HBVdb

Dataset for protein HBx of genotype all

[Download (right click)] [Alignment] [Repertoires]

10045 sequence(s)

>gnl|hbvpro|AB014370_HBx_P-A Product feature CHAIN AB014370_HBx_P-A of FT:mat_peptide AB014370_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB064314_HBx_P-A Product feature CHAIN AB064314_HBx_P-A of FT:mat_peptide AB064314_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSLCNFFTSA
>gnl|hbvpro|AB076678_HBx_P-A Product feature CHAIN AB076678_HBx_P-A of FT:mat_peptide AB076678_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB076679_HBx_P-A Product feature CHAIN AB076679_HBx_P-A of FT:mat_peptide AB076679_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116076_HBx_P-A Product feature CHAIN AB116076_HBx_P-A of FT:mat_peptide AB116076_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116077_HBx_P-A Product feature CHAIN AB116077_HBx_P-A of FT:mat_peptide AB116077_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA2126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116078_HBx_P-A Product feature CHAIN AB116078_HBx_P-A of FT:mat_peptide AB116078_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116079_HBx_P-A Product feature CHAIN AB116079_HBx_P-A of FT:mat_peptide AB116079_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116080_HBx_P-A Product feature CHAIN AB116080_HBx_P-A of FT:mat_peptide AB116080_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116081_HBx_P-A Product feature CHAIN AB116081_HBx_P-A of FT:mat_peptide AB116081_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|AB116082_HBx_P-A Product feature CHAIN AB116082_HBx_P-A of FT:mat_peptide AB116082_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116083_HBx_P-A Product feature CHAIN AB116083_HBx_P-A of FT:mat_peptide AB116083_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDRVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116084_HBx_P-A Product feature CHAIN AB116084_HBx_P-A of FT:mat_peptide AB116084_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNTHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116085_HBx_P-A Product feature CHAIN AB116085_HBx_P-A of FT:mat_peptide AB116085_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116086_HBx_P-A Product feature CHAIN AB116086_HBx_P-A of FT:mat_peptide AB116086_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGSLGTLSSPAPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPYSCNFFTSA
>gnl|hbvpro|AB116087_HBx_P-A Product feature CHAIN AB116087_HBx_P-A of FT:mat_peptide AB116087_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116088_HBx_P-A Product feature CHAIN AB116088_HBx_P-A of FT:mat_peptide AB116088_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAPQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|AB116089_HBx_P-A Product feature CHAIN AB116089_HBx_P-A of FT:mat_peptide AB116089_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGANLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|AB116090_HBx_P-A Product feature CHAIN AB116090_HBx_P-A of FT:mat_peptide AB116090_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116091_HBx_P-A Product feature CHAIN AB116091_HBx_P-A of FT:mat_peptide AB116091_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVXAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116092_HBx_P-A Product feature CHAIN AB116092_HBx_P-A of FT:mat_peptide AB116092_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116093_HBx_P-A Product feature CHAIN AB116093_HBx_P-A of FT:mat_peptide AB116093_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB116094_HBx_P-A Product feature CHAIN AB116094_HBx_P-A of FT:mat_peptide AB116094_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB126580_HBx_P-A Product feature CHAIN AB126580_HBx_P-A of FT:mat_peptide AB126580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB194950_HBx_P-A Product feature CHAIN AB194950_HBx_P-A of FT:mat_peptide AB194950_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB194951_HBx_P-A Product feature CHAIN AB194951_HBx_P-A of FT:mat_peptide AB194951_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB194952_HBx_P-A Product feature CHAIN AB194952_HBx_P-A of FT:mat_peptide AB194952_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPFSCNFFTSA
>gnl|hbvpro|AB205118_HBx_P-A Product feature CHAIN AB205118_HBx_P-A of FT:mat_peptide AB205118_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB222707_HBx_P-A Product feature CHAIN AB222707_HBx_P-A of FT:mat_peptide AB222707_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB241114_HBx_P-A Product feature CHAIN AB241114_HBx_P-A of FT:mat_peptide AB241114_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB241115_HBx_P-A Product feature CHAIN AB241115_HBx_P-A of FT:mat_peptide AB241115_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDTSRDVLCLRPISAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB246317_HBx_P-A Product feature CHAIN AB246317_HBx_P-A of FT:mat_peptide AB246317_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGANLSLRGLPVCAFSSAGPCALRFTSARCVE
TTMNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPLSCNFFTSA
>gnl|hbvpro|AB246335_HBx_P-A Product feature CHAIN AB246335_HBx_P-A of FT:mat_peptide AB246335_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB246336_HBx_P-A Product feature CHAIN AB246336_HBx_P-A of FT:mat_peptide AB246336_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB246337_HBx_P-A Product feature CHAIN AB246337_HBx_P-A of FT:mat_peptide AB246337_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB246338_HBx_P-A Product feature CHAIN AB246338_HBx_P-A of FT:mat_peptide AB246338_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB300366_HBx_P-A Product feature CHAIN AB300366_HBx_P-A of FT:mat_peptide AB300366_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB300367_HBx_P-A Product feature CHAIN AB300367_HBx_P-A of FT:mat_peptide AB300367_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB362931_HBx_P-A Product feature CHAIN AB362931_HBx_P-A of FT:mat_peptide AB362931_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453979_HBx_P-A Product feature CHAIN AB453979_HBx_P-A of FT:mat_peptide AB453979_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453980_HBx_P-A Product feature CHAIN AB453980_HBx_P-A of FT:mat_peptide AB453980_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453981_HBx_P-A Product feature CHAIN AB453981_HBx_P-A of FT:mat_peptide AB453981_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453982_HBx_P-A Product feature CHAIN AB453982_HBx_P-A of FT:mat_peptide AB453982_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453983_HBx_P-A Product feature CHAIN AB453983_HBx_P-A of FT:mat_peptide AB453983_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453984_HBx_P-A Product feature CHAIN AB453984_HBx_P-A of FT:mat_peptide AB453984_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB453986_HBx_P-A Product feature CHAIN AB453986_HBx_P-A of FT:mat_peptide AB453986_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB453987_HBx_P-A Product feature CHAIN AB453987_HBx_P-A of FT:mat_peptide AB453987_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|AB453988_HBx_P-A Product feature CHAIN AB453988_HBx_P-A of FT:mat_peptide AB453988_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRPLAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB453989_HBx_P-A Product feature CHAIN AB453989_HBx_P-A of FT:mat_peptide AB453989_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB480036_HBx_P-A Product feature CHAIN AB480036_HBx_P-A of FT:mat_peptide AB480036_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB480038_HBx_P-A Product feature CHAIN AB480038_HBx_P-A of FT:mat_peptide AB480038_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB480039_HBx_P-A Product feature CHAIN AB480039_HBx_P-A of FT:mat_peptide AB480039_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB480040_HBx_P-A Product feature CHAIN AB480040_HBx_P-A of FT:mat_peptide AB480040_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARXMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB480041_HBx_P-A Product feature CHAIN AB480041_HBx_P-A of FT:mat_peptide AB480041_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB549213_HBx_P-A Product feature CHAIN AB549213_HBx_P-A of FT:mat_peptide AB549213_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697487_HBx_P-A Product feature CHAIN AB697487_HBx_P-A of FT:mat_peptide AB697487_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCXFKDWEELGEEIRLKVFVLGGCRHKLVCXPAPCNFFTSA
>gnl|hbvpro|AB697488_HBx_P-A Product feature CHAIN AB697488_HBx_P-A of FT:mat_peptide AB697488_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697489_HBx_P-A Product feature CHAIN AB697489_HBx_P-A of FT:mat_peptide AB697489_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697491_HBx_P-A Product feature CHAIN AB697491_HBx_P-A of FT:mat_peptide AB697491_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697492_HBx_P-A Product feature CHAIN AB697492_HBx_P-A of FT:mat_peptide AB697492_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697493_HBx_P-A Product feature CHAIN AB697493_HBx_P-A of FT:mat_peptide AB697493_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697495_HBx_P-A Product feature CHAIN AB697495_HBx_P-A of FT:mat_peptide AB697495_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697496_HBx_P-A Product feature CHAIN AB697496_HBx_P-A of FT:mat_peptide AB697496_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697497_HBx_P-A Product feature CHAIN AB697497_HBx_P-A of FT:mat_peptide AB697497_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697498_HBx_P-A Product feature CHAIN AB697498_HBx_P-A of FT:mat_peptide AB697498_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCXPAPCNFFTSA
>gnl|hbvpro|AB697499_HBx_P-A Product feature CHAIN AB697499_HBx_P-A of FT:mat_peptide AB697499_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697501_HBx_P-A Product feature CHAIN AB697501_HBx_P-A of FT:mat_peptide AB697501_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697503_HBx_P-A Product feature CHAIN AB697503_HBx_P-A of FT:mat_peptide AB697503_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697504_HBx_P-A Product feature CHAIN AB697504_HBx_P-A of FT:mat_peptide AB697504_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697505_HBx_P-A Product feature CHAIN AB697505_HBx_P-A of FT:mat_peptide AB697505_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697506_HBx_P-A Product feature CHAIN AB697506_HBx_P-A of FT:mat_peptide AB697506_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697507_HBx_P-A Product feature CHAIN AB697507_HBx_P-A of FT:mat_peptide AB697507_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697508_HBx_P-A Product feature CHAIN AB697508_HBx_P-A of FT:mat_peptide AB697508_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697509_HBx_P-A Product feature CHAIN AB697509_HBx_P-A of FT:mat_peptide AB697509_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697511_HBx_P-A Product feature CHAIN AB697511_HBx_P-A of FT:mat_peptide AB697511_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB697512_HBx_P-A Product feature CHAIN AB697512_HBx_P-A of FT:mat_peptide AB697512_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB775198_HBx_P-A Product feature CHAIN AB775198_HBx_P-A of FT:mat_peptide AB775198_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB775199_HBx_P-A Product feature CHAIN AB775199_HBx_P-A of FT:mat_peptide AB775199_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB775200_HBx_P-A Product feature CHAIN AB775200_HBx_P-A of FT:mat_peptide AB775200_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB775201_HBx_P-A Product feature CHAIN AB775201_HBx_P-A of FT:mat_peptide AB775201_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937791_HBx_P-A Product feature CHAIN AB937791_HBx_P-A of FT:mat_peptide AB937791_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB937792_HBx_P-A Product feature CHAIN AB937792_HBx_P-A of FT:mat_peptide AB937792_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937793_HBx_P-A Product feature CHAIN AB937793_HBx_P-A of FT:mat_peptide