat_peptide MF925372_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925373_HBSP_P-A Product feature CHAIN MF925373_HBSP_P-A of FT:mat_peptide MF925373_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925385_HBSP_P-A Product feature CHAIN MF925385_HBSP_P-A of FT:mat_peptide MF925385_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925400_HBSP_P-A Product feature CHAIN MF925400_HBSP_P-A of FT:mat_peptide MF925400_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925407_HBSP_P-A Product feature CHAIN MF925407_HBSP_P-A of FT:mat_peptide MF925407_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV54). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464808_HBSP_P-A Product feature CHAIN MH464808_HBSP_P-A of FT:mat_peptide MH464808_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFXKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|MH464809_HBSP_P-A Product feature CHAIN MH464809_HBSP_P-A of FT:mat_peptide MH464809_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA87). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDAELEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGPVY
>gnl|hbvpro|MH464810_HBSP_P-A Product feature CHAIN MH464810_HBSP_P-A of FT:mat_peptide MH464810_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464811_HBSP_P-A Product feature CHAIN MH464811_HBSP_P-A of FT:mat_peptide MH464811_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA89). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDAELEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARXLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464812_HBSP_P-A Product feature CHAIN MH464812_HBSP_P-A of FT:mat_peptide MH464812_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA90). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464813_HBSP_P-A Product feature CHAIN MH464813_HBSP_P-A of FT:mat_peptide MH464813_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464814_HBSP_P-A Product feature CHAIN MH464814_HBSP_P-A of FT:mat_peptide MH464814_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464815_HBSP_P-A Product feature CHAIN MH464815_HBSP_P-A of FT:mat_peptide MH464815_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464816_HBSP_P-A Product feature CHAIN MH464816_HBSP_P-A of FT:mat_peptide MH464816_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA94). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464818_HBSP_P-A Product feature CHAIN MH464818_HBSP_P-A of FT:mat_peptide MH464818_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464819_HBSP_P-A Product feature CHAIN MH464819_HBSP_P-A of FT:mat_peptide MH464819_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA97). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464820_HBSP_P-A Product feature CHAIN MH464820_HBSP_P-A of FT:mat_peptide MH464820_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA98). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPTRLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464821_HBSP_P-A Product feature CHAIN MH464821_HBSP_P-A of FT:mat_peptide MH464821_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA99). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464822_HBSP_P-A Product feature CHAIN MH464822_HBSP_P-A of FT:mat_peptide MH464822_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA100). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464824_HBSP_P-A Product feature CHAIN MH464824_HBSP_P-A of FT:mat_peptide MH464824_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464825_HBSP_P-A Product feature CHAIN MH464825_HBSP_P-A of FT:mat_peptide MH464825_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|MH464826_HBSP_P-A Product feature CHAIN MH464826_HBSP_P-A of FT:mat_peptide MH464826_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464827_HBSP_P-A Product feature CHAIN MH464827_HBSP_P-A of FT:mat_peptide MH464827_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA105). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464828_HBSP_P-A Product feature CHAIN MH464828_HBSP_P-A of FT:mat_peptide MH464828_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464829_HBSP_P-A Product feature CHAIN MH464829_HBSP_P-A of FT:mat_peptide MH464829_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA107). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKANLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464830_HBSP_P-A Product feature CHAIN MH464830_HBSP_P-A of FT:mat_peptide MH464830_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH580627_HBSP_P-A Product feature CHAIN MH580627_HBSP_P-A of FT:mat_peptide MH580627_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 299). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH580639_HBSP_P-A Product feature CHAIN MH580639_HBSP_P-A of FT:mat_peptide MH580639_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 420). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH580642_HBSP_P-A Product feature CHAIN MH580642_HBSP_P-A of FT:mat_peptide MH580642_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 443). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH580643_HBSP_P-A Product feature CHAIN MH580643_HBSP_P-A of FT:mat_peptide MH580643_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 446). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH932713_HBSP_P-A Product feature CHAIN MH932713_HBSP_P-A of FT:mat_peptide MH932713_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Hiroshima GtA CL1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512456_HBSP_P-A Product feature CHAIN MK512456_HBSP_P-A of FT:mat_peptide MK512456_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3531). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512457_HBSP_P-A Product feature CHAIN MK512457_HBSP_P-A of FT:mat_peptide MK512457_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3173). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512458_HBSP_P-A Product feature CHAIN MK512458_HBSP_P-A of FT:mat_peptide MK512458_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2244). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512459_HBSP_P-A Product feature CHAIN MK512459_HBSP_P-A of FT:mat_peptide MK512459_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2226). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512460_HBSP_P-A Product feature CHAIN MK512460_HBSP_P-A of FT:mat_peptide MK512460_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2199). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLANKNLNRRVAKDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512461_HBSP_P-A Product feature CHAIN MK512461_HBSP_P-A of FT:mat_peptide MK512461_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2157). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512462_HBSP_P-A Product feature CHAIN MK512462_HBSP_P-A of FT:mat_peptide MK512462_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2113). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSFS
>gnl|hbvpro|MK512463_HBSP_P-A Product feature CHAIN MK512463_HBSP_P-A of FT:mat_peptide MK512463_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2086). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADKDLNRRVAENLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512464_HBSP_P-A Product feature CHAIN MK512464_HBSP_P-A of FT:mat_peptide MK512464_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2016). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLFLDDETEAGPLEEELPRLADEDFNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MK512465_HBSP_P-A Product feature CHAIN MK512465_HBSP_P-A of FT:mat_peptide MK512465_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2003). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512466_HBSP_P-A Product feature CHAIN MK512466_HBSP_P-A of FT:mat_peptide MK512466_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-226). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MK512467_HBSP_P-A Product feature CHAIN MK512467_HBSP_P-A of FT:mat_peptide MK512467_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-220). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512469_HBSP_P-A Product feature CHAIN MK512469_HBSP_P-A of FT:mat_peptide MK512469_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-136). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MK512470_HBSP_P-A Product feature CHAIN MK512470_HBSP_P-A of FT:mat_peptide MK512470_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-126). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512471_HBSP_P-A Product feature CHAIN MK512471_HBSP_P-A of FT:mat_peptide MK512471_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-120). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512472_HBSP_P-A Product feature CHAIN MK512472_HBSP_P-A of FT:mat_peptide MK512472_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-65). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512473_HBSP_P-A Product feature CHAIN MK512473_HBSP_P-A of FT:mat_peptide MK512473_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512474_HBSP_P-A Product feature CHAIN MK512474_HBSP_P-A of FT:mat_peptide MK512474_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-37). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRPADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512475_HBSP_P-A Product feature CHAIN MK512475_HBSP_P-A of FT:mat_peptide MK512475_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|MK512476_HBSP_P-A Product feature CHAIN MK512476_HBSP_P-A of FT:mat_peptide MK512476_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512477_HBSP_P-A Product feature CHAIN MK512477_HBSP_P-A of FT:mat_peptide MK512477_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-03). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|V00866_HBSP_P-A Product feature CHAIN V00866_HBSP_P-A of FT:mat_peptide V00866_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLSFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|X02763_HBSP_C-A Product feature CHAIN X02763_HBSP_C-A of FT:mat_peptide X02763_HBSP_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLHRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|X51970_HBSP_P-A Product feature CHAIN X51970_HBSP_P-A of FT:mat_peptide X51970_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|X70185_HBSP_P-A Product feature CHAIN X70185_HBSP_P-A of FT:mat_peptide X70185_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A938). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|Z35717_HBSP_P-A Product feature CHAIN Z35717_HBSP_P-A of FT:mat_peptide Z35717_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hb614). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|Z72478_HBSP_P-A Product feature CHAIN Z72478_HBSP_P-A of FT:mat_peptide Z72478_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A317). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RLEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB010289_HBSP_P-B Product feature CHAIN AB010289_HBSP_P-B of FT:mat_peptide AB010289_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB010290_HBSP_P-B Product feature CHAIN AB010290_HBSP_P-B of FT:mat_peptide AB010290_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB010291_HBSP_P-B Product feature CHAIN AB010291_HBSP_P-B of FT:mat_peptide AB010291_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB010292_HBSP_P-B Product feature CHAIN AB010292_HBSP_P-B of FT:mat_peptide AB010292_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB014366_HBSP_P-B Product feature CHAIN AB014366_HBSP_P-B of FT:mat_peptide AB014366_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 07D07HCC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB031266_HBSP_P-B Product feature CHAIN AB031266_HBSP_P-B of FT:mat_peptide AB031266_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB031267_HBSP_P-B Product feature CHAIN AB031267_HBSP_P-B of FT:mat_peptide AB031267_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB033555_HBSP_P-B Product feature CHAIN AB033555_HBSP_P-B of FT:mat_peptide AB033555_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRPVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB048705_HBSP_P-B Product feature CHAIN AB048705_HBSP_P-B of FT:mat_peptide AB048705_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|AB073821_HBSP_P-B Product feature CHAIN AB073821_HBSP_P-B of FT:mat_peptide AB073821_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073822_HBSP_P-B Product feature CHAIN AB073822_HBSP_P-B of FT:mat_peptide AB073822_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073823_HBSP_P-B Product feature CHAIN AB073823_HBSP_P-B of FT:mat_peptide AB073823_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|AB073824_HBSP_P-B Product feature CHAIN AB073824_HBSP_P-B of FT:mat_peptide AB073824_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDRQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073825_HBSP_P-B Product feature CHAIN AB073825_HBSP_P-B of FT:mat_peptide AB073825_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073826_HBSP_P-B Product feature CHAIN AB073826_HBSP_P-B of FT:mat_peptide AB073826_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073827_HBSP_P-B Product feature CHAIN AB073827_HBSP_P-B of FT:mat_peptide AB073827_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073828_HBSP_P-B Product feature CHAIN AB073828_HBSP_P-B of FT:mat_peptide AB073828_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073829_HBSP_P-B Product feature CHAIN AB073829_HBSP_P-B of FT:mat_peptide AB073829_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073830_HBSP_P-B Product feature CHAIN AB073830_HBSP_P-B of FT:mat_peptide AB073830_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH57). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQXFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073831_HBSP_P-B Product feature CHAIN AB073831_HBSP_P-B of FT:mat_peptide AB073831_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073832_HBSP_P-B Product feature CHAIN AB073832_HBSP_P-B of FT:mat_peptide AB073832_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073833_HBSP_P-B Product feature CHAIN AB073833_HBSP_P-B of FT:mat_peptide AB073833_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073834_HBSP_P-B Product feature CHAIN AB073834_HBSP_P-B of FT:mat_peptide AB073834_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073835_HBSP_P-B Product feature CHAIN AB073835_HBSP_P-B of FT:mat_peptide AB073835_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB073836_HBSP_P-B Product feature CHAIN AB073836_HBSP_P-B of FT:mat_peptide AB073836_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073837_HBSP_P-B Product feature CHAIN AB073837_HBSP_P-B of FT:mat_peptide AB073837_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHHGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073838_HBSP_P-B Product feature CHAIN AB073838_HBSP_P-B of FT:mat_peptide AB073838_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073839_HBSP_P-B Product feature CHAIN AB073839_HBSP_P-B of FT:mat_peptide AB073839_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073840_HBSP_P-B Product feature CHAIN AB073840_HBSP_P-B of FT:mat_peptide AB073840_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073841_HBSP_P-B Product feature CHAIN AB073841_HBSP_P-B of FT:mat_peptide AB073841_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073842_HBSP_P-B Product feature CHAIN AB073842_HBSP_P-B of FT:mat_peptide AB073842_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw11). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQPPARDHARPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB073843_HBSP_P-B Product feature CHAIN AB073843_HBSP_P-B of FT:mat_peptide AB073843_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAPLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073844_HBSP_P-B Product feature CHAIN AB073844_HBSP_P-B of FT:mat_peptide AB073844_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073845_HBSP_P-B Product feature CHAIN AB073845_HBSP_P-B of FT:mat_peptide AB073845_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073846_HBSP_P-B Product feature CHAIN AB073846_HBSP_P-B of FT:mat_peptide AB073846_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHHVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073847_HBSP_P-B Product feature CHAIN AB073847_HBSP_P-B of FT:mat_peptide AB073847_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073848_HBSP_P-B Product feature CHAIN AB073848_HBSP_P-B of FT:mat_peptide AB073848_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073849_HBSP_P-B Product feature CHAIN AB073849_HBSP_P-B of FT:mat_peptide AB073849_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLXLLDDEAGPLEEELPRLADEGLNXRVAEDLNLGNPNDHQPPARXHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073850_HBSP_P-B Product feature CHAIN AB073850_HBSP_P-B of FT:mat_peptide AB073850_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073851_HBSP_P-B Product feature CHAIN AB073851_HBSP_P-B of FT:mat_peptide AB073851_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKETLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSFGSVY
>gnl|hbvpro|AB073852_HBSP_P-B Product feature CHAIN AB073852_HBSP_P-B of FT:mat_peptide AB073852_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073853_HBSP_P-B Product feature CHAIN AB073853_HBSP_P-B of FT:mat_peptide AB073853_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB073854_HBSP_P-B Product feature CHAIN AB073854_HBSP_P-B of FT:mat_peptide AB073854_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073855_HBSP_P-B Product feature CHAIN AB073855_HBSP_P-B of FT:mat_peptide AB073855_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry34). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073857_HBSP_P-B Product feature CHAIN AB073857_HBSP_P-B of FT:mat_peptide AB073857_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPTDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB073858_HBSP_P-B Product feature CHAIN AB073858_HBSP_P-B of FT:mat_peptide AB073858_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB100695_HBSP_P-B Product feature CHAIN AB100695_HBSP_P-B of FT:mat_peptide AB100695_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPPFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB106884_HBSP_P-B Product feature CHAIN AB106884_HBSP_P-B of FT:mat_peptide AB106884_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB115551_HBSP_P-B Product feature CHAIN AB115551_HBSP_P-B of FT:mat_peptide AB115551_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB117759_HBSP_P-B Product feature CHAIN AB117759_HBSP_P-B of FT:mat_peptide AB117759_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPARDHARPAQLLLETPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB195933_HBSP_P-B Product feature CHAIN AB195933_HBSP_P-B of FT:mat_peptide AB195933_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB195934_HBSP_P-B Product feature CHAIN AB195934_HBSP_P-B of FT:mat_peptide AB195934_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB195935_HBSP_P-B Product feature CHAIN AB195935_HBSP_P-B of FT:mat_peptide AB195935_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB205119_HBSP_P-B Product feature CHAIN AB205119_HBSP_P-B of FT:mat_peptide AB205119_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB205120_HBSP_P-B Product feature CHAIN AB205120_HBSP_P-B of FT:mat_peptide AB205120_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB205121_HBSP_P-B Product feature CHAIN AB205121_HBSP_P-B of FT:mat_peptide AB205121_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB205122_HBSP_P-B Product feature CHAIN AB205122_HBSP_P-B of FT:mat_peptide AB205122_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLPLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB212625_HBSP_P-B Product feature CHAIN AB212625_HBSP_P-B of FT:mat_peptide AB212625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEQAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB219427_HBSP_P-B Product feature CHAIN AB219427_HBSP_P-B of FT:mat_peptide AB219427_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPPVAVQNLRK
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB219428_HBSP_C-B Product feature CHAIN AB219428_HBSP_C-B of FT:mat_peptide AB219428_HBSP_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB219430_HBSP_P-B Product feature CHAIN AB219430_HBSP_P-B of FT:mat_peptide AB219430_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB231909_HBSP_P-B Product feature CHAIN AB231909_HBSP_P-B of FT:mat_peptide AB231909_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNHRVAEDLNLGNLNDHQPPALDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB241116_HBSP_P-B Product feature CHAIN AB241116_HBSP_P-B of FT:mat_peptide AB241116_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC03). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLRFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB241117_HBSP_P-B Product feature CHAIN AB241117_HBSP_P-B of FT:mat_peptide AB241117_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLRFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246339_HBSP_P-B Product feature CHAIN AB246339_HBSP_P-B of FT:mat_peptide AB246339_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246340_HBSP_P-B Product feature CHAIN AB246340_HBSP_P-B of FT:mat_peptide AB246340_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246341_HBSP_P-B Product feature CHAIN AB246341_HBSP_P-B of FT:mat_peptide AB246341_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246342_HBSP_P-B Product feature CHAIN AB246342_HBSP_P-B of FT:mat_peptide AB246342_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246343_HBSP_P-B Product feature CHAIN AB246343_HBSP_P-B of FT:mat_peptide AB246343_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287314_HBSP_P-B Product feature CHAIN AB287314_HBSP_P-B of FT:mat_peptide AB287314_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287315_HBSP_P-B Product feature CHAIN AB287315_HBSP_P-B of FT:mat_peptide AB287315_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287316_HBSP_P-B Product feature CHAIN AB287316_HBSP_P-B of FT:mat_peptide AB287316_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDESGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287317_HBSP_P-B Product feature CHAIN AB287317_HBSP_P-B of FT:mat_peptide AB287317_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQYFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287318_HBSP_P-B Product feature CHAIN AB287318_HBSP_P-B of FT:mat_peptide AB287318_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287319_HBSP_P-B Product feature CHAIN AB287319_HBSP_P-B of FT:mat_peptide AB287319_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287320_HBSP_P-B Product feature CHAIN AB287320_HBSP_P-B of FT:mat_peptide AB287320_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287321_HBSP_P-B Product feature CHAIN AB287321_HBSP_P-B of FT:mat_peptide AB287321_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGALEEELPRLADPDLNHRVAEDLNLGDPNDHQPPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287322_HBSP_P-B Product feature CHAIN AB287322_HBSP_P-B of FT:mat_peptide AB287322_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287323_HBSP_P-B Product feature CHAIN AB287323_HBSP_P-B of FT:mat_peptide AB287323_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNRRVAEDLNLGNPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287325_HBSP_P-B Product feature CHAIN AB287325_HBSP_P-B of FT:mat_peptide AB287325_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHAKPARLLLKGPLCFPHVVVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287326_HBSP_P-B Product feature CHAIN AB287326_HBSP_P-B of FT:mat_peptide AB287326_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287327_HBSP_P-B Product feature CHAIN AB287327_HBSP_P-B of FT:mat_peptide AB287327_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADAGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287328_HBSP_P-B Product feature CHAIN AB287328_HBSP_P-B of FT:mat_peptide AB287328_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB287329_HBSP_P-B Product feature CHAIN AB287329_HBSP_P-B of FT:mat_peptide AB287329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300364_HBSP_P-B Product feature CHAIN AB300364_HBSP_P-B of FT:mat_peptide AB300364_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300370_HBSP_P-B Product feature CHAIN AB300370_HBSP_P-B of FT:mat_peptide AB300370_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300371_HBSP_P-B Product feature CHAIN AB300371_HBSP_P-B of FT:mat_peptide AB300371_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQLFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQQPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302095_HBSP_P-B Product feature CHAIN AB302095_HBSP_P-B of FT:mat_peptide AB302095_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKETLRFPHVAVQNLRM
ETAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302942_HBSP_P-B Product feature CHAIN AB302942_HBSP_P-B of FT:mat_peptide AB302942_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302943_HBSP_P-B Product feature CHAIN AB302943_HBSP_P-B of FT:mat_peptide AB302943_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302944_HBSP_P-B Product feature CHAIN AB302944_HBSP_P-B of FT:mat_peptide AB302944_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB302945_HBSP_P-B Product feature CHAIN AB302945_HBSP_P-B of FT:mat_peptide AB302945_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPEHAKPARLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB362933_HBSP_P-B Product feature CHAIN AB362933_HBSP_P-B of FT:mat_peptide AB362933_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPQARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB365445_HBSP_P-B Product feature CHAIN AB365445_HBSP_P-B of FT:mat_peptide AB365445_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB368295_HBSP_P-B Product feature CHAIN AB368295_HBSP_P-B of FT:mat_peptide AB368295_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB471854_HBSP_P-B Product feature CHAIN AB471854_HBSP_P-B of FT:mat_peptide AB471854_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB471855_HBSP_P-B Product feature CHAIN AB471855_HBSP_P-B of FT:mat_peptide AB471855_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB493833_HBSP_P-B Product feature CHAIN AB493833_HBSP_P-B of FT:mat_peptide AB493833_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB555498_HBSP_P-B Product feature CHAIN AB555498_HBSP_P-B of FT:mat_peptide AB555498_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB555499_HBSP_P-B Product feature CHAIN AB555499_HBSP_P-B of FT:mat_peptide AB555499_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA62). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB642093_HBSP_P-B Product feature CHAIN AB642093_HBSP_P-B of FT:mat_peptide AB642093_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHAKXAQLLLKEPLCFPHAXVQNLRT
ETAPVFPSHXLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB642094_HBSP_P-B Product feature CHAIN AB642094_HBSP_P-B of FT:mat_peptide AB642094_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB675676_HBSP_P-B Product feature CHAIN AB675676_HBSP_P-B of FT:mat_peptide AB675676_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713527_HBSP_P-B Product feature CHAIN AB713527_HBSP_P-B of FT:mat_peptide AB713527_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLMEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713528_HBSP_P-B Product feature CHAIN AB713528_HBSP_P-B of FT:mat_peptide AB713528_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPPVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713529_HBSP_P-B Product feature CHAIN AB713529_HBSP_P-B of FT:mat_peptide AB713529_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv68). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713530_HBSP_P-B Product feature CHAIN AB713530_HBSP_P-B of FT:mat_peptide AB713530_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKETLCFPHGAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713531_HBSP_P-B Product feature CHAIN AB713531_HBSP_P-B of FT:mat_peptide AB713531_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB713532_HBSP_P-B Product feature CHAIN AB713532_HBSP_P-B of FT:mat_peptide AB713532_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv132). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLMEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900095_HBSP_P-B Product feature CHAIN AB900095_HBSP_P-B of FT:mat_peptide AB900095_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900096_HBSP_P-B Product feature CHAIN AB900096_HBSP_P-B of FT:mat_peptide AB900096_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKATLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900097_HBSP_P-B Product feature CHAIN AB900097_HBSP_P-B of FT:mat_peptide AB900097_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADAGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900098_HBSP_P-B Product feature CHAIN AB900098_HBSP_P-B of FT:mat_peptide AB900098_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQPPAPDHARPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900102_HBSP_P-B Product feature CHAIN AB900102_HBSP_P-B of FT:mat_peptide AB900102_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900103_HBSP_P-B Product feature CHAIN AB900103_HBSP_P-B of FT:mat_peptide AB900103_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900104_HBSP_P-B Product feature CHAIN AB900104_HBSP_P-B of FT:mat_peptide AB900104_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900105_HBSP_P-B Product feature CHAIN AB900105_HBSP_P-B of FT:mat_peptide AB900105_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPARDHARPARLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900106_HBSP_P-B Product feature CHAIN AB900106_HBSP_P-B of FT:mat_peptide AB900106_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDPQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AB900107_HBSP_P-B Product feature CHAIN AB900107_HBSP_P-B of FT:mat_peptide AB900107_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPAPDPARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900108_HBSP_P-B Product feature CHAIN AB900108_HBSP_P-B of FT:mat_peptide AB900108_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPDDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900110_HBSP_P-B Product feature CHAIN AB900110_HBSP_P-B of FT:mat_peptide AB900110_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900111_HBSP_P-B Product feature CHAIN AB900111_HBSP_P-B of FT:mat_peptide AB900111_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=112 residues).
MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNHRVAEDLNLGIDPNDHXPPARDHARPAQLLLKEPLCFPHVAVQNLR
TETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB900112_HBSP_P-B Product feature CHAIN AB900112_HBSP_P-B of FT:mat_peptide AB900112_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB931168_HBSP_P-B Product feature CHAIN AB931168_HBSP_P-B of FT:mat_peptide AB931168_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB931169_HBSP_P-B Product feature CHAIN AB931169_HBSP_P-B of FT:mat_peptide AB931169_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB976562_HBSP_P-B Product feature CHAIN AB976562_HBSP_P-B of FT:mat_peptide AB976562_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF100308_HBSP_P-B Product feature CHAIN AF100308_HBSP_P-B of FT:mat_peptide AF100308_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF100309_HBSP_P-B Product feature CHAIN AF100309_HBSP_P-B of FT:mat_peptide AF100309_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121243_HBSP_P-B Product feature CHAIN AF121243_HBSP_P-B of FT:mat_peptide AF121243_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121244_HBSP_P-B Product feature CHAIN AF121244_HBSP_P-B of FT:mat_peptide AF121244_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121245_HBSP_P-B Product feature CHAIN AF121245_HBSP_P-B of FT:mat_peptide AF121245_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121246_HBSP_P-B Product feature CHAIN AF121246_HBSP_P-B of FT:mat_peptide AF121246_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121247_HBSP_P-B Product feature CHAIN AF121247_HBSP_P-B of FT:mat_peptide AF121247_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121248_HBSP_P-B Product feature CHAIN AF121248_HBSP_P-B of FT:mat_peptide AF121248_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|AF121249_HBSP_P-B Product feature CHAIN AF121249_HBSP_P-B of FT:mat_peptide AF121249_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121250_HBSP_P-B Product feature CHAIN AF121250_HBSP_P-B of FT:mat_peptide AF121250_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF121251_HBSP_P-B Product feature CHAIN AF121251_HBSP_P-B of FT:mat_peptide AF121251_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AF282917_HBSP_P-B Product feature CHAIN AF282917_HBSP_P-B of FT:mat_peptide AF282917_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPALDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AF282918_HBSP_P-B Product feature CHAIN AF282918_HBSP_P-B of FT:mat_peptide AF282918_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF461360_HBSP_P-B Product feature CHAIN AF461360_HBSP_P-B of FT:mat_peptide AF461360_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH14-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|AF461362_HBSP_P-B Product feature CHAIN AF461362_HBSP_P-B of FT:mat_peptide AF461362_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH10). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPALDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF479684_HBSP_P-B Product feature CHAIN AF479684_HBSP_P-B of FT:mat_peptide AF479684_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDGEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ627225_HBSP_P-B Product feature CHAIN AJ627225_HBSP_P-B of FT:mat_peptide AJ627225_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011084_HBSP_P-B Product feature CHAIN AP011084_HBSP_P-B of FT:mat_peptide AP011084_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011085_HBSP_P-B Product feature CHAIN AP011085_HBSP_P-B of FT:mat_peptide AP011085_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011086_HBSP_P-B Product feature CHAIN AP011086_HBSP_P-B of FT:mat_peptide AP011086_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLYFPHVAVQNLRT
EIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011087_HBSP_P-B Product feature CHAIN AP011087_HBSP_P-B of FT:mat_peptide AP011087_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011088_HBSP_P-B Product feature CHAIN AP011088_HBSP_P-B of FT:mat_peptide AP011088_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011089_HBSP_P-B Product feature CHAIN AP011089_HBSP_P-B of FT:mat_peptide AP011089_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011090_HBSP_P-B Product feature CHAIN AP011090_HBSP_P-B of FT:mat_peptide AP011090_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011091_HBSP_P-B Product feature CHAIN AP011091_HBSP_P-B of FT:mat_peptide AP011091_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011092_HBSP_P-B Product feature CHAIN AP011092_HBSP_P-B of FT:mat_peptide AP011092_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011093_HBSP_P-B Product feature CHAIN AP011093_HBSP_P-B of FT:mat_peptide AP011093_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011094_HBSP_P-B Product feature CHAIN AP011094_HBSP_P-B of FT:mat_peptide AP011094_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AP011095_HBSP_P-B Product feature CHAIN AP011095_HBSP_P-B of FT:mat_peptide AP011095_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AP011096_HBSP_P-B Product feature CHAIN AP011096_HBSP_P-B of FT:mat_peptide AP011096_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY033072_HBSP_P-B Product feature CHAIN AY033072_HBSP_P-B of FT:mat_peptide AY033072_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLWT
ETAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY033073_HBSP_P-B Product feature CHAIN AY033073_HBSP_P-B of FT:mat_peptide AY033073_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLWT
ETAHVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AY163869_HBSP_P-B Product feature CHAIN AY163869_HBSP_P-B of FT:mat_peptide AY163869_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMClx-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPAREHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY163870_HBSP_P-B Product feature CHAIN AY163870_HBSP_P-B of FT:mat_peptide AY163870_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU001). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPAREHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167089_HBSP_P-B Product feature CHAIN AY167089_HBSP_P-B of FT:mat_peptide AY167089_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSCQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167093_HBSP_P-B Product feature CHAIN AY167093_HBSP_P-B of FT:mat_peptide AY167093_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167094_HBSP_P-B Product feature CHAIN AY167094_HBSP_P-B of FT:mat_peptide AY167094_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167097_HBSP_P-B Product feature CHAIN AY167097_HBSP_P-B of FT:mat_peptide AY167097_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167098_HBSP_P-B Product feature CHAIN AY167098_HBSP_P-B of FT:mat_peptide AY167098_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167100_HBSP_P-B Product feature CHAIN AY167100_HBSP_P-B of FT:mat_peptide AY167100_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167101_HBSP_P-B Product feature CHAIN AY167101_HBSP_P-B of FT:mat_peptide AY167101_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY167102_HBSP_P-B Product feature CHAIN AY167102_HBSP_P-B of FT:mat_peptide AY167102_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHYLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY206375_HBSP_P-B Product feature CHAIN AY206375_HBSP_P-B of FT:mat_peptide AY206375_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY206383_HBSP_P-B Product feature CHAIN AY206383_HBSP_P-B of FT:mat_peptide AY206383_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLEQDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY206387_HBSP_P-B Product feature CHAIN AY206387_HBSP_P-B of FT:mat_peptide AY206387_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDGDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPEHAKPARLLLKEPLCFPHVAVQNLRT
QTAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY206390_HBSP_P-B Product feature CHAIN AY206390_HBSP_P-B of FT:mat_peptide AY206390_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY206391_HBSP_P-B Product feature CHAIN AY206391_HBSP_P-B of FT:mat_peptide AY206391_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217356_HBSP_P-B Product feature CHAIN AY217356_HBSP_P-B of FT:mat_peptide AY217356_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A9-2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217357_HBSP_P-B Product feature CHAIN AY217357_HBSP_P-B of FT:mat_peptide AY217357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217358_HBSP_P-B Product feature CHAIN AY217358_HBSP_P-B of FT:mat_peptide AY217358_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217359_HBSP_P-B Product feature CHAIN AY217359_HBSP_P-B of FT:mat_peptide AY217359_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLFKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217360_HBSP_P-B Product feature CHAIN AY217360_HBSP_P-B of FT:mat_peptide AY217360_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRIAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217361_HBSP_P-B Product feature CHAIN AY217361_HBSP_P-B of FT:mat_peptide AY217361_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY217362_HBSP_P-B Product feature CHAIN AY217362_HBSP_P-B of FT:mat_peptide AY217362_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217364_HBSP_P-B Product feature CHAIN AY217364_HBSP_P-B of FT:mat_peptide AY217364_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 586). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPARLLLNEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY217368_HBSP_P-B Product feature CHAIN AY217368_HBSP_P-B of FT:mat_peptide AY217368_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21949). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|AY220697_HBSP_P-B Product feature CHAIN AY220697_HBSP_P-B of FT:mat_peptide AY220697_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|AY220698_HBSP_P-B Product feature CHAIN AY220698_HBSP_P-B of FT:mat_peptide AY220698_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY220703_HBSP_P-B Product feature CHAIN AY220703_HBSP_P-B of FT:mat_peptide AY220703_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY220704_HBSP_P-B Product feature CHAIN AY220704_HBSP_P-B of FT:mat_peptide AY220704_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY293309_HBSP_P-B Product feature CHAIN AY293309_HBSP_P-B of FT:mat_peptide AY293309_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY518556_HBSP_P-B Product feature CHAIN AY518556_HBSP_P-B of FT:mat_peptide AY518556_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596102_HBSP_P-B Product feature CHAIN AY596102_HBSP_P-B of FT:mat_peptide AY596102_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596103_HBSP_P-B Product feature CHAIN AY596103_HBSP_P-B of FT:mat_peptide AY596103_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVH
>gnl|hbvpro|AY596104_HBSP_P-B Product feature CHAIN AY596104_HBSP_P-B of FT:mat_peptide AY596104_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AY596105_HBSP_P-B Product feature CHAIN AY596105_HBSP_P-B of FT:mat_peptide AY596105_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-5). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596106_HBSP_P-B Product feature CHAIN AY596106_HBSP_P-B of FT:mat_peptide AY596106_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596109_HBSP_P-B Product feature CHAIN AY596109_HBSP_P-B of FT:mat_peptide AY596109_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSCQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596110_HBSP_P-B Product feature CHAIN AY596110_HBSP_P-B of FT:mat_peptide AY596110_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596111_HBSP_P-B Product feature CHAIN AY596111_HBSP_P-B of FT:mat_peptide AY596111_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY596112_HBSP_P-B Product feature CHAIN AY596112_HBSP_P-B of FT:mat_peptide AY596112_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY766463_HBSP_P-B Product feature CHAIN AY766463_HBSP_P-B of FT:mat_peptide AY766463_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY800389_HBSP_P-B Product feature CHAIN AY800389_HBSP_P-B of FT:mat_peptide AY800389_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQPFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AY800391_HBSP_P-B Product feature CHAIN AY800391_HBSP_P-B of FT:mat_peptide AY800391_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARRLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY800392_HBSP_P-B Product feature CHAIN AY800392_HBSP_P-B of FT:mat_peptide AY800392_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARRLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D00329_HBSP_P-B Product feature CHAIN D00329_HBSP_P-B of FT:mat_peptide D00329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLWM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D00330_HBSP_P-B Product feature CHAIN D00330_HBSP_P-B of FT:mat_peptide D00330_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D00331_HBSP_C-B Product feature CHAIN D00331_HBSP_C-B of FT:mat_peptide D00331_HBSP_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAQDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D23678_HBSP_P-B Product feature CHAIN D23678_HBSP_P-B of FT:mat_peptide D23678_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D23679_HBSP_P-B Product feature CHAIN D23679_HBSP_P-B of FT:mat_peptide D23679_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARGHARPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D50521_HBSP_P-B Product feature CHAIN D50521_HBSP_P-B of FT:mat_peptide D50521_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLGLGNLNDHQPPARDHARPAQLLLETPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|D50522_HBSP_P-B Product feature CHAIN D50522_HBSP_P-B of FT:mat_peptide D50522_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLGLGNLNDHQPPARDHARPAQLLLKAPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ361535_HBSP_P-B Product feature CHAIN DQ361535_HBSP_P-B of FT:mat_peptide DQ361535_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CRP-228). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKETLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ377158_HBSP_P-B Product feature CHAIN DQ377158_HBSP_P-B of FT:mat_peptide DQ377158_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WJT31). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448619_HBSP_P-B Product feature CHAIN DQ448619_HBSP_P-B of FT:mat_peptide DQ448619_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448620_HBSP_P-B Product feature CHAIN DQ448620_HBSP_P-B of FT:mat_peptide DQ448620_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448621_HBSP_P-B Product feature CHAIN DQ448621_HBSP_P-B of FT:mat_peptide DQ448621_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448622_HBSP_P-B Product feature CHAIN DQ448622_HBSP_P-B of FT:mat_peptide DQ448622_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448623_HBSP_P-B Product feature CHAIN DQ448623_HBSP_P-B of FT:mat_peptide DQ448623_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448624_HBSP_P-B Product feature CHAIN DQ448624_HBSP_P-B of FT:mat_peptide DQ448624_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448625_HBSP_P-B Product feature CHAIN DQ448625_HBSP_P-B of FT:mat_peptide DQ448625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448626_HBSP_P-B Product feature CHAIN DQ448626_HBSP_P-B of FT:mat_peptide DQ448626_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448627_HBSP_P-B Product feature CHAIN DQ448627_HBSP_P-B of FT:mat_peptide DQ448627_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ448628_HBSP_P-B Product feature CHAIN DQ448628_HBSP_P-B of FT:mat_peptide DQ448628_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463787_HBSP_P-B Product feature CHAIN DQ463787_HBSP_P-B of FT:mat_peptide DQ463787_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463788_HBSP_P-B Product feature CHAIN DQ463788_HBSP_P-B of FT:mat_peptide DQ463788_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463789_HBSP_P-B Product feature CHAIN DQ463789_HBSP_P-B of FT:mat_peptide DQ463789_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463790_HBSP_P-B Product feature CHAIN DQ463790_HBSP_P-B of FT:mat_peptide DQ463790_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463791_HBSP_P-B Product feature CHAIN DQ463791_HBSP_P-B of FT:mat_peptide DQ463791_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHRPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463792_HBSP_P-B Product feature CHAIN DQ463792_HBSP_P-B of FT:mat_peptide DQ463792_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDTDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463793_HBSP_P-B Product feature CHAIN DQ463793_HBSP_P-B of FT:mat_peptide DQ463793_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_1979). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHAKLARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463794_HBSP_P-B Product feature CHAIN DQ463794_HBSP_P-B of FT:mat_peptide DQ463794_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGDPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463795_HBSP_P-B Product feature CHAIN DQ463795_HBSP_P-B of FT:mat_peptide DQ463795_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDRARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463796_HBSP_P-B Product feature CHAIN DQ463796_HBSP_P-B of FT:mat_peptide DQ463796_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463797_HBSP_P-B Product feature CHAIN DQ463797_HBSP_P-B of FT:mat_peptide DQ463797_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463798_HBSP_P-B Product feature CHAIN DQ463798_HBSP_P-B of FT:mat_peptide DQ463798_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463799_HBSP_P-B Product feature CHAIN DQ463799_HBSP_P-B of FT:mat_peptide DQ463799_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463800_HBSP_P-B Product feature CHAIN DQ463800_HBSP_P-B of FT:mat_peptide DQ463800_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463801_HBSP_P-B Product feature CHAIN DQ463801_HBSP_P-B of FT:mat_peptide DQ463801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_2004). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNDHQPPAPDHAKLARLLLKEPLCFPHVVVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ463802_HBSP_P-B Product feature CHAIN DQ463802_HBSP_P-B of FT:mat_peptide DQ463802_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ904357_HBSP_P-B Product feature CHAIN DQ904357_HBSP_P-B of FT:mat_peptide DQ904357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993680_HBSP_P-B Product feature CHAIN DQ993680_HBSP_P-B of FT:mat_peptide DQ993680_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 268). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYEDFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993681_HBSP_P-B Product feature CHAIN DQ993681_HBSP_P-B of FT:mat_peptide DQ993681_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 290). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993683_HBSP_P-B Product feature CHAIN DQ993683_HBSP_P-B of FT:mat_peptide DQ993683_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993684_HBSP_P-B Product feature CHAIN DQ993684_HBSP_P-B of FT:mat_peptide DQ993684_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993685_HBSP_P-B Product feature CHAIN DQ993685_HBSP_P-B of FT:mat_peptide DQ993685_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 554). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDPAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993686_HBSP_P-B Product feature CHAIN DQ993686_HBSP_P-B of FT:mat_peptide DQ993686_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPARDHARPAQLLLETPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993687_HBSP_P-B Product feature CHAIN DQ993687_HBSP_P-B of FT:mat_peptide DQ993687_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=112 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFASHHLGLSQNTYGSGPQSVSLGSVYY
>gnl|hbvpro|DQ993696_HBSP_P-B Product feature CHAIN DQ993696_HBSP_P-B of FT:mat_peptide DQ993696_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHGIPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQFVSLGSVY
>gnl|hbvpro|DQ993697_HBSP_P-B Product feature CHAIN DQ993697_HBSP_P-B of FT:mat_peptide DQ993697_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993698_HBSP_P-B Product feature CHAIN DQ993698_HBSP_P-B of FT:mat_peptide DQ993698_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0327-ETCvs3TC-Naive). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEAAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993699_HBSP_P-B Product feature CHAIN DQ993699_HBSP_P-B of FT:mat_peptide DQ993699_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEAAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993700_HBSP_P-B Product feature CHAIN DQ993700_HBSP_P-B of FT:mat_peptide DQ993700_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993701_HBSP_P-B Product feature CHAIN DQ993701_HBSP_P-B of FT:mat_peptide DQ993701_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993702_HBSP_P-B Product feature CHAIN DQ993702_HBSP_P-B of FT:mat_peptide DQ993702_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|DQ993703_HBSP_P-B Product feature CHAIN DQ993703_HBSP_P-B of FT:mat_peptide DQ993703_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993704_HBSP_P-B Product feature CHAIN DQ993704_HBSP_P-B of FT:mat_peptide DQ993704_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-1127-Nature3.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLYYQHFRKLLLLDEQAGPLEKELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993705_HBSP_P-B Product feature CHAIN DQ993705_HBSP_P-B of FT:mat_peptide DQ993705_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0625-Nature3.4-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993706_HBSP_P-B Product feature CHAIN DQ993706_HBSP_P-B of FT:mat_peptide DQ993706_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993707_HBSP_P-B Product feature CHAIN DQ993707_HBSP_P-B of FT:mat_peptide DQ993707_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993708_HBSP_P-B Product feature CHAIN DQ993708_HBSP_P-B of FT:mat_peptide DQ993708_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993709_HBSP_P-B Product feature CHAIN DQ993709_HBSP_P-B of FT:mat_peptide DQ993709_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993710_HBSP_P-B Product feature CHAIN DQ993710_HBSP_P-B of FT:mat_peptide DQ993710_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0718-ETC). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ993711_HBSP_P-B Product feature CHAIN DQ993711_HBSP_P-B of FT:mat_peptide DQ993711_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 221-1120-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGTLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995801_HBSP_P-B Product feature CHAIN DQ995801_HBSP_P-B of FT:mat_peptide DQ995801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995802_HBSP_P-B Product feature CHAIN DQ995802_HBSP_P-B of FT:mat_peptide DQ995802_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQQPAPDHAKPAQLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995803_HBSP_P-B Product feature CHAIN DQ995803_HBSP_P-B of FT:mat_peptide DQ995803_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C265-15). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995804_HBSP_P-B Product feature CHAIN DQ995804_HBSP_P-B of FT:mat_peptide DQ995804_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQESGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|DQ995805_HBSP_P-B Product feature CHAIN DQ995805_HBSP_P-B of FT:mat_peptide DQ995805_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-2.5KB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF134945_HBSP_P-B Product feature CHAIN EF134945_HBSP_P-B of FT:mat_peptide EF134945_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF134946_HBSP_P-B Product feature CHAIN EF134946_HBSP_P-B of FT:mat_peptide EF134946_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473971_HBSP_P-B Product feature CHAIN EF473971_HBSP_P-B of FT:mat_peptide EF473971_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473972_HBSP_P-B Product feature CHAIN EF473972_HBSP_P-B of FT:mat_peptide EF473972_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473973_HBSP_P-B Product feature CHAIN EF473973_HBSP_P-B of FT:mat_peptide EF473973_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRPVADDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473974_HBSP_P-B Product feature CHAIN EF473974_HBSP_P-B of FT:mat_peptide EF473974_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EF473975_HBSP_P-B Product feature CHAIN EF473975_HBSP_P-B of FT:mat_peptide EF473975_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVADDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|EF473976_HBSP_P-B Product feature CHAIN EF473976_HBSP_P-B of FT:mat_peptide EF473976_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHPPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF473977_HBSP_P-B Product feature CHAIN EF473977_HBSP_P-B of FT:mat_peptide EF473977_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPAQLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF494380_HBSP_P-B Product feature CHAIN EF494380_HBSP_P-B of FT:mat_peptide EF494380_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF494382_HBSP_P-B Product feature CHAIN EF494382_HBSP_P-B of FT:mat_peptide EF494382_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNHRVAKDLNLGTLNDHQQPARDHAKPARVLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU139543_HBSP_P-B Product feature CHAIN EU139543_HBSP_P-B of FT:mat_peptide EU139543_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVH
>gnl|hbvpro|EU158262_HBSP_P-B Product feature CHAIN EU158262_HBSP_P-B of FT:mat_peptide EU158262_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G116). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU158263_HBSP_P-B Product feature CHAIN EU158263_HBSP_P-B of FT:mat_peptide EU158263_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU305547_HBSP_P-B Product feature CHAIN EU305547_HBSP_P-B of FT:mat_peptide EU305547_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU305548_HBSP_P-B Product feature CHAIN EU305548_HBSP_P-B of FT:mat_peptide EU305548_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRRPASDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306677_HBSP_P-B Product feature CHAIN EU306677_HBSP_P-B of FT:mat_peptide EU306677_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306678_HBSP_P-B Product feature CHAIN EU306678_HBSP_P-B of FT:mat_peptide EU306678_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306679_HBSP_P-B Product feature CHAIN EU306679_HBSP_P-B of FT:mat_peptide EU306679_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306680_HBSP_P-B Product feature CHAIN EU306680_HBSP_P-B of FT:mat_peptide EU306680_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306681_HBSP_P-B Product feature CHAIN EU306681_HBSP_P-B of FT:mat_peptide EU306681_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAHLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306695_HBSP_P-B Product feature CHAIN EU306695_HBSP_P-B of FT:mat_peptide EU306695_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306696_HBSP_P-B Product feature CHAIN EU306696_HBSP_P-B of FT:mat_peptide EU306696_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGRGPQSVSLGSVY
>gnl|hbvpro|EU306697_HBSP_P-B Product feature CHAIN EU306697_HBSP_P-B of FT:mat_peptide EU306697_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306698_HBSP_P-B Product feature CHAIN EU306698_HBSP_P-B of FT:mat_peptide EU306698_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306699_HBSP_P-B Product feature CHAIN EU306699_HBSP_P-B of FT:mat_peptide EU306699_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306700_HBSP_P-B Product feature CHAIN EU306700_HBSP_P-B of FT:mat_peptide EU306700_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306701_HBSP_P-B Product feature CHAIN EU306701_HBSP_P-B of FT:mat_peptide EU306701_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306702_HBSP_P-B Product feature CHAIN EU306702_HBSP_P-B of FT:mat_peptide EU306702_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306703_HBSP_P-B Product feature CHAIN EU306703_HBSP_P-B of FT:mat_peptide EU306703_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306704_HBSP_P-B Product feature CHAIN EU306704_HBSP_P-B of FT:mat_peptide EU306704_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNAYGSGPQSVSLGSVY
>gnl|hbvpro|EU306705_HBSP_P-B Product feature CHAIN EU306705_HBSP_P-B of FT:mat_peptide EU306705_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306706_HBSP_P-B Product feature CHAIN EU306706_HBSP_P-B of FT:mat_peptide EU306706_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306707_HBSP_P-B Product feature CHAIN EU306707_HBSP_P-B of FT:mat_peptide EU306707_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRAAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNAYGSGPQSVSLGSVY
>gnl|hbvpro|EU306708_HBSP_P-B Product feature CHAIN EU306708_HBSP_P-B of FT:mat_peptide EU306708_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306709_HBSP_P-B Product feature CHAIN EU306709_HBSP_P-B of FT:mat_peptide EU306709_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306710_HBSP_P-B Product feature CHAIN EU306710_HBSP_P-B of FT:mat_peptide EU306710_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306711_HBSP_P-B Product feature CHAIN EU306711_HBSP_P-B of FT:mat_peptide EU306711_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU306712_HBSP_P-B Product feature CHAIN EU306712_HBSP_P-B of FT:mat_peptide EU306712_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330989_HBSP_P-B Product feature CHAIN EU330989_HBSP_P-B of FT:mat_peptide EU330989_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPRVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330990_HBSP_P-B Product feature CHAIN EU330990_HBSP_P-B of FT:mat_peptide EU330990_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPRVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330992_HBSP_P-B Product feature CHAIN EU330992_HBSP_P-B of FT:mat_peptide EU330992_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330994_HBSP_P-B Product feature CHAIN EU330994_HBSP_P-B of FT:mat_peptide EU330994_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330995_HBSP_P-B Product feature CHAIN EU330995_HBSP_P-B of FT:mat_peptide EU330995_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-80). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330996_HBSP_P-B Product feature CHAIN EU330996_HBSP_P-B of FT:mat_peptide EU330996_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330997_HBSP_P-B Product feature CHAIN EU330997_HBSP_P-B of FT:mat_peptide EU330997_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330998_HBSP_P-B Product feature CHAIN EU330998_HBSP_P-B of FT:mat_peptide EU330998_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU330999_HBSP_P-B Product feature CHAIN EU330999_HBSP_P-B of FT:mat_peptide EU330999_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU331000_HBSP_P-B Product feature CHAIN EU331000_HBSP_P-B of FT:mat_peptide EU331000_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU331001_HBSP_P-B Product feature CHAIN EU331001_HBSP_P-B of FT:mat_peptide EU331001_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU350409_HBSP_P-B Product feature CHAIN EU350409_HBSP_P-B of FT:mat_peptide EU350409_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439018_HBSP_P-B Product feature CHAIN EU439018_HBSP_P-B of FT:mat_peptide EU439018_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439020_HBSP_P-B Product feature CHAIN EU439020_HBSP_P-B of FT:mat_peptide EU439020_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439021_HBSP_P-B Product feature CHAIN EU439021_HBSP_P-B of FT:mat_peptide EU439021_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439022_HBSP_P-B Product feature CHAIN EU439022_HBSP_P-B of FT:mat_peptide EU439022_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU439023_HBSP_P-B Product feature CHAIN EU439023_HBSP_P-B of FT:mat_peptide EU439023_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU487256_HBSP_P-B Product feature CHAIN EU487256_HBSP_P-B of FT:mat_peptide EU487256_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU487257_HBSP_P-B Product feature CHAIN EU487257_HBSP_P-B of FT:mat_peptide EU487257_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU522066_HBSP_P-B Product feature CHAIN EU522066_HBSP_P-B of FT:mat_peptide EU522066_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4N). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU522067_HBSP_P-B Product feature CHAIN EU522067_HBSP_P-B of FT:mat_peptide EU522067_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4T). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU522072_HBSP_P-B Product feature CHAIN EU522072_HBSP_P-B of FT:mat_peptide EU522072_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU522073_HBSP_P-B Product feature CHAIN EU522073_HBSP_P-B of FT:mat_peptide EU522073_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU522074_HBSP_P-B Product feature CHAIN EU522074_HBSP_P-B of FT:mat_peptide EU522074_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU522075_HBSP_P-B Product feature CHAIN EU522075_HBSP_P-B of FT:mat_peptide EU522075_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU547563_HBSP_P-B Product feature CHAIN EU547563_HBSP_P-B of FT:mat_peptide EU547563_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564822_HBSP_P-B Product feature CHAIN EU564822_HBSP_P-B of FT:mat_peptide EU564822_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564823_HBSP_P-B Product feature CHAIN EU564823_HBSP_P-B of FT:mat_peptide EU564823_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564824_HBSP_P-B Product feature CHAIN EU564824_HBSP_P-B of FT:mat_peptide EU564824_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564825_HBSP_P-B Product feature CHAIN EU564825_HBSP_P-B of FT:mat_peptide EU564825_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11T). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU564826_HBSP_P-B Product feature CHAIN EU564826_HBSP_P-B of FT:mat_peptide EU564826_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11N). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU570069_HBSP_P-B Product feature CHAIN EU570069_HBSP_P-B of FT:mat_peptide EU570069_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
GTAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU570070_HBSP_P-B Product feature CHAIN EU570070_HBSP_P-B of FT:mat_peptide EU570070_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU570071_HBSP_P-B Product feature CHAIN EU570071_HBSP_P-B of FT:mat_peptide EU570071_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU570075_HBSP_P-B Product feature CHAIN EU570075_HBSP_P-B of FT:mat_peptide EU570075_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRRQRAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU579441_HBSP_P-B Product feature CHAIN EU579441_HBSP_P-B of FT:mat_peptide EU579441_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKILLLDQDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRRQRAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU589335_HBSP_P-B Product feature CHAIN EU589335_HBSP_P-B of FT:mat_peptide EU589335_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142-5). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRRQRAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU595031_HBSP_P-B Product feature CHAIN EU595031_HBSP_P-B of FT:mat_peptide EU595031_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU660224_HBSP_P-B Product feature CHAIN EU660224_HBSP_P-B of FT:mat_peptide EU660224_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-12N). Non-functional genomic sequence. [Hepadnaviridae] (length=110 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNQTEPAPDHAKPAQLLLKEPLCFPHVAVPNLRTE
TAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU660230_HBSP_P-B Product feature CHAIN EU660230_HBSP_P-B of FT:mat_peptide EU660230_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU660231_HBSP_P-B Product feature CHAIN EU660231_HBSP_P-B of FT:mat_peptide EU660231_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU796066_HBSP_P-B Product feature CHAIN EU796066_HBSP_P-B of FT:mat_peptide EU796066_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU796067_HBSP_P-B Product feature CHAIN EU796067_HBSP_P-B of FT:mat_peptide EU796067_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU796068_HBSP_P-B Product feature CHAIN EU796068_HBSP_P-B of FT:mat_peptide EU796068_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU796071_HBSP_P-B Product feature CHAIN EU796071_HBSP_P-B of FT:mat_peptide EU796071_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU881997_HBSP_P-B Product feature CHAIN EU881997_HBSP_P-B of FT:mat_peptide EU881997_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU881998_HBSP_P-B Product feature CHAIN EU881998_HBSP_P-B of FT:mat_peptide EU881998_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU882002_HBSP_P-B Product feature CHAIN EU882002_HBSP_P-B of FT:mat_peptide EU882002_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU882004_HBSP_P-B Product feature CHAIN EU882004_HBSP_P-B of FT:mat_peptide EU882004_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU919171_HBSP_P-B Product feature CHAIN EU919171_HBSP_P-B of FT:mat_peptide EU919171_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU919172_HBSP_P-B Product feature CHAIN EU919172_HBSP_P-B of FT:mat_peptide EU919172_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSHNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU919173_HBSP_P-B Product feature CHAIN EU919173_HBSP_P-B of FT:mat_peptide EU919173_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU919175_HBSP_P-B Product feature CHAIN EU919175_HBSP_P-B of FT:mat_peptide EU919175_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU919176_HBSP_P-B Product feature CHAIN EU919176_HBSP_P-B of FT:mat_peptide EU919176_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939559_HBSP_P-B Product feature CHAIN EU939559_HBSP_P-B of FT:mat_peptide EU939559_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939633_HBSP_P-B Product feature CHAIN EU939633_HBSP_P-B of FT:mat_peptide EU939633_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU939634_HBSP_P-B Product feature CHAIN EU939634_HBSP_P-B of FT:mat_peptide EU939634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU939635_HBSP_P-B Product feature CHAIN EU939635_HBSP_P-B of FT:mat_peptide EU939635_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B125). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939636_HBSP_P-B Product feature CHAIN EU939636_HBSP_P-B of FT:mat_peptide EU939636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939637_HBSP_P-B Product feature CHAIN EU939637_HBSP_P-B of FT:mat_peptide EU939637_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C13). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKSAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939638_HBSP_P-B Product feature CHAIN EU939638_HBSP_P-B of FT:mat_peptide EU939638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLYFPHVAVQNLRT
ATAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939639_HBSP_P-B Product feature CHAIN EU939639_HBSP_P-B of FT:mat_peptide EU939639_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939660_HBSP_P-B Product feature CHAIN EU939660_HBSP_P-B of FT:mat_peptide EU939660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C34). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939661_HBSP_P-B Product feature CHAIN EU939661_HBSP_P-B of FT:mat_peptide EU939661_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVADELNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939663_HBSP_P-B Product feature CHAIN EU939663_HBSP_P-B of FT:mat_peptide EU939663_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939664_HBSP_P-B Product feature CHAIN EU939664_HBSP_P-B of FT:mat_peptide EU939664_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C85). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939665_HBSP_P-B Product feature CHAIN EU939665_HBSP_P-B of FT:mat_peptide EU939665_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939666_HBSP_P-B Product feature CHAIN EU939666_HBSP_P-B of FT:mat_peptide EU939666_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939667_HBSP_P-B Product feature CHAIN EU939667_HBSP_P-B of FT:mat_peptide EU939667_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939669_HBSP_P-B Product feature CHAIN EU939669_HBSP_P-B of FT:mat_peptide EU939669_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU939670_HBSP_P-B Product feature CHAIN EU939670_HBSP_P-B of FT:mat_peptide EU939670_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGDLNEHQQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU939672_HBSP_P-B Product feature CHAIN EU939672_HBSP_P-B of FT:mat_peptide EU939672_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939673_HBSP_P-B Product feature CHAIN EU939673_HBSP_P-B of FT:mat_peptide EU939673_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARHAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939674_HBSP_P-B Product feature CHAIN EU939674_HBSP_P-B of FT:mat_peptide EU939674_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVH
>gnl|hbvpro|EU939675_HBSP_P-B Product feature CHAIN EU939675_HBSP_P-B of FT:mat_peptide EU939675_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939676_HBSP_P-B Product feature CHAIN EU939676_HBSP_P-B of FT:mat_peptide EU939676_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939677_HBSP_P-B Product feature CHAIN EU939677_HBSP_P-B of FT:mat_peptide EU939677_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHPQPARDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU939678_HBSP_P-B Product feature CHAIN EU939678_HBSP_P-B of FT:mat_peptide EU939678_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023631_HBSP_P-B Product feature CHAIN FJ023631_HBSP_P-B of FT:mat_peptide FJ023631_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQESGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKLARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023632_HBSP_P-B Product feature CHAIN FJ023632_HBSP_P-B of FT:mat_peptide FJ023632_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023633_HBSP_P-B Product feature CHAIN FJ023633_HBSP_P-B of FT:mat_peptide FJ023633_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023634_HBSP_P-B Product feature CHAIN FJ023634_HBSP_P-B of FT:mat_peptide FJ023634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023635_HBSP_P-B Product feature CHAIN FJ023635_HBSP_P-B of FT:mat_peptide FJ023635_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023636_HBSP_P-B Product feature CHAIN FJ023636_HBSP_P-B of FT:mat_peptide FJ023636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLYFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023637_HBSP_P-B Product feature CHAIN FJ023637_HBSP_P-B of FT:mat_peptide FJ023637_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ023638_HBSP_P-B Product feature CHAIN FJ023638_HBSP_P-B of FT:mat_peptide FJ023638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032342_HBSP_P-B Product feature CHAIN FJ032342_HBSP_P-B of FT:mat_peptide FJ032342_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKETLRYPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032344_HBSP_P-B Product feature CHAIN FJ032344_HBSP_P-B of FT:mat_peptide FJ032344_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDHQQPAPDHAKPARLLLKETLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032349_HBSP_P-B Product feature CHAIN FJ032349_HBSP_P-B of FT:mat_peptide FJ032349_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|FJ032352_HBSP_P-B Product feature CHAIN FJ032352_HBSP_P-B of FT:mat_peptide FJ032352_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHRLGLSQNIYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032353_HBSP_P-B Product feature CHAIN FJ032353_HBSP_P-B of FT:mat_peptide FJ032353_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032354_HBSP_P-B Product feature CHAIN FJ032354_HBSP_P-B of FT:mat_peptide FJ032354_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032357_HBSP_P-B Product feature CHAIN FJ032357_HBSP_P-B of FT:mat_peptide FJ032357_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ032358_HBSP_P-B Product feature CHAIN FJ032358_HBSP_P-B of FT:mat_peptide FJ032358_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|FJ349236_HBSP_P-B Product feature CHAIN FJ349236_HBSP_P-B of FT:mat_peptide FJ349236_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386582_HBSP_P-B Product feature CHAIN FJ386582_HBSP_P-B of FT:mat_peptide FJ386582_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386583_HBSP_P-B Product feature CHAIN FJ386583_HBSP_P-B of FT:mat_peptide FJ386583_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386584_HBSP_P-B Product feature CHAIN FJ386584_HBSP_P-B of FT:mat_peptide FJ386584_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386600_HBSP_P-B Product feature CHAIN FJ386600_HBSP_P-B of FT:mat_peptide FJ386600_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|FJ386608_HBSP_P-B Product feature CHAIN FJ386608_HBSP_P-B of FT:mat_peptide FJ386608_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHRQPALDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHRLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386610_HBSP_P-B Product feature CHAIN FJ386610_HBSP_P-B of FT:mat_peptide FJ386610_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386615_HBSP_P-B Product feature CHAIN FJ386615_HBSP_P-B of FT:mat_peptide FJ386615_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386634_HBSP_P-B Product feature CHAIN FJ386634_HBSP_P-B of FT:mat_peptide FJ386634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386636_HBSP_P-B Product feature CHAIN FJ386636_HBSP_P-B of FT:mat_peptide FJ386636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386642_HBSP_P-B Product feature CHAIN FJ386642_HBSP_P-B of FT:mat_peptide FJ386642_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386648_HBSP_P-B Product feature CHAIN FJ386648_HBSP_P-B of FT:mat_peptide FJ386648_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGILNEHQLPARDPAKPARLLLKEPLCFPLVAVQNLRT
ETALVFPSHHLGLSQDTYGSGPQSVSLRSIY
>gnl|hbvpro|FJ386654_HBSP_P-B Product feature CHAIN FJ386654_HBSP_P-B of FT:mat_peptide FJ386654_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPGHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386655_HBSP_P-B Product feature CHAIN FJ386655_HBSP_P-B of FT:mat_peptide FJ386655_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|FJ386656_HBSP_P-B Product feature CHAIN FJ386656_HBSP_P-B of FT:mat_peptide FJ386656_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRRQRAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386658_HBSP_P-B Product feature CHAIN FJ386658_HBSP_P-B of FT:mat_peptide FJ386658_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386660_HBSP_P-B Product feature CHAIN FJ386660_HBSP_P-B of FT:mat_peptide FJ386660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386666_HBSP_P-B Product feature CHAIN FJ386666_HBSP_P-B of FT:mat_peptide FJ386666_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLYFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386668_HBSP_P-B Product feature CHAIN FJ386668_HBSP_P-B of FT:mat_peptide FJ386668_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386669_HBSP_P-B Product feature CHAIN FJ386669_HBSP_P-B of FT:mat_peptide FJ386669_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386675_HBSP_P-B Product feature CHAIN FJ386675_HBSP_P-B of FT:mat_peptide FJ386675_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|FJ386676_HBSP_P-B Product feature CHAIN FJ386676_HBSP_P-B of FT:mat_peptide FJ386676_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386681_HBSP_P-B Product feature CHAIN FJ386681_HBSP_P-B of FT:mat_peptide FJ386681_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386682_HBSP_P-B Product feature CHAIN FJ386682_HBSP_P-B of FT:mat_peptide FJ386682_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1416). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386683_HBSP_P-B Product feature CHAIN FJ386683_HBSP_P-B of FT:mat_peptide FJ386683_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386684_HBSP_P-B Product feature CHAIN FJ386684_HBSP_P-B of FT:mat_peptide FJ386684_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ386688_HBSP_P-B Product feature CHAIN FJ386688_HBSP_P-B of FT:mat_peptide FJ386688_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ518811_HBSP_P-B Product feature CHAIN FJ518811_HBSP_P-B of FT:mat_peptide FJ518811_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLRLSQNTYGSGPQSVSLDSVY
>gnl|hbvpro|FJ518812_HBSP_P-B Product feature CHAIN FJ518812_HBSP_P-B of FT:mat_peptide FJ518812_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLVSVY
>gnl|hbvpro|FJ562219_HBSP_P-B Product feature CHAIN FJ562219_HBSP_P-B of FT:mat_peptide FJ562219_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLRFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562222_HBSP_P-B Product feature CHAIN FJ562222_HBSP_P-B of FT:mat_peptide FJ562222_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I14). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562224_HBSP_P-B Product feature CHAIN FJ562224_HBSP_P-B of FT:mat_peptide FJ562224_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|FJ562231_HBSP_P-B Product feature CHAIN FJ562231_HBSP_P-B of FT:mat_peptide FJ562231_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562234_HBSP_P-B Product feature CHAIN FJ562234_HBSP_P-B of FT:mat_peptide FJ562234_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562236_HBSP_P-B Product feature CHAIN FJ562236_HBSP_P-B of FT:mat_peptide FJ562236_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562237_HBSP_P-B Product feature CHAIN FJ562237_HBSP_P-B of FT:mat_peptide FJ562237_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562240_HBSP_P-B Product feature CHAIN FJ562240_HBSP_P-B of FT:mat_peptide FJ562240_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRLPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562246_HBSP_P-B Product feature CHAIN FJ562246_HBSP_P-B of FT:mat_peptide FJ562246_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562253_HBSP_P-B Product feature CHAIN FJ562253_HBSP_P-B of FT:mat_peptide FJ562253_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562254_HBSP_P-B Product feature CHAIN FJ562254_HBSP_P-B of FT:mat_peptide FJ562254_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562257_HBSP_P-B Product feature CHAIN FJ562257_HBSP_P-B of FT:mat_peptide FJ562257_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPASDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562259_HBSP_P-B Product feature CHAIN FJ562259_HBSP_P-B of FT:mat_peptide FJ562259_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562260_HBSP_P-B Product feature CHAIN FJ562260_HBSP_P-B of FT:mat_peptide FJ562260_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562262_HBSP_P-B Product feature CHAIN FJ562262_HBSP_P-B of FT:mat_peptide FJ562262_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I111). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562289_HBSP_P-B Product feature CHAIN FJ562289_HBSP_P-B of FT:mat_peptide FJ562289_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562296_HBSP_P-B Product feature CHAIN FJ562296_HBSP_P-B of FT:mat_peptide FJ562296_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPVPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562303_HBSP_P-B Product feature CHAIN FJ562303_HBSP_P-B of FT:mat_peptide FJ562303_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFHHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562311_HBSP_P-B Product feature CHAIN FJ562311_HBSP_P-B of FT:mat_peptide FJ562311_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEGDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562312_HBSP_P-B Product feature CHAIN FJ562312_HBSP_P-B of FT:mat_peptide FJ562312_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAHLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562316_HBSP_P-B Product feature CHAIN FJ562316_HBSP_P-B of FT:mat_peptide FJ562316_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I208). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ562322_HBSP_P-B Product feature CHAIN FJ562322_HBSP_P-B of FT:mat_peptide FJ562322_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ787444_HBSP_P-B Product feature CHAIN FJ787444_HBSP_P-B of FT:mat_peptide FJ787444_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ787475_HBSP_P-B Product feature CHAIN FJ787475_HBSP_P-B of FT:mat_peptide FJ787475_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|FJ787476_HBSP_P-B Product feature CHAIN FJ787476_HBSP_P-B of FT:mat_peptide FJ787476_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGCGPQSVSLGSVY
>gnl|hbvpro|FJ787477_HBSP_P-B Product feature CHAIN FJ787477_HBSP_P-B of FT:mat_peptide FJ787477_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899779_HBSP_P-B Product feature CHAIN FJ899779_HBSP_P-B of FT:mat_peptide FJ899779_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPPVAVQNLRT
ETALVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899784_HBSP_P-B Product feature CHAIN FJ899784_HBSP_P-B of FT:mat_peptide FJ899784_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899785_HBSP_P-B Product feature CHAIN FJ899785_HBSP_P-B of FT:mat_peptide FJ899785_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899786_HBSP_P-B Product feature CHAIN FJ899786_HBSP_P-B of FT:mat_peptide FJ899786_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899787_HBSP_P-B Product feature CHAIN FJ899787_HBSP_P-B of FT:mat_peptide FJ899787_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLSLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ899790_HBSP_P-B Product feature CHAIN FJ899790_HBSP_P-B of FT:mat_peptide FJ899790_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVH
>gnl|hbvpro|FJ899791_HBSP_P-B Product feature CHAIN FJ899791_HBSP_P-B of FT:mat_peptide FJ899791_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVH
>gnl|hbvpro|GQ358136_HBSP_P-B Product feature CHAIN GQ358136_HBSP_P-B of FT:mat_peptide GQ358136_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHPPPAPDHAKPARLLLKEPLCSPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358137_HBSP_P-B Product feature CHAIN GQ358137_HBSP_P-B of FT:mat_peptide GQ358137_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGINRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358138_HBSP_P-B Product feature CHAIN GQ358138_HBSP_P-B of FT:mat_peptide GQ358138_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358139_HBSP_P-B Product feature CHAIN GQ358139_HBSP_P-B of FT:mat_peptide GQ358139_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT032). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDFNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358140_HBSP_P-B Product feature CHAIN GQ358140_HBSP_P-B of FT:mat_peptide GQ358140_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358141_HBSP_P-B Product feature CHAIN GQ358141_HBSP_P-B of FT:mat_peptide GQ358141_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ358142_HBSP_P-B Product feature CHAIN GQ358142_HBSP_P-B of FT:mat_peptide GQ358142_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYRHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHPPPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358143_HBSP_P-B Product feature CHAIN GQ358143_HBSP_P-B of FT:mat_peptide GQ358143_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358145_HBSP_P-B Product feature CHAIN GQ358145_HBSP_P-B of FT:mat_peptide GQ358145_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358146_HBSP_P-B Product feature CHAIN GQ358146_HBSP_P-B of FT:mat_peptide GQ358146_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358147_HBSP_P-B Product feature CHAIN GQ358147_HBSP_P-B of FT:mat_peptide GQ358147_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRLVAEDLNLGNLNDHQPPAPDHAEPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358148_HBSP_P-B Product feature CHAIN GQ358148_HBSP_P-B of FT:mat_peptide GQ358148_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLFYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358149_HBSP_P-B Product feature CHAIN GQ358149_HBSP_P-B of FT:mat_peptide GQ358149_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358150_HBSP_P-B Product feature CHAIN GQ358150_HBSP_P-B of FT:mat_peptide GQ358150_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358151_HBSP_P-B Product feature CHAIN GQ358151_HBSP_P-B of FT:mat_peptide GQ358151_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ358152_HBSP_P-B Product feature CHAIN GQ358152_HBSP_P-B of FT:mat_peptide GQ358152_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377519_HBSP_P-B Product feature CHAIN GQ377519_HBSP_P-B of FT:mat_peptide GQ377519_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377525_HBSP_P-B Product feature CHAIN GQ377525_HBSP_P-B of FT:mat_peptide GQ377525_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377537_HBSP_P-B Product feature CHAIN GQ377537_HBSP_P-B of FT:mat_peptide GQ377537_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377542_HBSP_P-B Product feature CHAIN GQ377542_HBSP_P-B of FT:mat_peptide GQ377542_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377547_HBSP_P-B Product feature CHAIN GQ377547_HBSP_P-B of FT:mat_peptide GQ377547_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377550_HBSP_P-B Product feature CHAIN GQ377550_HBSP_P-B of FT:mat_peptide GQ377550_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J81). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377558_HBSP_P-B Product feature CHAIN GQ377558_HBSP_P-B of FT:mat_peptide GQ377558_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377561_HBSP_P-B Product feature CHAIN GQ377561_HBSP_P-B of FT:mat_peptide GQ377561_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377566_HBSP_P-B Product feature CHAIN GQ377566_HBSP_P-B of FT:mat_peptide GQ377566_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377567_HBSP_P-B Product feature CHAIN GQ377567_HBSP_P-B of FT:mat_peptide GQ377567_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J102). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPPPDHAKPAQFLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQDTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377568_HBSP_P-B Product feature CHAIN GQ377568_HBSP_P-B of FT:mat_peptide GQ377568_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377569_HBSP_P-B Product feature CHAIN GQ377569_HBSP_P-B of FT:mat_peptide GQ377569_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377582_HBSP_P-B Product feature CHAIN GQ377582_HBSP_P-B of FT:mat_peptide GQ377582_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377587_HBSP_P-B Product feature CHAIN GQ377587_HBSP_P-B of FT:mat_peptide GQ377587_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|GQ377588_HBSP_P-B Product feature CHAIN GQ377588_HBSP_P-B of FT:mat_peptide GQ377588_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377606_HBSP_P-B Product feature CHAIN GQ377606_HBSP_P-B of FT:mat_peptide GQ377606_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377610_HBSP_P-B Product feature CHAIN GQ377610_HBSP_P-B of FT:mat_peptide GQ377610_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377612_HBSP_P-B Product feature CHAIN GQ377612_HBSP_P-B of FT:mat_peptide GQ377612_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377622_HBSP_P-B Product feature CHAIN GQ377622_HBSP_P-B of FT:mat_peptide GQ377622_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377625_HBSP_P-B Product feature CHAIN GQ377625_HBSP_P-B of FT:mat_peptide GQ377625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAKDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377629_HBSP_P-B Product feature CHAIN GQ377629_HBSP_P-B of FT:mat_peptide GQ377629_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPGHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377638_HBSP_P-B Product feature CHAIN GQ377638_HBSP_P-B of FT:mat_peptide GQ377638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377639_HBSP_P-B Product feature CHAIN GQ377639_HBSP_P-B of FT:mat_peptide GQ377639_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377641_HBSP_P-B Product feature CHAIN GQ377641_HBSP_P-B of FT:mat_peptide GQ377641_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377643_HBSP_P-B Product feature CHAIN GQ377643_HBSP_P-B of FT:mat_peptide GQ377643_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ377644_HBSP_P-B Product feature CHAIN GQ377644_HBSP_P-B of FT:mat_peptide GQ377644_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELHHLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSWPQPVSLGSVH
>gnl|hbvpro|GQ475340_HBSP_P-B Product feature CHAIN GQ475340_HBSP_P-B of FT:mat_peptide GQ475340_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924603_HBSP_P-B Product feature CHAIN GQ924603_HBSP_P-B of FT:mat_peptide GQ924603_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924605_HBSP_P-B Product feature CHAIN GQ924605_HBSP_P-B of FT:mat_peptide GQ924605_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPXLAXEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924607_HBSP_P-B Product feature CHAIN GQ924607_HBSP_P-B of FT:mat_peptide GQ924607_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNGRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924608_HBSP_P-B Product feature CHAIN GQ924608_HBSP_P-B of FT:mat_peptide GQ924608_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924610_HBSP_P-B Product feature CHAIN GQ924610_HBSP_P-B of FT:mat_peptide GQ924610_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924611_HBSP_P-B Product feature CHAIN GQ924611_HBSP_P-B of FT:mat_peptide GQ924611_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924617_HBSP_P-B Product feature CHAIN GQ924617_HBSP_P-B of FT:mat_peptide GQ924617_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDHQPPAPDHAKPARRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924621_HBSP_P-B Product feature CHAIN GQ924621_HBSP_P-B of FT:mat_peptide GQ924621_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924624_HBSP_P-B Product feature CHAIN GQ924624_HBSP_P-B of FT:mat_peptide GQ924624_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPLFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924625_HBSP_P-B Product feature CHAIN GQ924625_HBSP_P-B of FT:mat_peptide GQ924625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924626_HBSP_P-B Product feature CHAIN GQ924626_HBSP_P-B of FT:mat_peptide GQ924626_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPEHAEHARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924627_HBSP_P-B Product feature CHAIN GQ924627_HBSP_P-B of FT:mat_peptide GQ924627_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924628_HBSP_P-B Product feature CHAIN GQ924628_HBSP_P-B of FT:mat_peptide GQ924628_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924630_HBSP_P-B Product feature CHAIN GQ924630_HBSP_P-B of FT:mat_peptide GQ924630_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924631_HBSP_P-B Product feature CHAIN GQ924631_HBSP_P-B of FT:mat_peptide GQ924631_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924632_HBSP_P-B Product feature CHAIN GQ924632_HBSP_P-B of FT:mat_peptide GQ924632_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924634_HBSP_P-B Product feature CHAIN GQ924634_HBSP_P-B of FT:mat_peptide GQ924634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPGHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924635_HBSP_P-B Product feature CHAIN GQ924635_HBSP_P-B of FT:mat_peptide GQ924635_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDFNVGNVNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924637_HBSP_P-B Product feature CHAIN GQ924637_HBSP_P-B of FT:mat_peptide GQ924637_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDPAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924638_HBSP_P-B Product feature CHAIN GQ924638_HBSP_P-B of FT:mat_peptide GQ924638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLEDEAGPLEEELPRVADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSFGSVY
>gnl|hbvpro|GQ924639_HBSP_P-B Product feature CHAIN GQ924639_HBSP_P-B of FT:mat_peptide GQ924639_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRVADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSFGSVY
>gnl|hbvpro|GQ924640_HBSP_P-B Product feature CHAIN GQ924640_HBSP_P-B of FT:mat_peptide GQ924640_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924644_HBSP_P-B Product feature CHAIN GQ924644_HBSP_P-B of FT:mat_peptide GQ924644_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M79). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924645_HBSP_P-B Product feature CHAIN GQ924645_HBSP_P-B of FT:mat_peptide GQ924645_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHPPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924646_HBSP_P-B Product feature CHAIN GQ924646_HBSP_P-B of FT:mat_peptide GQ924646_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARHLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924647_HBSP_P-B Product feature CHAIN GQ924647_HBSP_P-B of FT:mat_peptide GQ924647_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924648_HBSP_P-B Product feature CHAIN GQ924648_HBSP_P-B of FT:mat_peptide GQ924648_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924651_HBSP_P-B Product feature CHAIN GQ924651_HBSP_P-B of FT:mat_peptide GQ924651_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924653_HBSP_P-B Product feature CHAIN GQ924653_HBSP_P-B of FT:mat_peptide GQ924653_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924654_HBSP_P-B Product feature CHAIN GQ924654_HBSP_P-B of FT:mat_peptide GQ924654_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924656_HBSP_P-B Product feature CHAIN GQ924656_HBSP_P-B of FT:mat_peptide GQ924656_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ924660_HBSP_P-B Product feature CHAIN GQ924660_HBSP_P-B of FT:mat_peptide GQ924660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M74). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU332695_HBSP_P-B Product feature CHAIN GU332695_HBSP_P-B of FT:mat_peptide GU332695_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMD74). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPEHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|GU434372_HBSP_P-B Product feature CHAIN GU434372_HBSP_P-B of FT:mat_peptide GU434372_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU434373_HBSP_P-B Product feature CHAIN GU434373_HBSP_P-B of FT:mat_peptide GU434373_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU451682_HBSP_P-B Product feature CHAIN GU451682_HBSP_P-B of FT:mat_peptide GU451682_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815548_HBSP_P-B Product feature CHAIN GU815548_HBSP_P-B of FT:mat_peptide GU815548_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815549_HBSP_P-B Product feature CHAIN GU815549_HBSP_P-B of FT:mat_peptide GU815549_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815550_HBSP_P-B Product feature CHAIN GU815550_HBSP_P-B of FT:mat_peptide GU815550_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNPGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815551_HBSP_P-B Product feature CHAIN GU815551_HBSP_P-B of FT:mat_peptide GU815551_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815552_HBSP_P-B Product feature CHAIN GU815552_HBSP_P-B of FT:mat_peptide GU815552_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815553_HBSP_P-B Product feature CHAIN GU815553_HBSP_P-B of FT:mat_peptide GU815553_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815554_HBSP_P-B Product feature CHAIN GU815554_HBSP_P-B of FT:mat_peptide GU815554_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815555_HBSP_P-B Product feature CHAIN GU815555_HBSP_P-B of FT:mat_peptide GU815555_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815556_HBSP_P-B Product feature CHAIN GU815556_HBSP_P-B of FT:mat_peptide GU815556_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815557_HBSP_P-B Product feature CHAIN GU815557_HBSP_P-B of FT:mat_peptide GU815557_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815558_HBSP_P-B Product feature CHAIN GU815558_HBSP_P-B of FT:mat_peptide GU815558_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815559_HBSP_P-B Product feature CHAIN GU815559_HBSP_P-B of FT:mat_peptide GU815559_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815560_HBSP_P-B Product feature CHAIN GU815560_HBSP_P-B of FT:mat_peptide GU815560_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815561_HBSP_P-B Product feature CHAIN GU815561_HBSP_P-B of FT:mat_peptide GU815561_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815562_HBSP_P-B Product feature CHAIN GU815562_HBSP_P-B of FT:mat_peptide GU815562_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815563_HBSP_P-B Product feature CHAIN GU815563_HBSP_P-B of FT:mat_peptide GU815563_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815564_HBSP_P-B Product feature CHAIN GU815564_HBSP_P-B of FT:mat_peptide GU815564_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815565_HBSP_P-B Product feature CHAIN GU815565_HBSP_P-B of FT:mat_peptide GU815565_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815566_HBSP_P-B Product feature CHAIN GU815566_HBSP_P-B of FT:mat_peptide GU815566_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815567_HBSP_P-B Product feature CHAIN GU815567_HBSP_P-B of FT:mat_peptide GU815567_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815568_HBSP_P-B Product feature CHAIN GU815568_HBSP_P-B of FT:mat_peptide GU815568_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815569_HBSP_P-B Product feature CHAIN GU815569_HBSP_P-B of FT:mat_peptide GU815569_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815570_HBSP_P-B Product feature CHAIN GU815570_HBSP_P-B of FT:mat_peptide GU815570_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815571_HBSP_P-B Product feature CHAIN GU815571_HBSP_P-B of FT:mat_peptide GU815571_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GU815572_HBSP_P-B Product feature CHAIN GU815572_HBSP_P-B of FT:mat_peptide GU815572_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815573_HBSP_P-B Product feature CHAIN GU815573_HBSP_P-B of FT:mat_peptide GU815573_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNYPQQPAPDHAKPAQLLLKKPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815574_HBSP_P-B Product feature CHAIN GU815574_HBSP_P-B of FT:mat_peptide GU815574_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHARPAQLLLKEPPCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815575_HBSP_P-B Product feature CHAIN GU815575_HBSP_P-B of FT:mat_peptide GU815575_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815576_HBSP_P-B Product feature CHAIN GU815576_HBSP_P-B of FT:mat_peptide GU815576_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815577_HBSP_P-B Product feature CHAIN GU815577_HBSP_P-B of FT:mat_peptide GU815577_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHARPAQLLLKEPPCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815578_HBSP_P-B Product feature CHAIN GU815578_HBSP_P-B of FT:mat_peptide GU815578_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815579_HBSP_P-B Product feature CHAIN GU815579_HBSP_P-B of FT:mat_peptide GU815579_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815581_HBSP_P-B Product feature CHAIN GU815581_HBSP_P-B of FT:mat_peptide GU815581_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815583_HBSP_P-B Product feature CHAIN GU815583_HBSP_P-B of FT:mat_peptide GU815583_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815584_HBSP_P-B Product feature CHAIN GU815584_HBSP_P-B of FT:mat_peptide GU815584_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815585_HBSP_P-B Product feature CHAIN GU815585_HBSP_P-B of FT:mat_peptide GU815585_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815586_HBSP_P-B Product feature CHAIN GU815586_HBSP_P-B of FT:mat_peptide GU815586_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815587_HBSP_P-B Product feature CHAIN GU815587_HBSP_P-B of FT:mat_peptide GU815587_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815588_HBSP_P-B Product feature CHAIN GU815588_HBSP_P-B of FT:mat_peptide GU815588_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815589_HBSP_P-B Product feature CHAIN GU815589_HBSP_P-B of FT:mat_peptide GU815589_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-8). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815590_HBSP_P-B Product feature CHAIN GU815590_HBSP_P-B of FT:mat_peptide GU815590_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815591_HBSP_P-B Product feature CHAIN GU815591_HBSP_P-B of FT:mat_peptide GU815591_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815593_HBSP_P-B Product feature CHAIN GU815593_HBSP_P-B of FT:mat_peptide GU815593_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815594_HBSP_P-B Product feature CHAIN GU815594_HBSP_P-B of FT:mat_peptide GU815594_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815595_HBSP_P-B Product feature CHAIN GU815595_HBSP_P-B of FT:mat_peptide GU815595_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815596_HBSP_P-B Product feature CHAIN GU815596_HBSP_P-B of FT:mat_peptide GU815596_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815597_HBSP_P-B Product feature CHAIN GU815597_HBSP_P-B of FT:mat_peptide GU815597_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815598_HBSP_P-B Product feature CHAIN GU815598_HBSP_P-B of FT:mat_peptide GU815598_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815599_HBSP_P-B Product feature CHAIN GU815599_HBSP_P-B of FT:mat_peptide GU815599_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815600_HBSP_P-B Product feature CHAIN GU815600_HBSP_P-B of FT:mat_peptide GU815600_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815601_HBSP_P-B Product feature CHAIN GU815601_HBSP_P-B of FT:mat_peptide GU815601_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815602_HBSP_P-B Product feature CHAIN GU815602_HBSP_P-B of FT:mat_peptide GU815602_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815603_HBSP_P-B Product feature CHAIN GU815603_HBSP_P-B of FT:mat_peptide GU815603_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815604_HBSP_P-B Product feature CHAIN GU815604_HBSP_P-B of FT:mat_peptide GU815604_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815605_HBSP_P-B Product feature CHAIN GU815605_HBSP_P-B of FT:mat_peptide GU815605_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815606_HBSP_P-B Product feature CHAIN GU815606_HBSP_P-B of FT:mat_peptide GU815606_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815607_HBSP_P-B Product feature CHAIN GU815607_HBSP_P-B of FT:mat_peptide GU815607_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815608_HBSP_P-B Product feature CHAIN GU815608_HBSP_P-B of FT:mat_peptide GU815608_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815609_HBSP_P-B Product feature CHAIN GU815609_HBSP_P-B of FT:mat_peptide GU815609_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815610_HBSP_P-B Product feature CHAIN GU815610_HBSP_P-B of FT:mat_peptide GU815610_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815611_HBSP_P-B Product feature CHAIN GU815611_HBSP_P-B of FT:mat_peptide GU815611_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815612_HBSP_P-B Product feature CHAIN GU815612_HBSP_P-B of FT:mat_peptide GU815612_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815613_HBSP_P-B Product feature CHAIN GU815613_HBSP_P-B of FT:mat_peptide GU815613_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815614_HBSP_P-B Product feature CHAIN GU815614_HBSP_P-B of FT:mat_peptide GU815614_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815616_HBSP_P-B Product feature CHAIN GU815616_HBSP_P-B of FT:mat_peptide GU815616_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-11). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815617_HBSP_P-B Product feature CHAIN GU815617_HBSP_P-B of FT:mat_peptide GU815617_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815618_HBSP_P-B Product feature CHAIN GU815618_HBSP_P-B of FT:mat_peptide GU815618_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815619_HBSP_P-B Product feature CHAIN GU815619_HBSP_P-B of FT:mat_peptide GU815619_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815620_HBSP_P-B Product feature CHAIN GU815620_HBSP_P-B of FT:mat_peptide GU815620_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815621_HBSP_P-B Product feature CHAIN GU815621_HBSP_P-B of FT:mat_peptide GU815621_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815622_HBSP_P-B Product feature CHAIN GU815622_HBSP_P-B of FT:mat_peptide GU815622_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815623_HBSP_P-B Product feature CHAIN GU815623_HBSP_P-B of FT:mat_peptide GU815623_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815624_HBSP_P-B Product feature CHAIN GU815624_HBSP_P-B of FT:mat_peptide GU815624_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815625_HBSP_P-B Product feature CHAIN GU815625_HBSP_P-B of FT:mat_peptide GU815625_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815626_HBSP_P-B Product feature CHAIN GU815626_HBSP_P-B of FT:mat_peptide GU815626_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815627_HBSP_P-B Product feature CHAIN GU815627_HBSP_P-B of FT:mat_peptide GU815627_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815628_HBSP_P-B Product feature CHAIN GU815628_HBSP_P-B of FT:mat_peptide GU815628_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815629_HBSP_P-B Product feature CHAIN GU815629_HBSP_P-B of FT:mat_peptide GU815629_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815630_HBSP_P-B Product feature CHAIN GU815630_HBSP_P-B of FT:mat_peptide GU815630_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815631_HBSP_P-B Product feature CHAIN GU815631_HBSP_P-B of FT:mat_peptide GU815631_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815632_HBSP_P-B Product feature CHAIN GU815632_HBSP_P-B of FT:mat_peptide GU815632_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815633_HBSP_P-B Product feature CHAIN GU815633_HBSP_P-B of FT:mat_peptide GU815633_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815634_HBSP_P-B Product feature CHAIN GU815634_HBSP_P-B of FT:mat_peptide GU815634_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-10). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815635_HBSP_P-B Product feature CHAIN GU815635_HBSP_P-B of FT:mat_peptide GU815635_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815636_HBSP_P-B Product feature CHAIN GU815636_HBSP_P-B of FT:mat_peptide GU815636_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815637_HBSP_P-B Product feature CHAIN GU815637_HBSP_P-B of FT:mat_peptide GU815637_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815638_HBSP_P-B Product feature CHAIN GU815638_HBSP_P-B of FT:mat_peptide GU815638_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815639_HBSP_P-B Product feature CHAIN GU815639_HBSP_P-B of FT:mat_peptide GU815639_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815640_HBSP_P-B Product feature CHAIN GU815640_HBSP_P-B of FT:mat_peptide GU815640_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815641_HBSP_P-B Product feature CHAIN GU815641_HBSP_P-B of FT:mat_peptide GU815641_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815642_HBSP_P-B Product feature CHAIN GU815642_HBSP_P-B of FT:mat_peptide GU815642_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815643_HBSP_P-B Product feature CHAIN GU815643_HBSP_P-B of FT:mat_peptide GU815643_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815644_HBSP_P-B Product feature CHAIN GU815644_HBSP_P-B of FT:mat_peptide GU815644_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815645_HBSP_P-B Product feature CHAIN GU815645_HBSP_P-B of FT:mat_peptide GU815645_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLEEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815646_HBSP_P-B Product feature CHAIN GU815646_HBSP_P-B of FT:mat_peptide GU815646_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815647_HBSP_P-B Product feature CHAIN GU815647_HBSP_P-B of FT:mat_peptide GU815647_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815648_HBSP_P-B Product feature CHAIN GU815648_HBSP_P-B of FT:mat_peptide GU815648_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815649_HBSP_P-B Product feature CHAIN GU815649_HBSP_P-B of FT:mat_peptide GU815649_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815650_HBSP_P-B Product feature CHAIN GU815650_HBSP_P-B of FT:mat_peptide GU815650_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQRLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815651_HBSP_P-B Product feature CHAIN GU815651_HBSP_P-B of FT:mat_peptide GU815651_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815652_HBSP_P-B Product feature CHAIN GU815652_HBSP_P-B of FT:mat_peptide GU815652_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815653_HBSP_P-B Product feature CHAIN GU815653_HBSP_P-B of FT:mat_peptide GU815653_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815654_HBSP_P-B Product feature CHAIN GU815654_HBSP_P-B of FT:mat_peptide GU815654_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815656_HBSP_P-B Product feature CHAIN GU815656_HBSP_P-B of FT:mat_peptide GU815656_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815657_HBSP_P-B Product feature CHAIN GU815657_HBSP_P-B of FT:mat_peptide GU815657_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815658_HBSP_P-B Product feature CHAIN GU815658_HBSP_P-B of FT:mat_peptide GU815658_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815659_HBSP_P-B Product feature CHAIN GU815659_HBSP_P-B of FT:mat_peptide GU815659_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815660_HBSP_P-B Product feature CHAIN GU815660_HBSP_P-B of FT:mat_peptide GU815660_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815661_HBSP_P-B Product feature CHAIN GU815661_HBSP_P-B of FT:mat_peptide GU815661_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815662_HBSP_P-B Product feature CHAIN GU815662_HBSP_P-B of FT:mat_peptide GU815662_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLDRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815663_HBSP_P-B Product feature CHAIN GU815663_HBSP_P-B of FT:mat_peptide GU815663_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815664_HBSP_P-B Product feature CHAIN GU815664_HBSP_P-B of FT:mat_peptide GU815664_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815665_HBSP_P-B Product feature CHAIN GU815665_HBSP_P-B of FT:mat_peptide GU815665_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815666_HBSP_P-B Product feature CHAIN GU815666_HBSP_P-B of FT:mat_peptide GU815666_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815667_HBSP_P-B Product feature CHAIN GU815667_HBSP_P-B of FT:mat_peptide GU815667_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815668_HBSP_P-B Product feature CHAIN GU815668_HBSP_P-B of FT:mat_peptide GU815668_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815669_HBSP_P-B Product feature CHAIN GU815669_HBSP_P-B of FT:mat_peptide GU815669_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815670_HBSP_P-B Product feature CHAIN GU815670_HBSP_P-B of FT:mat_peptide GU815670_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815672_HBSP_P-B Product feature CHAIN GU815672_HBSP_P-B of FT:mat_peptide GU815672_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815673_HBSP_P-B Product feature CHAIN GU815673_HBSP_P-B of FT:mat_peptide GU815673_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLGEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815674_HBSP_P-B Product feature CHAIN GU815674_HBSP_P-B of FT:mat_peptide GU815674_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815675_HBSP_P-B Product feature CHAIN GU815675_HBSP_P-B of FT:mat_peptide GU815675_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815676_HBSP_P-B Product feature CHAIN GU815676_HBSP_P-B of FT:mat_peptide GU815676_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815677_HBSP_P-B Product feature CHAIN GU815677_HBSP_P-B of FT:mat_peptide GU815677_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815678_HBSP_P-B Product feature CHAIN GU815678_HBSP_P-B of FT:mat_peptide GU815678_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815679_HBSP_P-B Product feature CHAIN GU815679_HBSP_P-B of FT:mat_peptide GU815679_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815680_HBSP_P-B Product feature CHAIN GU815680_HBSP_P-B of FT:mat_peptide GU815680_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815681_HBSP_P-B Product feature CHAIN GU815681_HBSP_P-B of FT:mat_peptide GU815681_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815683_HBSP_P-B Product feature CHAIN GU815683_HBSP_P-B of FT:mat_peptide GU815683_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815684_HBSP_P-B Product feature CHAIN GU815684_HBSP_P-B of FT:mat_peptide GU815684_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815685_HBSP_P-B Product feature CHAIN GU815685_HBSP_P-B of FT:mat_peptide GU815685_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815686_HBSP_P-B Product feature CHAIN GU815686_HBSP_P-B of FT:mat_peptide GU815686_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815687_HBSP_P-B Product feature CHAIN GU815687_HBSP_P-B of FT:mat_peptide GU815687_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815688_HBSP_P-B Product feature CHAIN GU815688_HBSP_P-B of FT:mat_peptide GU815688_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815689_HBSP_P-B Product feature CHAIN GU815689_HBSP_P-B of FT:mat_peptide GU815689_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815691_HBSP_P-B Product feature CHAIN GU815691_HBSP_P-B of FT:mat_peptide GU815691_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815692_HBSP_P-B Product feature CHAIN GU815692_HBSP_P-B of FT:mat_peptide GU815692_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815693_HBSP_P-B Product feature CHAIN GU815693_HBSP_P-B of FT:mat_peptide GU815693_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815694_HBSP_P-B Product feature CHAIN GU815694_HBSP_P-B of FT:mat_peptide GU815694_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815695_HBSP_P-B Product feature CHAIN GU815695_HBSP_P-B of FT:mat_peptide GU815695_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815696_HBSP_P-B Product feature CHAIN GU815696_HBSP_P-B of FT:mat_peptide GU815696_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815697_HBSP_P-B Product feature CHAIN GU815697_HBSP_P-B of FT:mat_peptide GU815697_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815698_HBSP_P-B Product feature CHAIN GU815698_HBSP_P-B of FT:mat_peptide GU815698_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815699_HBSP_P-B Product feature CHAIN GU815699_HBSP_P-B of FT:mat_peptide GU815699_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815700_HBSP_P-B Product feature CHAIN GU815700_HBSP_P-B of FT:mat_peptide GU815700_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815701_HBSP_P-B Product feature CHAIN GU815701_HBSP_P-B of FT:mat_peptide GU815701_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815702_HBSP_P-B Product feature CHAIN GU815702_HBSP_P-B of FT:mat_peptide GU815702_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815703_HBSP_P-B Product feature CHAIN GU815703_HBSP_P-B of FT:mat_peptide GU815703_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815704_HBSP_P-B Product feature CHAIN GU815704_HBSP_P-B of FT:mat_peptide GU815704_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815705_HBSP_P-B Product feature CHAIN GU815705_HBSP_P-B of FT:mat_peptide GU815705_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815706_HBSP_P-B Product feature CHAIN GU815706_HBSP_P-B of FT:mat_peptide GU815706_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815707_HBSP_P-B Product feature CHAIN GU815707_HBSP_P-B of FT:mat_peptide GU815707_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815708_HBSP_P-B Product feature CHAIN GU815708_HBSP_P-B of FT:mat_peptide GU815708_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815709_HBSP_P-B Product feature CHAIN GU815709_HBSP_P-B of FT:mat_peptide GU815709_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815710_HBSP_P-B Product feature CHAIN GU815710_HBSP_P-B of FT:mat_peptide GU815710_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815711_HBSP_P-B Product feature CHAIN GU815711_HBSP_P-B of FT:mat_peptide GU815711_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815712_HBSP_P-B Product feature CHAIN GU815712_HBSP_P-B of FT:mat_peptide GU815712_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=111 residues).
IPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815713_HBSP_P-B Product feature CHAIN GU815713_HBSP_P-B of FT:mat_peptide GU815713_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815715_HBSP_P-B Product feature CHAIN GU815715_HBSP_P-B of FT:mat_peptide GU815715_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815716_HBSP_P-B Product feature CHAIN GU815716_HBSP_P-B of FT:mat_peptide GU815716_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815717_HBSP_P-B Product feature CHAIN GU815717_HBSP_P-B of FT:mat_peptide GU815717_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815718_HBSP_P-B Product feature CHAIN GU815718_HBSP_P-B of FT:mat_peptide GU815718_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815719_HBSP_P-B Product feature CHAIN GU815719_HBSP_P-B of FT:mat_peptide GU815719_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815720_HBSP_P-B Product feature CHAIN GU815720_HBSP_P-B of FT:mat_peptide GU815720_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHAAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815721_HBSP_P-B Product feature CHAIN GU815721_HBSP_P-B of FT:mat_peptide GU815721_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815722_HBSP_P-B Product feature CHAIN GU815722_HBSP_P-B of FT:mat_peptide GU815722_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815723_HBSP_P-B Product feature CHAIN GU815723_HBSP_P-B of FT:mat_peptide GU815723_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNNHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815724_HBSP_P-B Product feature CHAIN GU815724_HBSP_P-B of FT:mat_peptide GU815724_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815725_HBSP_P-B Product feature CHAIN GU815725_HBSP_P-B of FT:mat_peptide GU815725_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815726_HBSP_P-B Product feature CHAIN GU815726_HBSP_P-B of FT:mat_peptide GU815726_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815727_HBSP_P-B Product feature CHAIN GU815727_HBSP_P-B of FT:mat_peptide GU815727_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGNGPQSVSLGSVY
>gnl|hbvpro|GU815728_HBSP_P-B Product feature CHAIN GU815728_HBSP_P-B of FT:mat_peptide GU815728_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815729_HBSP_P-B Product feature CHAIN GU815729_HBSP_P-B of FT:mat_peptide GU815729_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815730_HBSP_P-B Product feature CHAIN GU815730_HBSP_P-B of FT:mat_peptide GU815730_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815731_HBSP_P-B Product feature CHAIN GU815731_HBSP_P-B of FT:mat_peptide GU815731_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815732_HBSP_P-B Product feature CHAIN GU815732_HBSP_P-B of FT:mat_peptide GU815732_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815733_HBSP_P-B Product feature CHAIN GU815733_HBSP_P-B of FT:mat_peptide GU815733_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815734_HBSP_P-B Product feature CHAIN GU815734_HBSP_P-B of FT:mat_peptide GU815734_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815735_HBSP_P-B Product feature CHAIN GU815735_HBSP_P-B of FT:mat_peptide GU815735_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815736_HBSP_P-B Product feature CHAIN GU815736_HBSP_P-B of FT:mat_peptide GU815736_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815737_HBSP_P-B Product feature CHAIN GU815737_HBSP_P-B of FT:mat_peptide GU815737_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815738_HBSP_P-B Product feature CHAIN GU815738_HBSP_P-B of FT:mat_peptide GU815738_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815739_HBSP_P-B Product feature CHAIN GU815739_HBSP_P-B of FT:mat_peptide GU815739_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815740_HBSP_P-B Product feature CHAIN GU815740_HBSP_P-B of FT:mat_peptide GU815740_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815741_HBSP_P-B Product feature CHAIN GU815741_HBSP_P-B of FT:mat_peptide GU815741_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLRLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815742_HBSP_P-B Product feature CHAIN GU815742_HBSP_P-B of FT:mat_peptide GU815742_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815744_HBSP_P-B Product feature CHAIN GU815744_HBSP_P-B of FT:mat_peptide GU815744_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815745_HBSP_P-B Product feature CHAIN GU815745_HBSP_P-B of FT:mat_peptide GU815745_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815746_HBSP_P-B Product feature CHAIN GU815746_HBSP_P-B of FT:mat_peptide GU815746_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLTEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815747_HBSP_P-B Product feature CHAIN GU815747_HBSP_P-B of FT:mat_peptide GU815747_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815748_HBSP_P-B Product feature CHAIN GU815748_HBSP_P-B of FT:mat_peptide GU815748_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815749_HBSP_P-B Product feature CHAIN GU815749_HBSP_P-B of FT:mat_peptide GU815749_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815750_HBSP_P-B Product feature CHAIN GU815750_HBSP_P-B of FT:mat_peptide GU815750_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815751_HBSP_P-B Product feature CHAIN GU815751_HBSP_P-B of FT:mat_peptide GU815751_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815752_HBSP_P-B Product feature CHAIN GU815752_HBSP_P-B of FT:mat_peptide GU815752_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815753_HBSP_P-B Product feature CHAIN GU815753_HBSP_P-B of FT:mat_peptide GU815753_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815754_HBSP_P-B Product feature CHAIN GU815754_HBSP_P-B of FT:mat_peptide GU815754_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815755_HBSP_P-B Product feature CHAIN GU815755_HBSP_P-B of FT:mat_peptide GU815755_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815756_HBSP_P-B Product feature CHAIN GU815756_HBSP_P-B of FT:mat_peptide GU815756_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|GU815757_HBSP_P-B Product feature CHAIN GU815757_HBSP_P-B of FT:mat_peptide GU815757_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815759_HBSP_P-B Product feature CHAIN GU815759_HBSP_P-B of FT:mat_peptide GU815759_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815760_HBSP_P-B Product feature CHAIN GU815760_HBSP_P-B of FT:mat_peptide GU815760_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFLHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815761_HBSP_P-B Product feature CHAIN GU815761_HBSP_P-B of FT:mat_peptide GU815761_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815762_HBSP_P-B Product feature CHAIN GU815762_HBSP_P-B of FT:mat_peptide GU815762_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815764_HBSP_P-B Product feature CHAIN GU815764_HBSP_P-B of FT:mat_peptide GU815764_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815765_HBSP_P-B Product feature CHAIN GU815765_HBSP_P-B of FT:mat_peptide GU815765_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815766_HBSP_P-B Product feature CHAIN GU815766_HBSP_P-B of FT:mat_peptide GU815766_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815767_HBSP_P-B Product feature CHAIN GU815767_HBSP_P-B of FT:mat_peptide GU815767_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815768_HBSP_P-B Product feature CHAIN GU815768_HBSP_P-B of FT:mat_peptide GU815768_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815769_HBSP_P-B Product feature CHAIN GU815769_HBSP_P-B of FT:mat_peptide GU815769_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815770_HBSP_P-B Product feature CHAIN GU815770_HBSP_P-B of FT:mat_peptide GU815770_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815771_HBSP_P-B Product feature CHAIN GU815771_HBSP_P-B of FT:mat_peptide GU815771_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815772_HBSP_P-B Product feature CHAIN GU815772_HBSP_P-B of FT:mat_peptide GU815772_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGSQSVSLGSVY
>gnl|hbvpro|GU815773_HBSP_P-B Product feature CHAIN GU815773_HBSP_P-B of FT:mat_peptide GU815773_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815774_HBSP_P-B Product feature CHAIN GU815774_HBSP_P-B of FT:mat_peptide GU815774_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKESLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815775_HBSP_P-B Product feature CHAIN GU815775_HBSP_P-B of FT:mat_peptide GU815775_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815776_HBSP_P-B Product feature CHAIN GU815776_HBSP_P-B of FT:mat_peptide GU815776_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815777_HBSP_P-B Product feature CHAIN GU815777_HBSP_P-B of FT:mat_peptide GU815777_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815778_HBSP_P-B Product feature CHAIN GU815778_HBSP_P-B of FT:mat_peptide GU815778_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815779_HBSP_P-B Product feature CHAIN GU815779_HBSP_P-B of FT:mat_peptide GU815779_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815780_HBSP_P-B Product feature CHAIN GU815780_HBSP_P-B of FT:mat_peptide GU815780_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815781_HBSP_P-B Product feature CHAIN GU815781_HBSP_P-B of FT:mat_peptide GU815781_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815782_HBSP_P-B Product feature CHAIN GU815782_HBSP_P-B of FT:mat_peptide GU815782_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU815783_HBSP_P-B Product feature CHAIN GU815783_HBSP_P-B of FT:mat_peptide GU815783_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011466_HBSP_P-B Product feature CHAIN HM011466_HBSP_P-B of FT:mat_peptide HM011466_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQQARDHARPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011467_HBSP_P-B Product feature CHAIN HM011467_HBSP_P-B of FT:mat_peptide HM011467_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=110 residues).
MPLSYQHFRKLLLLEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTE
TAPVFPSHHLGXSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|HM011469_HBSP_P-B Product feature CHAIN HM011469_HBSP_P-B of FT:mat_peptide HM011469_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011470_HBSP_P-B Product feature CHAIN HM011470_HBSP_P-B of FT:mat_peptide HM011470_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKETLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011471_HBSP_P-B Product feature CHAIN HM011471_HBSP_P-B of FT:mat_peptide HM011471_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAPLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011473_HBSP_P-B Product feature CHAIN HM011473_HBSP_P-B of FT:mat_peptide HM011473_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVXNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011474_HBSP_P-B Product feature CHAIN HM011474_HBSP_P-B of FT:mat_peptide HM011474_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAXDLXLGNXNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011475_HBSP_P-B Product feature CHAIN HM011475_HBSP_P-B of FT:mat_peptide HM011475_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKXLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011476_HBSP_P-B Product feature CHAIN HM011476_HBSP_P-B of FT:mat_peptide HM011476_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKXARLLLKEPLCFPHVAVQNLRT
EXAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011478_HBSP_P-B Product feature CHAIN HM011478_HBSP_P-B of FT:mat_peptide HM011478_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSCQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAXDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHXLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011480_HBSP_P-B Product feature CHAIN HM011480_HBSP_P-B of FT:mat_peptide HM011480_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011482_HBSP_P-B Product feature CHAIN HM011482_HBSP_P-B of FT:mat_peptide HM011482_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011483_HBSP_P-B Product feature CHAIN HM011483_HBSP_P-B of FT:mat_peptide HM011483_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011484_HBSP_P-B Product feature CHAIN HM011484_HBSP_P-B of FT:mat_peptide HM011484_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011487_HBSP_P-B Product feature CHAIN HM011487_HBSP_P-B of FT:mat_peptide HM011487_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDDAAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLXETLRFPHVAVQNLRT
QTAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011490_HBSP_P-B Product feature CHAIN HM011490_HBSP_P-B of FT:mat_peptide HM011490_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011492_HBSP_P-B Product feature CHAIN HM011492_HBSP_P-B of FT:mat_peptide HM011492_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|HM011494_HBSP_P-B Product feature CHAIN HM011494_HBSP_P-B of FT:mat_peptide HM011494_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAXPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011496_HBSP_P-B Product feature CHAIN HM011496_HBSP_P-B of FT:mat_peptide HM011496_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQPPAXDHAEPARLLLKEPLCFPHVAVQNLRT
ETALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011499_HBSP_P-B Product feature CHAIN HM011499_HBSP_P-B of FT:mat_peptide HM011499_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDBEAGPLEEELPRLADEGLNRRVAEDLNLGBPXDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011503_HBSP_P-B Product feature CHAIN HM011503_HBSP_P-B of FT:mat_peptide HM011503_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLXLDEGAGPLEEELPRLADEGLNRRVAEDLNLGXLNDHQXPAXDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011504_HBSP_P-B Product feature CHAIN HM011504_HBSP_P-B of FT:mat_peptide HM011504_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLVLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|HQ700546_HBSP_P-B Product feature CHAIN HQ700546_HBSP_P-B of FT:mat_peptide HQ700546_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HQ700548_HBSP_P-B Product feature CHAIN HQ700548_HBSP_P-B of FT:mat_peptide HQ700548_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|HQ700549_HBSP_P-B Product feature CHAIN HQ700549_HBSP_P-B of FT:mat_peptide HQ700549_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF412801_HBSP_P-B Product feature CHAIN JF412801_HBSP_P-B of FT:mat_peptide JF412801_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF899335_HBSP_P-B Product feature CHAIN JF899335_HBSP_P-B of FT:mat_peptide JF899335_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN406371_HBSP_P-B Product feature CHAIN JN406371_HBSP_P-B of FT:mat_peptide JN406371_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792893_HBSP_P-B Product feature CHAIN JN792893_HBSP_P-B of FT:mat_peptide JN792893_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2004). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNDHQPPAPDHAKLARLLLKEPLCFPHVVVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792894_HBSP_P-B Product feature CHAIN JN792894_HBSP_P-B of FT:mat_peptide JN792894_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARLARLLLKEPLCFPHVVVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792895_HBSP_P-B Product feature CHAIN JN792895_HBSP_P-B of FT:mat_peptide JN792895_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792896_HBSP_P-B Product feature CHAIN JN792896_HBSP_P-B of FT:mat_peptide JN792896_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792897_HBSP_P-B Product feature CHAIN JN792897_HBSP_P-B of FT:mat_peptide JN792897_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792898_HBSP_P-B Product feature CHAIN JN792898_HBSP_P-B of FT:mat_peptide JN792898_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792899_HBSP_P-B Product feature CHAIN JN792899_HBSP_P-B of FT:mat_peptide JN792899_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792900_HBSP_P-B Product feature CHAIN JN792900_HBSP_P-B of FT:mat_peptide JN792900_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQPPAPDHARPARLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLPQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN792901_HBSP_P-B Product feature CHAIN JN792901_HBSP_P-B of FT:mat_peptide JN792901_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNLRVAEDLTLGNPNDHQPPAPDHARPARLLLKTALRFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JN792902_HBSP_P-B Product feature CHAIN JN792902_HBSP_P-B of FT:mat_peptide JN792902_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2004). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNLRVAEDLTLGNPNDHQPPAPXHARPARLLLKATLRFPHVAVQNLRT
EIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JN827419_HBSP_P-B Product feature CHAIN JN827419_HBSP_P-B of FT:mat_peptide JN827419_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPAQLLLKGPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ027311_HBSP_P-B Product feature CHAIN JQ027311_HBSP_P-B of FT:mat_peptide JQ027311_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEXGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLXQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027312_HBSP_P-B Product feature CHAIN JQ027312_HBSP_P-B of FT:mat_peptide JQ027312_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAXPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027313_HBSP_P-B Product feature CHAIN JQ027313_HBSP_P-B of FT:mat_peptide JQ027313_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADDDLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLXFPHVAVQNLRT
ETAPVFPSHXLGLXQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027315_HBSP_P-B Product feature CHAIN JQ027315_HBSP_P-B of FT:mat_peptide JQ027315_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027316_HBSP_P-B Product feature CHAIN JQ027316_HBSP_P-B of FT:mat_peptide JQ027316_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027325_HBSP_P-B Product feature CHAIN JQ027325_HBSP_P-B of FT:mat_peptide JQ027325_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLTEPLCFPHVAVRNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027329_HBSP_P-B Product feature CHAIN JQ027329_HBSP_P-B of FT:mat_peptide JQ027329_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQQPAPDHAKPAQLLLXXPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027330_HBSP_P-B Product feature CHAIN JQ027330_HBSP_P-B of FT:mat_peptide JQ027330_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKATLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027331_HBSP_P-B Product feature CHAIN JQ027331_HBSP_P-B of FT:mat_peptide JQ027331_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQQPAPDHAKPAQLLLKATLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ027334_HBSP_P-B Product feature CHAIN JQ027334_HBSP_P-B of FT:mat_peptide JQ027334_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040125_HBSP_P-B Product feature CHAIN JQ040125_HBSP_P-B of FT:mat_peptide JQ040125_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRIAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040128_HBSP_P-B Product feature CHAIN JQ040128_HBSP_P-B of FT:mat_peptide JQ040128_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040138_HBSP_P-B Product feature CHAIN JQ040138_HBSP_P-B of FT:mat_peptide JQ040138_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 240). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040147_HBSP_P-B Product feature CHAIN JQ040147_HBSP_P-B of FT:mat_peptide JQ040147_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 280). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVPNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040157_HBSP_P-B Product feature CHAIN JQ040157_HBSP_P-B of FT:mat_peptide JQ040157_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNXHQLPARDHARPARFLLKAPLCFXHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040169_HBSP_P-B Product feature CHAIN JQ040169_HBSP_P-B of FT:mat_peptide JQ040169_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G237). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040170_HBSP_P-B Product feature CHAIN JQ040170_HBSP_P-B of FT:mat_peptide JQ040170_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQXTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040171_HBSP_P-B Product feature CHAIN JQ040171_HBSP_P-B of FT:mat_peptide JQ040171_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ040173_HBSP_P-B Product feature CHAIN JQ040173_HBSP_P-B of FT:mat_peptide JQ040173_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341549_HBSP_P-B Product feature CHAIN JQ341549_HBSP_P-B of FT:mat_peptide JQ341549_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341550_HBSP_P-B Product feature CHAIN JQ341550_HBSP_P-B of FT:mat_peptide JQ341550_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341551_HBSP_P-B Product feature CHAIN JQ341551_HBSP_P-B of FT:mat_peptide JQ341551_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEXLXFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGXGPQSVSLGSVY
>gnl|hbvpro|JQ341552_HBSP_P-B Product feature CHAIN JQ341552_HBSP_P-B of FT:mat_peptide JQ341552_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHAAVQNLRM
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341553_HBSP_P-B Product feature CHAIN JQ341553_HBSP_P-B of FT:mat_peptide JQ341553_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLXFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341554_HBSP_P-B Product feature CHAIN JQ341554_HBSP_P-B of FT:mat_peptide JQ341554_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno06). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLXLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341555_HBSP_P-B Product feature CHAIN JQ341555_HBSP_P-B of FT:mat_peptide JQ341555_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKHAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341556_HBSP_P-B Product feature CHAIN JQ341556_HBSP_P-B of FT:mat_peptide JQ341556_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno08). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQXPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341557_HBSP_P-B Product feature CHAIN JQ341557_HBSP_P-B of FT:mat_peptide JQ341557_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno09). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPXHAXPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341558_HBSP_P-B Product feature CHAIN JQ341558_HBSP_P-B of FT:mat_peptide JQ341558_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341559_HBSP_P-B Product feature CHAIN JQ341559_HBSP_P-B of FT:mat_peptide JQ341559_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPAPDHAXPAQLLLKEPLCFPHVAVXNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341560_HBSP_P-B Product feature CHAIN JQ341560_HBSP_P-B of FT:mat_peptide JQ341560_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341561_HBSP_P-B Product feature CHAIN JQ341561_HBSP_P-B of FT:mat_peptide JQ341561_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno13). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQQPARDHAKPARLLLXXPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341562_HBSP_P-B Product feature CHAIN JQ341562_HBSP_P-B of FT:mat_peptide JQ341562_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQYFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341563_HBSP_P-B Product feature CHAIN JQ341563_HBSP_P-B of FT:mat_peptide JQ341563_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341564_HBSP_P-B Product feature CHAIN JQ341564_HBSP_P-B of FT:mat_peptide JQ341564_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341565_HBSP_P-B Product feature CHAIN JQ341565_HBSP_P-B of FT:mat_peptide JQ341565_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno17). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341566_HBSP_P-B Product feature CHAIN JQ341566_HBSP_P-B of FT:mat_peptide JQ341566_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341567_HBSP_P-B Product feature CHAIN JQ341567_HBSP_P-B of FT:mat_peptide JQ341567_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341568_HBSP_P-B Product feature CHAIN JQ341568_HBSP_P-B of FT:mat_peptide JQ341568_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341569_HBSP_P-B Product feature CHAIN JQ341569_HBSP_P-B of FT:mat_peptide JQ341569_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341570_HBSP_P-B Product feature CHAIN JQ341570_HBSP_P-B of FT:mat_peptide JQ341570_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341571_HBSP_P-B Product feature CHAIN JQ341571_HBSP_P-B of FT:mat_peptide JQ341571_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYXHFRKLLLLEDGAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQPPARDHAKPAQLLLKEPLCFPHVAVQNLRM
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341572_HBSP_P-B Product feature CHAIN JQ341572_HBSP_P-B of FT:mat_peptide JQ341572_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLSLGNLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341573_HBSP_P-B Product feature CHAIN JQ341573_HBSP_P-B of FT:mat_peptide JQ341573_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341574_HBSP_P-B Product feature CHAIN JQ341574_HBSP_P-B of FT:mat_peptide JQ341574_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341575_HBSP_P-B Product feature CHAIN JQ341575_HBSP_P-B of FT:mat_peptide JQ341575_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341576_HBSP_P-B Product feature CHAIN JQ341576_HBSP_P-B of FT:mat_peptide JQ341576_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno28). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRILLLDQDAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQQPALDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341577_HBSP_P-B Product feature CHAIN JQ341577_HBSP_P-B of FT:mat_peptide JQ341577_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341578_HBSP_P-B Product feature CHAIN JQ341578_HBSP_P-B of FT:mat_peptide JQ341578_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKLAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341579_HBSP_P-B Product feature CHAIN JQ341579_HBSP_P-B of FT:mat_peptide JQ341579_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKAPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341580_HBSP_P-B Product feature CHAIN JQ341580_HBSP_P-B of FT:mat_peptide JQ341580_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341581_HBSP_P-B Product feature CHAIN JQ341581_HBSP_P-B of FT:mat_peptide JQ341581_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341582_HBSP_P-B Product feature CHAIN JQ341582_HBSP_P-B of FT:mat_peptide JQ341582_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSXGSVY
>gnl|hbvpro|JQ341583_HBSP_P-B Product feature CHAIN JQ341583_HBSP_P-B of FT:mat_peptide JQ341583_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341584_HBSP_P-B Product feature CHAIN JQ341584_HBSP_P-B of FT:mat_peptide JQ341584_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341585_HBSP_P-B Product feature CHAIN JQ341585_HBSP_P-B of FT:mat_peptide JQ341585_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno37). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQPPAPDHAEPARLLLKEPLCFPHAAVQNLRT
ETAHVFPSHHLGLSQNTYGSGPQXVSLGSVY
>gnl|hbvpro|JQ341586_HBSP_P-B Product feature CHAIN JQ341586_HBSP_P-B of FT:mat_peptide JQ341586_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341587_HBSP_P-B Product feature CHAIN JQ341587_HBSP_P-B of FT:mat_peptide JQ341587_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNINDHQXPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341588_HBSP_P-B Product feature CHAIN JQ341588_HBSP_P-B of FT:mat_peptide JQ341588_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEELNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341589_HBSP_P-B Product feature CHAIN JQ341589_HBSP_P-B of FT:mat_peptide JQ341589_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGDLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341590_HBSP_P-B Product feature CHAIN JQ341590_HBSP_P-B of FT:mat_peptide JQ341590_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341591_HBSP_P-B Product feature CHAIN JQ341591_HBSP_P-B of FT:mat_peptide JQ341591_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341592_HBSP_P-B Product feature CHAIN JQ341592_HBSP_P-B of FT:mat_peptide JQ341592_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno44). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLHLGNINDHQRPARDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNPYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341593_HBSP_P-B Product feature CHAIN JQ341593_HBSP_P-B of FT:mat_peptide JQ341593_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341594_HBSP_P-B Product feature CHAIN JQ341594_HBSP_P-B of FT:mat_peptide JQ341594_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLXXEAGPLEEELPRLADEGLNRRVAEDLXLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVVVQNLRT
ETAPVFPSXHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341595_HBSP_P-B Product feature CHAIN JQ341595_HBSP_P-B of FT:mat_peptide JQ341595_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno47). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAXDHAKPAXLLLKEPLCFPHVAVQNLRT
ETAXVFPSHHLGLXQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341596_HBSP_P-B Product feature CHAIN JQ341596_HBSP_P-B of FT:mat_peptide JQ341596_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSXNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341597_HBSP_P-B Product feature CHAIN JQ341597_HBSP_P-B of FT:mat_peptide JQ341597_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341598_HBSP_P-B Product feature CHAIN JQ341598_HBSP_P-B of FT:mat_peptide JQ341598_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341599_HBSP_P-B Product feature CHAIN JQ341599_HBSP_P-B of FT:mat_peptide JQ341599_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341600_HBSP_P-B Product feature CHAIN JQ341600_HBSP_P-B of FT:mat_peptide JQ341600_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQCFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHRQPAPDHAKPAQLLLKDPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341601_HBSP_P-B Product feature CHAIN JQ341601_HBSP_P-B of FT:mat_peptide JQ341601_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVXNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341603_HBSP_P-B Product feature CHAIN JQ341603_HBSP_P-B of FT:mat_peptide JQ341603_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341604_HBSP_P-B Product feature CHAIN JQ341604_HBSP_P-B of FT:mat_peptide JQ341604_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341605_HBSP_P-B Product feature CHAIN JQ341605_HBSP_P-B of FT:mat_peptide JQ341605_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno57). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341606_HBSP_P-B Product feature CHAIN JQ341606_HBSP_P-B of FT:mat_peptide JQ341606_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno58). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGXLNDHQQPAPDHAKXARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341607_HBSP_P-B Product feature CHAIN JQ341607_HBSP_P-B of FT:mat_peptide JQ341607_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno59). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKGPLCFPHVAVQNLRT
ETAPVFPSHXLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341608_HBSP_P-B Product feature CHAIN JQ341608_HBSP_P-B of FT:mat_peptide JQ341608_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno60). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEKAGPLEEELPRLADEGLNRRVAEDLSLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ341609_HBSP_P-B Product feature CHAIN JQ341609_HBSP_P-B of FT:mat_peptide JQ341609_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ429079_HBSP_P-B Product feature CHAIN JQ429079_HBSP_P-B of FT:mat_peptide JQ429079_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08.10.002). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHANPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ429080_HBSP_P-B Product feature CHAIN JQ429080_HBSP_P-B of FT:mat_peptide JQ429080_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.40.033). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQPPAPDHAKPARLLLKEPLCLPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ429081_HBSP_P-B Product feature CHAIN JQ429081_HBSP_P-B of FT:mat_peptide JQ429081_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.80.055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ429082_HBSP_P-B Product feature CHAIN JQ429082_HBSP_P-B of FT:mat_peptide JQ429082_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.41.591). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ688405_HBSP_P-B Product feature CHAIN JQ688405_HBSP_P-B of FT:mat_peptide JQ688405_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVB2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707734_HBSP_P-B Product feature CHAIN JQ707734_HBSP_P-B of FT:mat_peptide JQ707734_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707735_HBSP_P-B Product feature CHAIN JQ707735_HBSP_P-B of FT:mat_peptide JQ707735_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707737_HBSP_P-B Product feature CHAIN JQ707737_HBSP_P-B of FT:mat_peptide JQ707737_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707738_HBSP_P-B Product feature CHAIN JQ707738_HBSP_P-B of FT:mat_peptide JQ707738_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707739_HBSP_P-B Product feature CHAIN JQ707739_HBSP_P-B of FT:mat_peptide JQ707739_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707740_HBSP_P-B Product feature CHAIN JQ707740_HBSP_P-B of FT:mat_peptide JQ707740_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNNHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGHQSVSHGSVY
>gnl|hbvpro|JQ707742_HBSP_P-B Product feature CHAIN JQ707742_HBSP_P-B of FT:mat_peptide JQ707742_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707743_HBSP_P-B Product feature CHAIN JQ707743_HBSP_P-B of FT:mat_peptide JQ707743_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_20-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707744_HBSP_P-B Product feature CHAIN JQ707744_HBSP_P-B of FT:mat_peptide JQ707744_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707745_HBSP_P-B Product feature CHAIN JQ707745_HBSP_P-B of FT:mat_peptide JQ707745_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAQDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707746_HBSP_P-B Product feature CHAIN JQ707746_HBSP_P-B of FT:mat_peptide JQ707746_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_24-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707747_HBSP_P-B Product feature CHAIN JQ707747_HBSP_P-B of FT:mat_peptide JQ707747_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARILLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707749_HBSP_P-B Product feature CHAIN JQ707749_HBSP_P-B of FT:mat_peptide JQ707749_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707750_HBSP_P-B Product feature CHAIN JQ707750_HBSP_P-B of FT:mat_peptide JQ707750_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDRQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707753_HBSP_P-B Product feature CHAIN JQ707753_HBSP_P-B of FT:mat_peptide JQ707753_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707755_HBSP_P-B Product feature CHAIN JQ707755_HBSP_P-B of FT:mat_peptide JQ707755_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707758_HBSP_P-B Product feature CHAIN JQ707758_HBSP_P-B of FT:mat_peptide JQ707758_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707759_HBSP_P-B Product feature CHAIN JQ707759_HBSP_P-B of FT:mat_peptide JQ707759_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707762_HBSP_P-B Product feature CHAIN JQ707762_HBSP_P-B of FT:mat_peptide JQ707762_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707763_HBSP_P-B Product feature CHAIN JQ707763_HBSP_P-B of FT:mat_peptide JQ707763_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707764_HBSP_P-B Product feature CHAIN JQ707764_HBSP_P-B of FT:mat_peptide JQ707764_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707765_HBSP_P-B Product feature CHAIN JQ707765_HBSP_P-B of FT:mat_peptide JQ707765_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707766_HBSP_P-B Product feature CHAIN JQ707766_HBSP_P-B of FT:mat_peptide JQ707766_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707767_HBSP_P-B Product feature CHAIN JQ707767_HBSP_P-B of FT:mat_peptide JQ707767_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801471_HBSP_P-B Product feature CHAIN JQ801471_HBSP_P-B of FT:mat_peptide JQ801471_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLWT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801474_HBSP_P-B Product feature CHAIN JQ801474_HBSP_P-B of FT:mat_peptide JQ801474_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801479_HBSP_P-B Product feature CHAIN JQ801479_HBSP_P-B of FT:mat_peptide JQ801479_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801485_HBSP_P-B Product feature CHAIN JQ801485_HBSP_P-B of FT:mat_peptide JQ801485_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801494_HBSP_P-B Product feature CHAIN JQ801494_HBSP_P-B of FT:mat_peptide JQ801494_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSRHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801506_HBSP_P-B Product feature CHAIN JQ801506_HBSP_P-B of FT:mat_peptide JQ801506_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801507_HBSP_P-B Product feature CHAIN JQ801507_HBSP_P-B of FT:mat_peptide JQ801507_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801512_HBSP_P-B Product feature CHAIN JQ801512_HBSP_P-B of FT:mat_peptide JQ801512_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAEPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801514_HBSP_P-B Product feature CHAIN JQ801514_HBSP_P-B of FT:mat_peptide JQ801514_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801516_HBSP_P-B Product feature CHAIN JQ801516_HBSP_P-B of FT:mat_peptide JQ801516_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQRPVPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ801524_HBSP_P-B Product feature CHAIN JQ801524_HBSP_P-B of FT:mat_peptide JQ801524_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JX026879_HBSP_P-B Product feature CHAIN JX026879_HBSP_P-B of FT:mat_peptide JX026879_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRT
DTAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JX026881_HBSP_P-B Product feature CHAIN JX026881_HBSP_P-B of FT:mat_peptide JX026881_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQRPAPDHAKPAQLLLKEPLCFPHVAVHNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX026883_HBSP_P-B Product feature CHAIN JX026883_HBSP_P-B of FT:mat_peptide JX026883_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-50). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQQPAPEHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX026886_HBSP_P-B Product feature CHAIN JX026886_HBSP_P-B of FT:mat_peptide JX026886_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-73). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQLPAPDPAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429897_HBSP_P-B Product feature CHAIN JX429897_HBSP_P-B of FT:mat_peptide JX429897_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHARPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429899_HBSP_P-B Product feature CHAIN JX429899_HBSP_P-B of FT:mat_peptide JX429899_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429900_HBSP_P-B Product feature CHAIN JX429900_HBSP_P-B of FT:mat_peptide JX429900_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429901_HBSP_P-B Product feature CHAIN JX429901_HBSP_P-B of FT:mat_peptide JX429901_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-33). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JX429902_HBSP_P-B Product feature CHAIN JX429902_HBSP_P-B of FT:mat_peptide JX429902_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX429908_HBSP_P-B Product feature CHAIN JX429908_HBSP_P-B of FT:mat_peptide JX429908_HBSP_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-58). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNFNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRT
ETAPVFPSHHLGLSQNTYGS