AB937793_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937794_HBx_P-A Product feature CHAIN AB937794_HBx_P-A of FT:mat_peptide AB937794_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937795_HBx_P-A Product feature CHAIN AB937795_HBx_P-A of FT:mat_peptide AB937795_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKWTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB937796_HBx_P-A Product feature CHAIN AB937796_HBx_P-A of FT:mat_peptide AB937796_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AB937797_HBx_P-A Product feature CHAIN AB937797_HBx_P-A of FT:mat_peptide AB937797_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQTLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB937798_HBx_P-A Product feature CHAIN AB937798_HBx_P-A of FT:mat_peptide AB937798_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF043560_HBx_P-A Product feature CHAIN AF043560_HBx_P-A of FT:mat_peptide AF043560_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AF043580_HBx_P-A Product feature CHAIN AF043580_HBx_P-A of FT:mat_peptide AF043580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLXGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF090838_HBx_P-A Product feature CHAIN AF090838_HBx_P-A of FT:mat_peptide AF090838_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF090839_HBx_P-A Product feature CHAIN AF090839_HBx_P-A of FT:mat_peptide AF090839_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF090840_HBx_P-A Product feature CHAIN AF090840_HBx_P-A of FT:mat_peptide AF090840_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF090841_HBx_P-A Product feature CHAIN AF090841_HBx_P-A of FT:mat_peptide AF090841_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF090842_HBx_P-A Product feature CHAIN AF090842_HBx_P-A of FT:mat_peptide AF090842_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AF143298_HBx_P-A Product feature CHAIN AF143298_HBx_P-A of FT:mat_peptide AF143298_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=155 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF143302_HBx_P-A Product feature CHAIN AF143302_HBx_P-A of FT:mat_peptide AF143302_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297621_HBx_P-A Product feature CHAIN AF297621_HBx_P-A of FT:mat_peptide AF297621_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297622_HBx_P-A Product feature CHAIN AF297622_HBx_P-A of FT:mat_peptide AF297622_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297623_HBx_P-A Product feature CHAIN AF297623_HBx_P-A of FT:mat_peptide AF297623_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297624_HBx_P-A Product feature CHAIN AF297624_HBx_P-A of FT:mat_peptide AF297624_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF297625_HBx_P-A Product feature CHAIN AF297625_HBx_P-A of FT:mat_peptide AF297625_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVFAPSSCNFFTSA
>gnl|hbvpro|AF536524_HBx_P-A Product feature CHAIN AF536524_HBx_P-A of FT:mat_peptide AF536524_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF537371_HBx_P-A Product feature CHAIN AF537371_HBx_P-A of FT:mat_peptide AF537371_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF537372_HBx_P-A Product feature CHAIN AF537372_HBx_P-A of FT:mat_peptide AF537372_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ012207_HBx_P-A Product feature CHAIN AJ012207_HBx_P-A of FT:mat_peptide AJ012207_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ309369_HBx_P-A Product feature CHAIN AJ309369_HBx_P-A of FT:mat_peptide AJ309369_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSAK
>gnl|hbvpro|AJ309370_HBx_P-A Product feature CHAIN AJ309370_HBx_P-A of FT:mat_peptide AJ309370_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ309371_HBx_P-A Product feature CHAIN AJ309371_HBx_P-A of FT:mat_peptide AJ309371_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MTARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ344115_HBx_P-A Product feature CHAIN AJ344115_HBx_P-A of FT:mat_peptide AJ344115_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLFCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627226_HBx_P-A Product feature CHAIN AJ627226_HBx_P-A of FT:mat_peptide AJ627226_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20952). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTIGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627227_HBx_P-A Product feature CHAIN AJ627227_HBx_P-A of FT:mat_peptide AJ627227_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21077). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVXAESRGRPLSGPLGALSSPSPSAVPAVHGANLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627228_HBx_P-A Product feature CHAIN AJ627228_HBx_P-A of FT:mat_peptide AJ627228_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM180624_HBx_P-A Product feature CHAIN AM180624_HBx_P-A of FT:mat_peptide AM180624_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGXLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AM184125_HBx_P-A Product feature CHAIN AM184125_HBx_P-A of FT:mat_peptide AM184125_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AM184126_HBx_P-A Product feature CHAIN AM184126_HBx_P-A of FT:mat_peptide AM184126_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AM282986_HBx_P-A Product feature CHAIN AM282986_HBx_P-A of FT:mat_peptide AM282986_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295795_HBx_P-A Product feature CHAIN AM295795_HBx_P-A of FT:mat_peptide AM295795_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295796_HBx_P-A Product feature CHAIN AM295796_HBx_P-A of FT:mat_peptide AM295796_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295797_HBx_P-A Product feature CHAIN AM295797_HBx_P-A of FT:mat_peptide AM295797_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295798_HBx_P-A Product feature CHAIN AM295798_HBx_P-A of FT:mat_peptide AM295798_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM295799_HBx_P-A Product feature CHAIN AM295799_HBx_P-A of FT:mat_peptide AM295799_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM410963_HBx_P-A Product feature CHAIN AM410963_HBx_P-A of FT:mat_peptide AM410963_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM494718_HBx_P-A Product feature CHAIN AM494718_HBx_P-A of FT:mat_peptide AM494718_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY034878_HBx_P-A Product feature CHAIN AY034878_HBx_P-A of FT:mat_peptide AY034878_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTFARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY128092_HBx_P-A Product feature CHAIN AY128092_HBx_P-A of FT:mat_peptide AY128092_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY152726_HBx_P-A Product feature CHAIN AY152726_HBx_P-A of FT:mat_peptide AY152726_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPVMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161138_HBx_P-A Product feature CHAIN AY161138_HBx_P-A of FT:mat_peptide AY161138_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161139_HBx_P-A Product feature CHAIN AY161139_HBx_P-A of FT:mat_peptide AY161139_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161142_HBx_P-A Product feature CHAIN AY161142_HBx_P-A of FT:mat_peptide AY161142_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRVTSARCME
TTVNSHQVLPKVLYKWTLGLSAMSTTDLKAYLKDCVFKDREELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY161143_HBx_P-A Product feature CHAIN AY161143_HBx_P-A of FT:mat_peptide AY161143_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRVTSARCME
TTVNSHQVLPKVLYKWTLGLSAMSTTDLKAYLKDCVFKDREELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY161144_HBx_P-A Product feature CHAIN AY161144_HBx_P-A of FT:mat_peptide AY161144_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRVTSARCME
TTVNSHQVLPKVLYKWTLGLSAMSTTDLKAYLKDCVFKDREELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233274_HBx_P-A Product feature CHAIN AY233274_HBx_P-A of FT:mat_peptide AY233274_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233275_HBx_P-A Product feature CHAIN AY233275_HBx_P-A of FT:mat_peptide AY233275_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|AY233276_HBx_P-A Product feature CHAIN AY233276_HBx_P-A of FT:mat_peptide AY233276_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAQQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233278_HBx_P-A Product feature CHAIN AY233278_HBx_P-A of FT:mat_peptide AY233278_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLRLRPVGAESRGRPLARSLGTLSSPTPSAVPSDHGAHLSLRGLPVCAFTSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233279_HBx_P-A Product feature CHAIN AY233279_HBx_P-A of FT:mat_peptide AY233279_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRPKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233280_HBx_P-A Product feature CHAIN AY233280_HBx_P-A of FT:mat_peptide AY233280_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKAFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233281_HBx_P-A Product feature CHAIN AY233281_HBx_P-A of FT:mat_peptide AY233281_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQIPPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLRIFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|AY233282_HBx_P-A Product feature CHAIN AY233282_HBx_P-A of FT:mat_peptide AY233282_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTADLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233283_HBx_P-A Product feature CHAIN AY233283_HBx_P-A of FT:mat_peptide AY233283_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233284_HBx_P-A Product feature CHAIN AY233284_HBx_P-A of FT:mat_peptide AY233284_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233285_HBx_P-A Product feature CHAIN AY233285_HBx_P-A of FT:mat_peptide AY233285_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233286_HBx_P-A Product feature CHAIN AY233286_HBx_P-A of FT:mat_peptide AY233286_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVSAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233287_HBx_P-A Product feature CHAIN AY233287_HBx_P-A of FT:mat_peptide AY233287_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233288_HBx_P-A Product feature CHAIN AY233288_HBx_P-A of FT:mat_peptide AY233288_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TIVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233289_HBx_P-A Product feature CHAIN AY233289_HBx_P-A of FT:mat_peptide AY233289_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY233290_HBx_P-A Product feature CHAIN AY233290_HBx_P-A of FT:mat_peptide AY233290_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGDLSSPSPSAVPSDHGANLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTFGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPLSCNFFTSA
>gnl|hbvpro|AY373428_HBx_P-A Product feature CHAIN AY373428_HBx_P-A of FT:mat_peptide AY373428_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY373429_HBx_P-A Product feature CHAIN AY373429_HBx_P-A of FT:mat_peptide AY373429_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY373432_HBx_P-A Product feature CHAIN AY373432_HBx_P-A of FT:mat_peptide AY373432_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY707087_HBx_P-A Product feature CHAIN AY707087_HBx_P-A of FT:mat_peptide AY707087_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY738139_HBx_P-A Product feature CHAIN AY738139_HBx_P-A of FT:mat_peptide AY738139_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY738140_HBx_P-A Product feature CHAIN AY738140_HBx_P-A of FT:mat_peptide AY738140_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY738141_HBx_P-A Product feature CHAIN AY738141_HBx_P-A of FT:mat_peptide AY738141_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY738142_HBx_P-A Product feature CHAIN AY738142_HBx_P-A of FT:mat_peptide AY738142_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTPGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY738143_HBx_P-A Product feature CHAIN AY738143_HBx_P-A of FT:mat_peptide AY738143_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCVE
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|AY862867_HBx_P-A Product feature CHAIN AY862867_HBx_P-A of FT:mat_peptide AY862867_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY862868_HBx_P-A Product feature CHAIN AY862868_HBx_P-A of FT:mat_peptide AY862868_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGVESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY902775_HBx_P-A Product feature CHAIN AY902775_HBx_P-A of FT:mat_peptide AY902775_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY903452_HBx_P-A Product feature CHAIN AY903452_HBx_P-A of FT:mat_peptide AY903452_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|AY934763_HBx_P-A Product feature CHAIN AY934763_HBx_P-A of FT:mat_peptide AY934763_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDTSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDDGANLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934764_HBx_P-A Product feature CHAIN AY934764_HBx_P-A of FT:mat_peptide AY934764_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934765_HBx_P-A Product feature CHAIN AY934765_HBx_P-A of FT:mat_peptide AY934765_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVCVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934766_HBx_P-A Product feature CHAIN AY934766_HBx_P-A of FT:mat_peptide AY934766_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934767_HBx_P-A Product feature CHAIN AY934767_HBx_P-A of FT:mat_peptide AY934767_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934768_HBx_P-A Product feature CHAIN AY934768_HBx_P-A of FT:mat_peptide AY934768_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934769_HBx_P-A Product feature CHAIN AY934769_HBx_P-A of FT:mat_peptide AY934769_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRRRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY934770_HBx_P-A Product feature CHAIN AY934770_HBx_P-A of FT:mat_peptide AY934770_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVCVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934771_HBx_P-A Product feature CHAIN AY934771_HBx_P-A of FT:mat_peptide AY934771_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934772_HBx_P-A Product feature CHAIN AY934772_HBx_P-A of FT:mat_peptide AY934772_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGSLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVYKDWEVLGEEIRLMICVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY934773_HBx_P-A Product feature CHAIN AY934773_HBx_P-A of FT:mat_peptide AY934773_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|AY934774_HBx_P-A Product feature CHAIN AY934774_HBx_P-A of FT:mat_peptide AY934774_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ020002_HBx_P-A Product feature CHAIN DQ020002_HBx_P-A of FT:mat_peptide DQ020002_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
ATVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMICVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ020003_HBx_P-A Product feature CHAIN DQ020003_HBx_P-A of FT:mat_peptide DQ020003_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ298161_HBx_P-A Product feature CHAIN DQ298161_HBx_P-A of FT:mat_peptide DQ298161_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADRGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ298162_HBx_P-A Product feature CHAIN DQ298162_HBx_P-A of FT:mat_peptide DQ298162_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCARRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLRGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ298163_HBx_P-A Product feature CHAIN DQ298163_HBx_P-A of FT:mat_peptide DQ298163_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ298164_HBx_P-A Product feature CHAIN DQ298164_HBx_P-A of FT:mat_peptide DQ298164_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ298165_HBx_P-A Product feature CHAIN DQ298165_HBx_P-A of FT:mat_peptide DQ298165_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ315784_HBx_P-A Product feature CHAIN DQ315784_HBx_P-A of FT:mat_peptide DQ315784_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ315785_HBx_P-A Product feature CHAIN DQ315785_HBx_P-A of FT:mat_peptide DQ315785_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI0386). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDILCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ315786_HBx_P-A Product feature CHAIN DQ315786_HBx_P-A of FT:mat_peptide DQ315786_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTTRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|DQ788725_HBx_P-A Product feature CHAIN DQ788725_HBx_P-A of FT:mat_peptide DQ788725_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ788728_HBx_P-A Product feature CHAIN DQ788728_HBx_P-A of FT:mat_peptide DQ788728_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 05/96). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMILVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF103278_HBx_P-A Product feature CHAIN EF103278_HBx_P-A of FT:mat_peptide EF103278_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLSLRPVGAESRGRPLARPLGAVSSPSPSAVPSDLGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EF208113_HBx_P-A Product feature CHAIN EF208113_HBx_P-A of FT:mat_peptide EF208113_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQIPPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU054331_HBx_C-A Product feature CHAIN EU054331_HBx_C-A of FT:mat_peptide EU054331_HBx_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPFGHFSSPSLSNIPNDHGAHLSFHCLPVCAFSSDGPCALRFTSARCMA
TTVNDHQMLRKLLHKRAVGLPAISTADLEAYFKDCVFKDWEELGEEIRLKVFVLRGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EU086721_HBx_P-A Product feature CHAIN EU086721_HBx_P-A of FT:mat_peptide EU086721_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185786_HBx_P-A Product feature CHAIN EU185786_HBx_P-A of FT:mat_peptide EU185786_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185787_HBx_P-A Product feature CHAIN EU185787_HBx_P-A of FT:mat_peptide EU185787_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185788_HBx_P-A Product feature CHAIN EU185788_HBx_P-A of FT:mat_peptide EU185788_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU19). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU185789_HBx_P-A Product feature CHAIN EU185789_HBx_P-A of FT:mat_peptide EU185789_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU366129_HBx_P-A Product feature CHAIN EU366129_HBx_P-A of FT:mat_peptide EU366129_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EU414133_HBx_P-A Product feature CHAIN EU414133_HBx_P-A of FT:mat_peptide EU414133_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLQKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594383_HBx_P-A Product feature CHAIN EU594383_HBx_P-A of FT:mat_peptide EU594383_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594384_HBx_P-A Product feature CHAIN EU594384_HBx_P-A of FT:mat_peptide EU594384_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594385_HBx_P-A Product feature CHAIN EU594385_HBx_P-A of FT:mat_peptide EU594385_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594386_HBx_P-A Product feature CHAIN EU594386_HBx_P-A of FT:mat_peptide EU594386_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594387_HBx_P-A Product feature CHAIN EU594387_HBx_P-A of FT:mat_peptide EU594387_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594388_HBx_P-A Product feature CHAIN EU594388_HBx_P-A of FT:mat_peptide EU594388_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594389_HBx_P-A Product feature CHAIN EU594389_HBx_P-A of FT:mat_peptide EU594389_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594390_HBx_P-A Product feature CHAIN EU594390_HBx_P-A of FT:mat_peptide EU594390_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594391_HBx_P-A Product feature CHAIN EU594391_HBx_P-A of FT:mat_peptide EU594391_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594392_HBx_P-A Product feature CHAIN EU594392_HBx_P-A of FT:mat_peptide EU594392_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594393_HBx_P-A Product feature CHAIN EU594393_HBx_P-A of FT:mat_peptide EU594393_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594394_HBx_P-A Product feature CHAIN EU594394_HBx_P-A of FT:mat_peptide EU594394_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594395_HBx_P-A Product feature CHAIN EU594395_HBx_P-A of FT:mat_peptide EU594395_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU747320_HBx_P-A Product feature CHAIN EU747320_HBx_P-A of FT:mat_peptide EU747320_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V51). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
NTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859898_HBx_P-A Product feature CHAIN EU859898_HBx_P-A of FT:mat_peptide EU859898_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859899_HBx_P-A Product feature CHAIN EU859899_HBx_P-A of FT:mat_peptide EU859899_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859900_HBx_P-A Product feature CHAIN EU859900_HBx_P-A of FT:mat_peptide EU859900_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKKTLGLPAMSTTDLEAYFKDCVFKHWEELGEENRLKVFVLGGCKHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859901_HBx_P-A Product feature CHAIN EU859901_HBx_P-A of FT:mat_peptide EU859901_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVWPPAPCNFFTSA
>gnl|hbvpro|EU859902_HBx_P-A Product feature CHAIN EU859902_HBx_P-A of FT:mat_peptide EU859902_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859903_HBx_P-A Product feature CHAIN EU859903_HBx_P-A of FT:mat_peptide EU859903_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|EU859904_HBx_P-A Product feature CHAIN EU859904_HBx_P-A of FT:mat_peptide EU859904_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859905_HBx_P-A Product feature CHAIN EU859905_HBx_P-A of FT:mat_peptide EU859905_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859906_HBx_P-A Product feature CHAIN EU859906_HBx_P-A of FT:mat_peptide EU859906_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCSHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859907_HBx_P-A Product feature CHAIN EU859907_HBx_P-A of FT:mat_peptide EU859907_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859908_HBx_P-A Product feature CHAIN EU859908_HBx_P-A of FT:mat_peptide EU859908_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859909_HBx_P-A Product feature CHAIN EU859909_HBx_P-A of FT:mat_peptide EU859909_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859910_HBx_P-A Product feature CHAIN EU859910_HBx_P-A of FT:mat_peptide EU859910_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859911_HBx_P-A Product feature CHAIN EU859911_HBx_P-A of FT:mat_peptide EU859911_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859912_HBx_P-A Product feature CHAIN EU859912_HBx_P-A of FT:mat_peptide EU859912_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859913_HBx_P-A Product feature CHAIN EU859913_HBx_P-A of FT:mat_peptide EU859913_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859914_HBx_P-A Product feature CHAIN EU859914_HBx_P-A of FT:mat_peptide EU859914_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859915_HBx_P-A Product feature CHAIN EU859915_HBx_P-A of FT:mat_peptide EU859915_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859916_HBx_P-A Product feature CHAIN EU859916_HBx_P-A of FT:mat_peptide EU859916_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859917_HBx_P-A Product feature CHAIN EU859917_HBx_P-A of FT:mat_peptide EU859917_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAKSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859918_HBx_P-A Product feature CHAIN EU859918_HBx_P-A of FT:mat_peptide EU859918_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859919_HBx_P-A Product feature CHAIN EU859919_HBx_P-A of FT:mat_peptide EU859919_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859920_HBx_P-A Product feature CHAIN EU859920_HBx_P-A of FT:mat_peptide EU859920_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859921_HBx_P-A Product feature CHAIN EU859921_HBx_P-A of FT:mat_peptide EU859921_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859922_HBx_P-A Product feature CHAIN EU859922_HBx_P-A of FT:mat_peptide EU859922_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859923_HBx_P-A Product feature CHAIN EU859923_HBx_P-A of FT:mat_peptide EU859923_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859924_HBx_P-A Product feature CHAIN EU859924_HBx_P-A of FT:mat_peptide EU859924_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859925_HBx_P-A Product feature CHAIN EU859925_HBx_P-A of FT:mat_peptide EU859925_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859926_HBx_P-A Product feature CHAIN EU859926_HBx_P-A of FT:mat_peptide EU859926_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859927_HBx_P-A Product feature CHAIN EU859927_HBx_P-A of FT:mat_peptide EU859927_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGFPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859928_HBx_P-A Product feature CHAIN EU859928_HBx_P-A of FT:mat_peptide EU859928_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859929_HBx_P-A Product feature CHAIN EU859929_HBx_P-A of FT:mat_peptide EU859929_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859930_HBx_P-A Product feature CHAIN EU859930_HBx_P-A of FT:mat_peptide EU859930_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=156 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859931_HBx_P-A Product feature CHAIN EU859931_HBx_P-A of FT:mat_peptide EU859931_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859932_HBx_P-A Product feature CHAIN EU859932_HBx_P-A of FT:mat_peptide EU859932_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859933_HBx_P-A Product feature CHAIN EU859933_HBx_P-A of FT:mat_peptide EU859933_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859934_HBx_P-A Product feature CHAIN EU859934_HBx_P-A of FT:mat_peptide EU859934_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859935_HBx_P-A Product feature CHAIN EU859935_HBx_P-A of FT:mat_peptide EU859935_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859936_HBx_P-A Product feature CHAIN EU859936_HBx_P-A of FT:mat_peptide EU859936_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859937_HBx_P-A Product feature CHAIN EU859937_HBx_P-A of FT:mat_peptide EU859937_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859938_HBx_P-A Product feature CHAIN EU859938_HBx_P-A of FT:mat_peptide EU859938_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C133). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859939_HBx_P-A Product feature CHAIN EU859939_HBx_P-A of FT:mat_peptide EU859939_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859940_HBx_P-A Product feature CHAIN EU859940_HBx_P-A of FT:mat_peptide EU859940_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859941_HBx_P-A Product feature CHAIN EU859941_HBx_P-A of FT:mat_peptide EU859941_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEKIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859942_HBx_P-A Product feature CHAIN EU859942_HBx_P-A of FT:mat_peptide EU859942_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859943_HBx_P-A Product feature CHAIN EU859943_HBx_P-A of FT:mat_peptide EU859943_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859944_HBx_P-A Product feature CHAIN EU859944_HBx_P-A of FT:mat_peptide EU859944_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859945_HBx_P-A Product feature CHAIN EU859945_HBx_P-A of FT:mat_peptide EU859945_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859946_HBx_P-A Product feature CHAIN EU859946_HBx_P-A of FT:mat_peptide EU859946_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859947_HBx_P-A Product feature CHAIN EU859947_HBx_P-A of FT:mat_peptide EU859947_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859948_HBx_P-A Product feature CHAIN EU859948_HBx_P-A of FT:mat_peptide EU859948_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQLLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859949_HBx_P-A Product feature CHAIN EU859949_HBx_P-A of FT:mat_peptide EU859949_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQLLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLRGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859950_HBx_P-A Product feature CHAIN EU859950_HBx_P-A of FT:mat_peptide EU859950_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859951_HBx_P-A Product feature CHAIN EU859951_HBx_P-A of FT:mat_peptide EU859951_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859952_HBx_P-A Product feature CHAIN EU859952_HBx_P-A of FT:mat_peptide EU859952_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859953_HBx_P-A Product feature CHAIN EU859953_HBx_P-A of FT:mat_peptide EU859953_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859954_HBx_P-A Product feature CHAIN EU859954_HBx_P-A of FT:mat_peptide EU859954_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859955_HBx_P-A Product feature CHAIN EU859955_HBx_P-A of FT:mat_peptide EU859955_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU859956_HBx_P-A Product feature CHAIN EU859956_HBx_P-A of FT:mat_peptide EU859956_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349222_HBx_P-A Product feature CHAIN FJ349222_HBx_P-A of FT:mat_peptide FJ349222_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349224_HBx_P-A Product feature CHAIN FJ349224_HBx_P-A of FT:mat_peptide FJ349224_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQLLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ692554_HBx_P-A Product feature CHAIN FJ692554_HBx_P-A of FT:mat_peptide FJ692554_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAYQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692555_HBx_P-A Product feature CHAIN FJ692555_HBx_P-A of FT:mat_peptide FJ692555_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24074). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|FJ692557_HBx_P-A Product feature CHAIN FJ692557_HBx_P-A of FT:mat_peptide FJ692557_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692558_HBx_P-A Product feature CHAIN FJ692558_HBx_P-A of FT:mat_peptide FJ692558_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPTSCNFFTSA
>gnl|hbvpro|FJ692559_HBx_P-A Product feature CHAIN FJ692559_HBx_P-A of FT:mat_peptide FJ692559_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692561_HBx_P-A Product feature CHAIN FJ692561_HBx_P-A of FT:mat_peptide FJ692561_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692562_HBx_P-A Product feature CHAIN FJ692562_HBx_P-A of FT:mat_peptide FJ692562_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDNGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692563_HBx_P-A Product feature CHAIN FJ692563_HBx_P-A of FT:mat_peptide FJ692563_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLRLPAMSTTDLEAYFKDCVFKDWEELGKEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692564_HBx_P-A Product feature CHAIN FJ692564_HBx_P-A of FT:mat_peptide FJ692564_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692565_HBx_P-A Product feature CHAIN FJ692565_HBx_P-A of FT:mat_peptide FJ692565_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692566_HBx_P-A Product feature CHAIN FJ692566_HBx_P-A of FT:mat_peptide FJ692566_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692567_HBx_P-A Product feature CHAIN FJ692567_HBx_P-A of FT:mat_peptide FJ692567_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692570_HBx_P-A Product feature CHAIN FJ692570_HBx_P-A of FT:mat_peptide FJ692570_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50010). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFEGSLGTLSSPSPSAVPSDYGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692571_HBx_P-A Product feature CHAIN FJ692571_HBx_P-A of FT:mat_peptide FJ692571_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|FJ692572_HBx_P-A Product feature CHAIN FJ692572_HBx_P-A of FT:mat_peptide FJ692572_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50013). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFTGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692573_HBx_P-A Product feature CHAIN FJ692573_HBx_P-A of FT:mat_peptide FJ692573_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50014). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692574_HBx_P-A Product feature CHAIN FJ692574_HBx_P-A of FT:mat_peptide FJ692574_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692575_HBx_P-A Product feature CHAIN FJ692575_HBx_P-A of FT:mat_peptide FJ692575_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692576_HBx_P-A Product feature CHAIN FJ692576_HBx_P-A of FT:mat_peptide FJ692576_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692577_HBx_P-A Product feature CHAIN FJ692577_HBx_P-A of FT:mat_peptide FJ692577_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNTHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692578_HBx_P-A Product feature CHAIN FJ692578_HBx_P-A of FT:mat_peptide FJ692578_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692579_HBx_P-A Product feature CHAIN FJ692579_HBx_P-A of FT:mat_peptide FJ692579_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692580_HBx_P-A Product feature CHAIN FJ692580_HBx_P-A of FT:mat_peptide FJ692580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692581_HBx_P-A Product feature CHAIN FJ692581_HBx_P-A of FT:mat_peptide FJ692581_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692582_HBx_P-A Product feature CHAIN FJ692582_HBx_P-A of FT:mat_peptide FJ692582_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692583_HBx_P-A Product feature CHAIN FJ692583_HBx_P-A of FT:mat_peptide FJ692583_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692584_HBx_P-A Product feature CHAIN FJ692584_HBx_P-A of FT:mat_peptide FJ692584_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692585_HBx_P-A Product feature CHAIN FJ692585_HBx_P-A of FT:mat_peptide FJ692585_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692586_HBx_P-A Product feature CHAIN FJ692586_HBx_P-A of FT:mat_peptide FJ692586_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692587_HBx_P-A Product feature CHAIN FJ692587_HBx_P-A of FT:mat_peptide FJ692587_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSTSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPFPCNFFTSA
>gnl|hbvpro|FJ692588_HBx_P-A Product feature CHAIN FJ692588_HBx_P-A of FT:mat_peptide FJ692588_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692590_HBx_P-A Product feature CHAIN FJ692590_HBx_P-A of FT:mat_peptide FJ692590_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TAVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692591_HBx_P-A Product feature CHAIN FJ692591_HBx_P-A of FT:mat_peptide FJ692591_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TAVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692592_HBx_P-A Product feature CHAIN FJ692592_HBx_P-A of FT:mat_peptide FJ692592_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692593_HBx_P-A Product feature CHAIN FJ692593_HBx_P-A of FT:mat_peptide FJ692593_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692595_HBx_P-A Product feature CHAIN FJ692595_HBx_P-A of FT:mat_peptide FJ692595_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692596_HBx_P-A Product feature CHAIN FJ692596_HBx_P-A of FT:mat_peptide FJ692596_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692597_HBx_P-A Product feature CHAIN FJ692597_HBx_P-A of FT:mat_peptide FJ692597_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTXA
>gnl|hbvpro|FJ692598_HBx_P-A Product feature CHAIN FJ692598_HBx_P-A of FT:mat_peptide FJ692598_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLXKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692599_HBx_P-A Product feature CHAIN FJ692599_HBx_P-A of FT:mat_peptide FJ692599_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692600_HBx_P-A Product feature CHAIN FJ692600_HBx_P-A of FT:mat_peptide FJ692600_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692601_HBx_P-A Product feature CHAIN FJ692601_HBx_P-A of FT:mat_peptide FJ692601_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692602_HBx_P-A Product feature CHAIN FJ692602_HBx_P-A of FT:mat_peptide FJ692602_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSRNFFTSA
>gnl|hbvpro|FJ692603_HBx_P-A Product feature CHAIN FJ692603_HBx_P-A of FT:mat_peptide FJ692603_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPPAVPAXHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692604_HBx_P-A Product feature CHAIN FJ692604_HBx_P-A of FT:mat_peptide FJ692604_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692605_HBx_P-A Product feature CHAIN FJ692605_HBx_P-A of FT:mat_peptide FJ692605_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPECAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692606_HBx_P-A Product feature CHAIN FJ692606_HBx_P-A of FT:mat_peptide FJ692606_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692607_HBx_P-A Product feature CHAIN FJ692607_HBx_P-A of FT:mat_peptide FJ692607_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692608_HBx_P-A Product feature CHAIN FJ692608_HBx_P-A of FT:mat_peptide FJ692608_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHWILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692609_HBx_P-A Product feature CHAIN FJ692609_HBx_P-A of FT:mat_peptide FJ692609_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50098). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPFSCNFFTSA
>gnl|hbvpro|FJ692610_HBx_P-A Product feature CHAIN FJ692610_HBx_P-A of FT:mat_peptide FJ692610_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAXRLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXSCNFFTSA
>gnl|hbvpro|FJ692611_HBx_P-A Product feature CHAIN FJ692611_HBx_P-A of FT:mat_peptide FJ692611_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692612_HBx_P-A Product feature CHAIN FJ692612_HBx_P-A of FT:mat_peptide FJ692612_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ692613_HBx_P-A Product feature CHAIN FJ692613_HBx_P-A of FT:mat_peptide FJ692613_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ904411_HBx_P-A Product feature CHAIN FJ904411_HBx_P-A of FT:mat_peptide FJ904411_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A55). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPSMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904434_HBx_P-A Product feature CHAIN FJ904434_HBx_P-A of FT:mat_peptide FJ904434_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FM199974_HBx_P-A Product feature CHAIN FM199974_HBx_P-A of FT:mat_peptide FM199974_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLXSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199975_HBx_P-A Product feature CHAIN FM199975_HBx_P-A of FT:mat_peptide FM199975_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199976_HBx_P-A Product feature CHAIN FM199976_HBx_P-A of FT:mat_peptide FM199976_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199977_HBx_P-A Product feature CHAIN FM199977_HBx_P-A of FT:mat_peptide FM199977_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCAPSFCNFFTSA
>gnl|hbvpro|FM199979_HBx_P-A Product feature CHAIN FM199979_HBx_P-A of FT:mat_peptide FM199979_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199980_HBx_P-A Product feature CHAIN FM199980_HBx_P-A of FT:mat_peptide FM199980_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FM199981_HBx_P-A Product feature CHAIN FM199981_HBx_P-A of FT:mat_peptide FM199981_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSX
>gnl|hbvpro|FN545825_HBx_P-A Product feature CHAIN FN545825_HBx_P-A of FT:mat_peptide FN545825_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGSVSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPTSCNFFTSA
>gnl|hbvpro|FN545826_HBx_P-A Product feature CHAIN FN545826_HBx_P-A of FT:mat_peptide FN545826_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLYKRTLGLPAMSMTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545828_HBx_P-A Product feature CHAIN FN545828_HBx_P-A of FT:mat_peptide FN545828_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|FN545829_HBx_P-A Product feature CHAIN FN545829_HBx_P-A of FT:mat_peptide FN545829_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFTSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545830_HBx_P-A Product feature CHAIN FN545830_HBx_P-A of FT:mat_peptide FN545830_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545831_HBx_P-A Product feature CHAIN FN545831_HBx_P-A of FT:mat_peptide FN545831_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVDAESRGRPLSGPLGALSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCAPLSCNFFTSA
>gnl|hbvpro|FN545832_HBx_P-A Product feature CHAIN FN545832_HBx_P-A of FT:mat_peptide FN545832_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545833_HBx_P-A Product feature CHAIN FN545833_HBx_P-A of FT:mat_peptide FN545833_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545834_HBx_P-A Product feature CHAIN FN545834_HBx_P-A of FT:mat_peptide FN545834_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXXXVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545835_HBx_P-A Product feature CHAIN FN545835_HBx_P-A of FT:mat_peptide FN545835_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|FN545836_HBx_P-A Product feature CHAIN FN545836_HBx_P-A of FT:mat_peptide FN545836_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|FN545837_HBx_P-A Product feature CHAIN FN545837_HBx_P-A of FT:mat_peptide FN545837_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|FN545838_HBx_P-A Product feature CHAIN FN545838_HBx_P-A of FT:mat_peptide FN545838_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545839_HBx_P-A Product feature CHAIN FN545839_HBx_P-A of FT:mat_peptide FN545839_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FN545840_HBx_P-A Product feature CHAIN FN545840_HBx_P-A of FT:mat_peptide FN545840_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GQ161813_HBx_P-A Product feature CHAIN GQ161813_HBx_P-A of FT:mat_peptide GQ161813_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GQ184323_HBx_P-A Product feature CHAIN GQ184323_HBx_P-A of FT:mat_peptide GQ184323_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYSQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ184324_HBx_P-A Product feature CHAIN GQ184324_HBx_P-A of FT:mat_peptide GQ184324_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ331046_HBx_P-A Product feature CHAIN GQ331046_HBx_P-A of FT:mat_peptide GQ331046_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ331047_HBx_P-A Product feature CHAIN GQ331047_HBx_P-A of FT:mat_peptide GQ331047_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ414522_HBx_P-A Product feature CHAIN GQ414522_HBx_P-A of FT:mat_peptide GQ414522_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477461_HBx_P-A Product feature CHAIN GQ477461_HBx_P-A of FT:mat_peptide GQ477461_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477462_HBx_P-A Product feature CHAIN GQ477462_HBx_P-A of FT:mat_peptide GQ477462_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477463_HBx_P-A Product feature CHAIN GQ477463_HBx_P-A of FT:mat_peptide GQ477463_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|GQ477464_HBx_P-A Product feature CHAIN GQ477464_HBx_P-A of FT:mat_peptide GQ477464_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477465_HBx_P-A Product feature CHAIN GQ477465_HBx_P-A of FT:mat_peptide GQ477465_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477466_HBx_P-A Product feature CHAIN GQ477466_HBx_P-A of FT:mat_peptide GQ477466_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477467_HBx_P-A Product feature CHAIN GQ477467_HBx_P-A of FT:mat_peptide GQ477467_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477468_HBx_P-A Product feature CHAIN GQ477468_HBx_P-A of FT:mat_peptide GQ477468_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477469_HBx_P-A Product feature CHAIN GQ477469_HBx_P-A of FT:mat_peptide GQ477469_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHRILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477470_HBx_P-A Product feature CHAIN GQ477470_HBx_P-A of FT:mat_peptide GQ477470_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477472_HBx_P-A Product feature CHAIN GQ477472_HBx_P-A of FT:mat_peptide GQ477472_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477473_HBx_P-A Product feature CHAIN GQ477473_HBx_P-A of FT:mat_peptide GQ477473_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477474_HBx_P-A Product feature CHAIN GQ477474_HBx_P-A of FT:mat_peptide GQ477474_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477475_HBx_P-A Product feature CHAIN GQ477475_HBx_P-A of FT:mat_peptide GQ477475_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRAVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477476_HBx_P-A Product feature CHAIN GQ477476_HBx_P-A of FT:mat_peptide GQ477476_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477477_HBx_P-A Product feature CHAIN GQ477477_HBx_P-A of FT:mat_peptide GQ477477_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477478_HBx_P-A Product feature CHAIN GQ477478_HBx_P-A of FT:mat_peptide GQ477478_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477479_HBx_P-A Product feature CHAIN GQ477479_HBx_P-A of FT:mat_peptide GQ477479_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESSGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477480_HBx_P-A Product feature CHAIN GQ477480_HBx_P-A of FT:mat_peptide GQ477480_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477482_HBx_P-A Product feature CHAIN GQ477482_HBx_P-A of FT:mat_peptide GQ477482_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477484_HBx_P-A Product feature CHAIN GQ477484_HBx_P-A of FT:mat_peptide GQ477484_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477486_HBx_P-A Product feature CHAIN GQ477486_HBx_P-A of FT:mat_peptide GQ477486_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSPTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|GQ477487_HBx_P-A Product feature CHAIN GQ477487_HBx_P-A of FT:mat_peptide GQ477487_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVFCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|GQ477488_HBx_P-A Product feature CHAIN GQ477488_HBx_P-A of FT:mat_peptide GQ477488_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|GQ477490_HBx_P-A Product feature CHAIN GQ477490_HBx_P-A of FT:mat_peptide GQ477490_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477491_HBx_P-A Product feature CHAIN GQ477491_HBx_P-A of FT:mat_peptide GQ477491_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|GQ477493_HBx_P-A Product feature CHAIN GQ477493_HBx_P-A of FT:mat_peptide GQ477493_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477494_HBx_P-A Product feature CHAIN GQ477494_HBx_P-A of FT:mat_peptide GQ477494_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAKLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477495_HBx_P-A Product feature CHAIN GQ477495_HBx_P-A of FT:mat_peptide GQ477495_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477496_HBx_P-A Product feature CHAIN GQ477496_HBx_P-A of FT:mat_peptide GQ477496_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477497_HBx_P-A Product feature CHAIN GQ477497_HBx_P-A of FT:mat_peptide GQ477497_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477499_HBx_P-A Product feature CHAIN GQ477499_HBx_P-A of FT:mat_peptide GQ477499_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P105). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477500_HBx_P-A Product feature CHAIN GQ477500_HBx_P-A of FT:mat_peptide GQ477500_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTFSSPSPSAVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPYNFFTSA
>gnl|hbvpro|GQ477501_HBx_P-A Product feature CHAIN GQ477501_HBx_P-A of FT:mat_peptide GQ477501_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477502_HBx_P-A Product feature CHAIN GQ477502_HBx_P-A of FT:mat_peptide GQ477502_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477503_HBx_P-A Product feature CHAIN GQ477503_HBx_P-A of FT:mat_peptide GQ477503_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477504_HBx_P-A Product feature CHAIN GQ477504_HBx_P-A of FT:mat_peptide GQ477504_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563545_HBx_P-A Product feature CHAIN GU563545_HBx_P-A of FT:mat_peptide GU563545_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPSSCNFFTSA
>gnl|hbvpro|GU563546_HBx_P-A Product feature CHAIN GU563546_HBx_P-A of FT:mat_peptide GU563546_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563547_HBx_P-A Product feature CHAIN GU563547_HBx_P-A of FT:mat_peptide GU563547_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEDWLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GU563548_HBx_P-A Product feature CHAIN GU563548_HBx_P-A of FT:mat_peptide GU563548_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|GU563550_HBx_P-A Product feature CHAIN GU563550_HBx_P-A of FT:mat_peptide GU563550_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLIIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563551_HBx_P-A Product feature CHAIN GU563551_HBx_P-A of FT:mat_peptide GU563551_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-124). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563553_HBx_P-A Product feature CHAIN GU563553_HBx_P-A of FT:mat_peptide GU563553_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563554_HBx_P-A Product feature CHAIN GU563554_HBx_P-A of FT:mat_peptide GU563554_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563555_HBx_P-A Product feature CHAIN GU563555_HBx_P-A of FT:mat_peptide GU563555_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563557_HBx_P-A Product feature CHAIN GU563557_HBx_P-A of FT:mat_peptide GU563557_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGSCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563558_HBx_P-A Product feature CHAIN GU563558_HBx_P-A of FT:mat_peptide GU563558_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU563562_HBx_P-A Product feature CHAIN GU563562_HBx_P-A of FT:mat_peptide GU563562_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGKEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE576988_HBx_P-A Product feature CHAIN HE576988_HBx_P-A of FT:mat_peptide HE576988_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HE576989_HBx_P-A Product feature CHAIN HE576989_HBx_P-A of FT:mat_peptide HE576989_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HM011485_HBx_P-A Product feature CHAIN HM011485_HBx_P-A of FT:mat_peptide HM011485_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARYME
TTVNAHQILPKVLXKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRXKLVCAPSSCNFFTSA
>gnl|hbvpro|HM535200_HBx_P-A Product feature CHAIN HM535200_HBx_P-A of FT:mat_peptide HM535200_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHPILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|HM535205_HBx_P-A Product feature CHAIN HM535205_HBx_P-A of FT:mat_peptide HM535205_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JN182318_HBx_P-A Product feature CHAIN JN182318_HBx_P-A of FT:mat_peptide JN182318_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKGCVFKDWEELGEEIRLKAFVLGGCRHKLVCAPAPXXFFTSA
>gnl|hbvpro|JN182321_HBx_P-A Product feature CHAIN JN182321_HBx_P-A of FT:mat_peptide JN182321_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
TAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNTHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGGEIRLRVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JN182322_HBx_P-A Product feature CHAIN JN182322_HBx_P-A of FT:mat_peptide JN182322_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVXXXXXXXFFTSA
>gnl|hbvpro|JN182323_HBx_P-A Product feature CHAIN JN182323_HBx_P-A of FT:mat_peptide JN182323_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDRVFKDWEELGEETRLKVFVLGGCRHKLVXXXXXXXFFTSA
>gnl|hbvpro|JN182324_HBx_P-A Product feature CHAIN JN182324_HBx_P-A of FT:mat_peptide JN182324_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN182325_HBx_P-A Product feature CHAIN JN182325_HBx_P-A of FT:mat_peptide JN182325_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JN182328_HBx_P-A Product feature CHAIN JN182328_HBx_P-A of FT:mat_peptide JN182328_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JN182330_HBx_P-A Product feature CHAIN JN182330_HBx_P-A of FT:mat_peptide JN182330_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JN182331_HBx_P-A Product feature CHAIN JN182331_HBx_P-A of FT:mat_peptide JN182331_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JN182332_HBx_P-A Product feature CHAIN JN182332_HBx_P-A of FT:mat_peptide JN182332_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JN182333_HBx_P-A Product feature CHAIN JN182333_HBx_P-A of FT:mat_peptide JN182333_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|JQ023660_HBx_P-A Product feature CHAIN JQ023660_HBx_P-A of FT:mat_peptide JQ023660_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JQ023661_HBx_P-A Product feature CHAIN JQ023661_HBx_P-A of FT:mat_peptide JQ023661_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JQ023662_HBx_P-A Product feature CHAIN JQ023662_HBx_P-A of FT:mat_peptide JQ023662_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1164). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JQ023663_HBx_P-A Product feature CHAIN JQ023663_HBx_P-A of FT:mat_peptide JQ023663_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1159). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JQ687529_HBx_P-A Product feature CHAIN JQ687529_HBx_P-A of FT:mat_peptide JQ687529_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ687533_HBx_P-A Product feature CHAIN JQ687533_HBx_P-A of FT:mat_peptide JQ687533_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 210). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707299_HBx_P-A Product feature CHAIN JQ707299_HBx_P-A of FT:mat_peptide JQ707299_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707300_HBx_P-A Product feature CHAIN JQ707300_HBx_P-A of FT:mat_peptide JQ707300_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707301_HBx_P-A Product feature CHAIN JQ707301_HBx_P-A of FT:mat_peptide JQ707301_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707302_HBx_P-A Product feature CHAIN JQ707302_HBx_P-A of FT:mat_peptide JQ707302_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707303_HBx_P-A Product feature CHAIN JQ707303_HBx_P-A of FT:mat_peptide JQ707303_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707304_HBx_P-A Product feature CHAIN JQ707304_HBx_P-A of FT:mat_peptide JQ707304_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707305_HBx_P-A Product feature CHAIN JQ707305_HBx_P-A of FT:mat_peptide JQ707305_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707306_HBx_P-A Product feature CHAIN JQ707306_HBx_P-A of FT:mat_peptide JQ707306_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C17). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MADRLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRLTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707307_HBx_P-A Product feature CHAIN JQ707307_HBx_P-A of FT:mat_peptide JQ707307_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707308_HBx_P-A Product feature CHAIN JQ707308_HBx_P-A of FT:mat_peptide JQ707308_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707309_HBx_P-A Product feature CHAIN JQ707309_HBx_P-A of FT:mat_peptide JQ707309_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKHCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707310_HBx_P-A Product feature CHAIN JQ707310_HBx_P-A of FT:mat_peptide JQ707310_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707311_HBx_P-A Product feature CHAIN JQ707311_HBx_P-A of FT:mat_peptide JQ707311_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707312_HBx_P-A Product feature CHAIN JQ707312_HBx_P-A of FT:mat_peptide JQ707312_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707313_HBx_P-A Product feature CHAIN JQ707313_HBx_P-A of FT:mat_peptide JQ707313_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707314_HBx_P-A Product feature CHAIN JQ707314_HBx_P-A of FT:mat_peptide JQ707314_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707315_HBx_P-A Product feature CHAIN JQ707315_HBx_P-A of FT:mat_peptide JQ707315_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707316_HBx_P-A Product feature CHAIN JQ707316_HBx_P-A of FT:mat_peptide JQ707316_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707317_HBx_P-A Product feature CHAIN JQ707317_HBx_P-A of FT:mat_peptide JQ707317_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707318_HBx_P-A Product feature CHAIN JQ707318_HBx_P-A of FT:mat_peptide JQ707318_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707319_HBx_P-A Product feature CHAIN JQ707319_HBx_P-A of FT:mat_peptide JQ707319_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707320_HBx_P-A Product feature CHAIN JQ707320_HBx_P-A of FT:mat_peptide JQ707320_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707321_HBx_P-A Product feature CHAIN JQ707321_HBx_P-A of FT:mat_peptide JQ707321_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707322_HBx_P-A Product feature CHAIN JQ707322_HBx_P-A of FT:mat_peptide JQ707322_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707323_HBx_P-A Product feature CHAIN JQ707323_HBx_P-A of FT:mat_peptide JQ707323_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707324_HBx_P-A Product feature CHAIN JQ707324_HBx_P-A of FT:mat_peptide JQ707324_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707325_HBx_P-A Product feature CHAIN JQ707325_HBx_P-A of FT:mat_peptide JQ707325_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707326_HBx_P-A Product feature CHAIN JQ707326_HBx_P-A of FT:mat_peptide JQ707326_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707327_HBx_P-A Product feature CHAIN JQ707327_HBx_P-A of FT:mat_peptide JQ707327_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707328_HBx_P-A Product feature CHAIN JQ707328_HBx_P-A of FT:mat_peptide JQ707328_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707329_HBx_P-A Product feature CHAIN JQ707329_HBx_P-A of FT:mat_peptide JQ707329_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C39). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCALSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707330_HBx_P-A Product feature CHAIN JQ707330_HBx_P-A of FT:mat_peptide JQ707330_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707331_HBx_P-A Product feature CHAIN JQ707331_HBx_P-A of FT:mat_peptide JQ707331_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707332_HBx_P-A Product feature CHAIN JQ707332_HBx_P-A of FT:mat_peptide JQ707332_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707333_HBx_P-A Product feature CHAIN JQ707333_HBx_P-A of FT:mat_peptide JQ707333_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707334_HBx_P-A Product feature CHAIN JQ707334_HBx_P-A of FT:mat_peptide JQ707334_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C43). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707335_HBx_P-A Product feature CHAIN JQ707335_HBx_P-A of FT:mat_peptide JQ707335_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C44). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707336_HBx_P-A Product feature CHAIN JQ707336_HBx_P-A of FT:mat_peptide JQ707336_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707337_HBx_P-A Product feature CHAIN JQ707337_HBx_P-A of FT:mat_peptide JQ707337_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707338_HBx_P-A Product feature CHAIN JQ707338_HBx_P-A of FT:mat_peptide JQ707338_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707339_HBx_P-A Product feature CHAIN JQ707339_HBx_P-A of FT:mat_peptide JQ707339_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707340_HBx_P-A Product feature CHAIN JQ707340_HBx_P-A of FT:mat_peptide JQ707340_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALHFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707341_HBx_P-A Product feature CHAIN JQ707341_HBx_P-A of FT:mat_peptide JQ707341_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707342_HBx_P-A Product feature CHAIN JQ707342_HBx_P-A of FT:mat_peptide JQ707342_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707343_HBx_P-A Product feature CHAIN JQ707343_HBx_P-A of FT:mat_peptide JQ707343_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707344_HBx_P-A Product feature CHAIN JQ707344_HBx_P-A of FT:mat_peptide JQ707344_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707345_HBx_P-A Product feature CHAIN JQ707345_HBx_P-A of FT:mat_peptide JQ707345_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707346_HBx_P-A Product feature CHAIN JQ707346_HBx_P-A of FT:mat_peptide JQ707346_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707347_HBx_P-A Product feature CHAIN JQ707347_HBx_P-A of FT:mat_peptide JQ707347_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707348_HBx_P-A Product feature CHAIN JQ707348_HBx_P-A of FT:mat_peptide JQ707348_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVRAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707349_HBx_P-A Product feature CHAIN JQ707349_HBx_P-A of FT:mat_peptide JQ707349_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707350_HBx_P-A Product feature CHAIN JQ707350_HBx_P-A of FT:mat_peptide JQ707350_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707351_HBx_P-A Product feature CHAIN JQ707351_HBx_P-A of FT:mat_peptide JQ707351_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707352_HBx_P-A Product feature CHAIN JQ707352_HBx_P-A of FT:mat_peptide JQ707352_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707353_HBx_P-A Product feature CHAIN JQ707353_HBx_P-A of FT:mat_peptide JQ707353_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCFRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707354_HBx_P-A Product feature CHAIN JQ707354_HBx_P-A of FT:mat_peptide JQ707354_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707355_HBx_P-A Product feature CHAIN JQ707355_HBx_P-A of FT:mat_peptide JQ707355_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707356_HBx_P-A Product feature CHAIN JQ707356_HBx_P-A of FT:mat_peptide JQ707356_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707357_HBx_P-A Product feature CHAIN JQ707357_HBx_P-A of FT:mat_peptide JQ707357_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707358_HBx_P-A Product feature CHAIN JQ707358_HBx_P-A of FT:mat_peptide JQ707358_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707359_HBx_P-A Product feature CHAIN JQ707359_HBx_P-A of FT:mat_peptide JQ707359_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707360_HBx_P-A Product feature CHAIN JQ707360_HBx_P-A of FT:mat_peptide JQ707360_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707361_HBx_P-A Product feature CHAIN JQ707361_HBx_P-A of FT:mat_peptide JQ707361_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707362_HBx_P-A Product feature CHAIN JQ707362_HBx_P-A of FT:mat_peptide JQ707362_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDNVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707363_HBx_P-A Product feature CHAIN JQ707363_HBx_P-A of FT:mat_peptide JQ707363_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707364_HBx_P-A Product feature CHAIN JQ707364_HBx_P-A of FT:mat_peptide JQ707364_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707365_HBx_P-A Product feature CHAIN JQ707365_HBx_P-A of FT:mat_peptide JQ707365_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707366_HBx_P-A Product feature CHAIN JQ707366_HBx_P-A of FT:mat_peptide JQ707366_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707367_HBx_P-A Product feature CHAIN JQ707367_HBx_P-A of FT:mat_peptide JQ707367_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707368_HBx_P-A Product feature CHAIN JQ707368_HBx_P-A of FT:mat_peptide JQ707368_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707369_HBx_P-A Product feature CHAIN JQ707369_HBx_P-A of FT:mat_peptide JQ707369_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707370_HBx_P-A Product feature CHAIN JQ707370_HBx_P-A of FT:mat_peptide JQ707370_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707371_HBx_P-A Product feature CHAIN JQ707371_HBx_P-A of FT:mat_peptide JQ707371_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707372_HBx_P-A Product feature CHAIN JQ707372_HBx_P-A of FT:mat_peptide JQ707372_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707373_HBx_P-A Product feature CHAIN JQ707373_HBx_P-A of FT:mat_peptide JQ707373_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707374_HBx_P-A Product feature CHAIN JQ707374_HBx_P-A of FT:mat_peptide JQ707374_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGQCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707375_HBx_P-A Product feature CHAIN JQ707375_HBx_P-A of FT:mat_peptide JQ707375_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707376_HBx_P-A Product feature CHAIN JQ707376_HBx_P-A of FT:mat_peptide JQ707376_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707377_HBx_P-A Product feature CHAIN JQ707377_HBx_P-A of FT:mat_peptide JQ707377_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707378_HBx_P-A Product feature CHAIN JQ707378_HBx_P-A of FT:mat_peptide JQ707378_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707379_HBx_P-A Product feature CHAIN JQ707379_HBx_P-A of FT:mat_peptide JQ707379_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707380_HBx_P-A Product feature CHAIN JQ707380_HBx_P-A of FT:mat_peptide JQ707380_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707381_HBx_P-A Product feature CHAIN JQ707381_HBx_P-A of FT:mat_peptide JQ707381_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707382_HBx_P-A Product feature CHAIN JQ707382_HBx_P-A of FT:mat_peptide JQ707382_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707383_HBx_P-A Product feature CHAIN JQ707383_HBx_P-A of FT:mat_peptide JQ707383_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPTMSTTDLEAYFKDSVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707384_HBx_P-A Product feature CHAIN JQ707384_HBx_P-A of FT:mat_peptide JQ707384_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C32). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707385_HBx_P-A Product feature CHAIN JQ707385_HBx_P-A of FT:mat_peptide JQ707385_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707386_HBx_P-A Product feature CHAIN JQ707386_HBx_P-A of FT:mat_peptide JQ707386_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707387_HBx_P-A Product feature CHAIN JQ707387_HBx_P-A of FT:mat_peptide JQ707387_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707388_HBx_P-A Product feature CHAIN JQ707388_HBx_P-A of FT:mat_peptide JQ707388_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707389_HBx_P-A Product feature CHAIN JQ707389_HBx_P-A of FT:mat_peptide JQ707389_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707390_HBx_P-A Product feature CHAIN JQ707390_HBx_P-A of FT:mat_peptide JQ707390_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707391_HBx_P-A Product feature CHAIN JQ707391_HBx_P-A of FT:mat_peptide JQ707391_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707392_HBx_P-A Product feature CHAIN JQ707392_HBx_P-A of FT:mat_peptide JQ707392_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707393_HBx_P-A Product feature CHAIN JQ707393_HBx_P-A of FT:mat_peptide JQ707393_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707394_HBx_P-A Product feature CHAIN JQ707394_HBx_P-A of FT:mat_peptide JQ707394_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707395_HBx_P-A Product feature CHAIN JQ707395_HBx_P-A of FT:mat_peptide JQ707395_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707396_HBx_P-A Product feature CHAIN JQ707396_HBx_P-A of FT:mat_peptide JQ707396_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707397_HBx_P-A Product feature CHAIN JQ707397_HBx_P-A of FT:mat_peptide JQ707397_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLRGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707398_HBx_P-A Product feature CHAIN JQ707398_HBx_P-A of FT:mat_peptide JQ707398_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707399_HBx_P-A Product feature CHAIN JQ707399_HBx_P-A of FT:mat_peptide JQ707399_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707400_HBx_P-A Product feature CHAIN JQ707400_HBx_P-A of FT:mat_peptide JQ707400_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707402_HBx_P-A Product feature CHAIN JQ707402_HBx_P-A of FT:mat_peptide JQ707402_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707403_HBx_P-A Product feature CHAIN JQ707403_HBx_P-A of FT:mat_peptide JQ707403_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707404_HBx_P-A Product feature CHAIN JQ707404_HBx_P-A of FT:mat_peptide JQ707404_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707405_HBx_P-A Product feature CHAIN JQ707405_HBx_P-A of FT:mat_peptide JQ707405_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGFRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707406_HBx_P-A Product feature CHAIN JQ707406_HBx_P-A of FT:mat_peptide JQ707406_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707407_HBx_P-A Product feature CHAIN JQ707407_HBx_P-A of FT:mat_peptide JQ707407_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707408_HBx_P-A Product feature CHAIN JQ707408_HBx_P-A of FT:mat_peptide JQ707408_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707409_HBx_P-A Product feature CHAIN JQ707409_HBx_P-A of FT:mat_peptide JQ707409_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707410_HBx_P-A Product feature CHAIN JQ707410_HBx_P-A of FT:mat_peptide JQ707410_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707411_HBx_P-A Product feature CHAIN JQ707411_HBx_P-A of FT:mat_peptide JQ707411_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAQQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707412_HBx_P-A Product feature CHAIN JQ707412_HBx_P-A of FT:mat_peptide JQ707412_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707413_HBx_P-A Product feature CHAIN JQ707413_HBx_P-A of FT:mat_peptide JQ707413_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707414_HBx_P-A Product feature CHAIN JQ707414_HBx_P-A of FT:mat_peptide JQ707414_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGSLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707415_HBx_P-A Product feature CHAIN JQ707415_HBx_P-A of FT:mat_peptide JQ707415_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707416_HBx_P-A Product feature CHAIN JQ707416_HBx_P-A of FT:mat_peptide JQ707416_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707417_HBx_P-A Product feature CHAIN JQ707417_HBx_P-A of FT:mat_peptide JQ707417_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707418_HBx_P-A Product feature CHAIN JQ707418_HBx_P-A of FT:mat_peptide JQ707418_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707419_HBx_P-A Product feature CHAIN JQ707419_HBx_P-A of FT:mat_peptide JQ707419_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707420_HBx_P-A Product feature CHAIN JQ707420_HBx_P-A of FT:mat_peptide JQ707420_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707531_HBx_P-A Product feature CHAIN JQ707531_HBx_P-A of FT:mat_peptide JQ707531_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707532_HBx_P-A Product feature CHAIN JQ707532_HBx_P-A of FT:mat_peptide JQ707532_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707533_HBx_P-A Product feature CHAIN JQ707533_HBx_P-A of FT:mat_peptide JQ707533_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707534_HBx_P-A Product feature CHAIN JQ707534_HBx_P-A of FT:mat_peptide JQ707534_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707535_HBx_P-A Product feature CHAIN JQ707535_HBx_P-A of FT:mat_peptide JQ707535_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707536_HBx_P-A Product feature CHAIN JQ707536_HBx_P-A of FT:mat_peptide JQ707536_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707537_HBx_P-A Product feature CHAIN JQ707537_HBx_P-A of FT:mat_peptide JQ707537_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707538_HBx_P-A Product feature CHAIN JQ707538_HBx_P-A of FT:mat_peptide JQ707538_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707539_HBx_P-A Product feature CHAIN JQ707539_HBx_P-A of FT:mat_peptide JQ707539_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707540_HBx_P-A Product feature CHAIN JQ707540_HBx_P-A of FT:mat_peptide JQ707540_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707541_HBx_P-A Product feature CHAIN JQ707541_HBx_P-A of FT:mat_peptide JQ707541_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707542_HBx_P-A Product feature CHAIN JQ707542_HBx_P-A of FT:mat_peptide JQ707542_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707543_HBx_P-A Product feature CHAIN JQ707543_HBx_P-A of FT:mat_peptide JQ707543_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707544_HBx_P-A Product feature CHAIN JQ707544_HBx_P-A of FT:mat_peptide JQ707544_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707545_HBx_P-A Product feature CHAIN JQ707545_HBx_P-A of FT:mat_peptide JQ707545_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707546_HBx_P-A Product feature CHAIN JQ707546_HBx_P-A of FT:mat_peptide JQ707546_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707547_HBx_P-A Product feature CHAIN JQ707547_HBx_P-A of FT:mat_peptide JQ707547_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707548_HBx_P-A Product feature CHAIN JQ707548_HBx_P-A of FT:mat_peptide JQ707548_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707549_HBx_P-A Product feature CHAIN JQ707549_HBx_P-A of FT:mat_peptide JQ707549_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707550_HBx_P-A Product feature CHAIN JQ707550_HBx_P-A of FT:mat_peptide JQ707550_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707551_HBx_P-A Product feature CHAIN JQ707551_HBx_P-A of FT:mat_peptide JQ707551_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707552_HBx_P-A Product feature CHAIN JQ707552_HBx_P-A of FT:mat_peptide JQ707552_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707553_HBx_P-A Product feature CHAIN JQ707553_HBx_P-A of FT:mat_peptide JQ707553_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707554_HBx_P-A Product feature CHAIN JQ707554_HBx_P-A of FT:mat_peptide JQ707554_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707555_HBx_P-A Product feature CHAIN JQ707555_HBx_P-A of FT:mat_peptide JQ707555_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707556_HBx_P-A Product feature CHAIN JQ707556_HBx_P-A of FT:mat_peptide JQ707556_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707557_HBx_P-A Product feature CHAIN JQ707557_HBx_P-A of FT:mat_peptide JQ707557_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707558_HBx_P-A Product feature CHAIN JQ707558_HBx_P-A of FT:mat_peptide JQ707558_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707559_HBx_P-A Product feature CHAIN JQ707559_HBx_P-A of FT:mat_peptide JQ707559_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707560_HBx_P-A Product feature CHAIN JQ707560_HBx_P-A of FT:mat_peptide JQ707560_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSTGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707561_HBx_P-A Product feature CHAIN JQ707561_HBx_P-A of FT:mat_peptide JQ707561_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707562_HBx_P-A Product feature CHAIN JQ707562_HBx_P-A of FT:mat_peptide JQ707562_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707563_HBx_P-A Product feature CHAIN JQ707563_HBx_P-A of FT:mat_peptide JQ707563_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707564_HBx_P-A Product feature CHAIN JQ707564_HBx_P-A of FT:mat_peptide JQ707564_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707565_HBx_P-A Product feature CHAIN JQ707565_HBx_P-A of FT:mat_peptide JQ707565_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707566_HBx_P-A Product feature CHAIN JQ707566_HBx_P-A of FT:mat_peptide JQ707566_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707567_HBx_P-A Product feature CHAIN JQ707567_HBx_P-A of FT:mat_peptide JQ707567_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707568_HBx_P-A Product feature CHAIN JQ707568_HBx_P-A of FT:mat_peptide JQ707568_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707569_HBx_P-A Product feature CHAIN JQ707569_HBx_P-A of FT:mat_peptide JQ707569_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707572_HBx_P-A Product feature CHAIN JQ707572_HBx_P-A of FT:mat_peptide JQ707572_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707573_HBx_P-A Product feature CHAIN JQ707573_HBx_P-A of FT:mat_peptide JQ707573_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707574_HBx_P-A Product feature CHAIN JQ707574_HBx_P-A of FT:mat_peptide JQ707574_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707575_HBx_P-A Product feature CHAIN JQ707575_HBx_P-A of FT:mat_peptide JQ707575_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707576_HBx_P-A Product feature CHAIN JQ707576_HBx_P-A of FT:mat_peptide JQ707576_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707577_HBx_P-A Product feature CHAIN JQ707577_HBx_P-A of FT:mat_peptide JQ707577_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707578_HBx_P-A Product feature CHAIN JQ707578_HBx_P-A of FT:mat_peptide JQ707578_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707579_HBx_P-A Product feature CHAIN JQ707579_HBx_P-A of FT:mat_peptide JQ707579_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707580_HBx_P-A Product feature CHAIN JQ707580_HBx_P-A of FT:mat_peptide JQ707580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707581_HBx_P-A Product feature CHAIN JQ707581_HBx_P-A of FT:mat_peptide JQ707581_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=154 residues).
VAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHKILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707582_HBx_P-A Product feature CHAIN JQ707582_HBx_P-A of FT:mat_peptide JQ707582_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707583_HBx_P-A Product feature CHAIN JQ707583_HBx_P-A of FT:mat_peptide JQ707583_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707584_HBx_P-A Product feature CHAIN JQ707584_HBx_P-A of FT:mat_peptide JQ707584_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C22). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707585_HBx_P-A Product feature CHAIN JQ707585_HBx_P-A of FT:mat_peptide JQ707585_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707586_HBx_P-A Product feature CHAIN JQ707586_HBx_P-A of FT:mat_peptide JQ707586_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707587_HBx_P-A Product feature CHAIN JQ707587_HBx_P-A of FT:mat_peptide JQ707587_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707588_HBx_P-A Product feature CHAIN JQ707588_HBx_P-A of FT:mat_peptide JQ707588_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C26). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707589_HBx_P-A Product feature CHAIN JQ707589_HBx_P-A of FT:mat_peptide JQ707589_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLETLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707590_HBx_P-A Product feature CHAIN JQ707590_HBx_P-A of FT:mat_peptide JQ707590_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707591_HBx_P-A Product feature CHAIN JQ707591_HBx_P-A of FT:mat_peptide JQ707591_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C29). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707592_HBx_P-A Product feature CHAIN JQ707592_HBx_P-A of FT:mat_peptide JQ707592_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707593_HBx_P-A Product feature CHAIN JQ707593_HBx_P-A of FT:mat_peptide JQ707593_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707594_HBx_P-A Product feature CHAIN JQ707594_HBx_P-A of FT:mat_peptide JQ707594_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707595_HBx_P-A Product feature CHAIN JQ707595_HBx_P-A of FT:mat_peptide JQ707595_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707596_HBx_P-A Product feature CHAIN JQ707596_HBx_P-A of FT:mat_peptide JQ707596_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707597_HBx_P-A Product feature CHAIN JQ707597_HBx_P-A of FT:mat_peptide JQ707597_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707598_HBx_P-A Product feature CHAIN JQ707598_HBx_P-A of FT:mat_peptide JQ707598_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707599_HBx_P-A Product feature CHAIN JQ707599_HBx_P-A of FT:mat_peptide JQ707599_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707600_HBx_P-A Product feature CHAIN JQ707600_HBx_P-A of FT:mat_peptide JQ707600_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C40). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707601_HBx_P-A Product feature CHAIN JQ707601_HBx_P-A of FT:mat_peptide JQ707601_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707602_HBx_P-A Product feature CHAIN JQ707602_HBx_P-A of FT:mat_peptide JQ707602_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C42). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707603_HBx_P-A Product feature CHAIN JQ707603_HBx_P-A of FT:mat_peptide JQ707603_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707604_HBx_P-A Product feature CHAIN JQ707604_HBx_P-A of FT:mat_peptide JQ707604_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707605_HBx_P-A Product feature CHAIN JQ707605_HBx_P-A of FT:mat_peptide JQ707605_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707606_HBx_P-A Product feature CHAIN JQ707606_HBx_P-A of FT:mat_peptide JQ707606_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707607_HBx_P-A Product feature CHAIN JQ707607_HBx_P-A of FT:mat_peptide JQ707607_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707608_HBx_P-A Product feature CHAIN JQ707608_HBx_P-A of FT:mat_peptide JQ707608_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707609_HBx_P-A Product feature CHAIN JQ707609_HBx_P-A of FT:mat_peptide JQ707609_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707610_HBx_P-A Product feature CHAIN JQ707610_HBx_P-A of FT:mat_peptide JQ707610_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707611_HBx_P-A Product feature CHAIN JQ707611_HBx_P-A of FT:mat_peptide JQ707611_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDSVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707612_HBx_P-A Product feature CHAIN JQ707612_HBx_P-A of FT:mat_peptide JQ707612_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707613_HBx_P-A Product feature CHAIN JQ707613_HBx_P-A of FT:mat_peptide JQ707613_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707614_HBx_P-A Product feature CHAIN JQ707614_HBx_P-A of FT:mat_peptide JQ707614_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707615_HBx_P-A Product feature CHAIN JQ707615_HBx_P-A of FT:mat_peptide JQ707615_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707616_HBx_P-A Product feature CHAIN JQ707616_HBx_P-A of FT:mat_peptide JQ707616_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707617_HBx_P-A Product feature CHAIN JQ707617_HBx_P-A of FT:mat_peptide JQ707617_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRYTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707618_HBx_P-A Product feature CHAIN JQ707618_HBx_P-A of FT:mat_peptide JQ707618_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707619_HBx_P-A Product feature CHAIN JQ707619_HBx_P-A of FT:mat_peptide JQ707619_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707620_HBx_P-A Product feature CHAIN JQ707620_HBx_P-A of FT:mat_peptide JQ707620_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707621_HBx_P-A Product feature CHAIN JQ707621_HBx_P-A of FT:mat_peptide JQ707621_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707622_HBx_P-A Product feature CHAIN JQ707622_HBx_P-A of FT:mat_peptide JQ707622_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707623_HBx_P-A Product feature CHAIN JQ707623_HBx_P-A of FT:mat_peptide JQ707623_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707624_HBx_P-A Product feature CHAIN JQ707624_HBx_P-A of FT:mat_peptide JQ707624_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707625_HBx_P-A Product feature CHAIN JQ707625_HBx_P-A of FT:mat_peptide JQ707625_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYMFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707626_HBx_P-A Product feature CHAIN JQ707626_HBx_P-A of FT:mat_peptide JQ707626_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707627_HBx_P-A Product feature CHAIN JQ707627_HBx_P-A of FT:mat_peptide JQ707627_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707628_HBx_P-A Product feature CHAIN JQ707628_HBx_P-A of FT:mat_peptide JQ707628_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707629_HBx_P-A Product feature CHAIN JQ707629_HBx_P-A of FT:mat_peptide JQ707629_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707630_HBx_P-A Product feature CHAIN JQ707630_HBx_P-A of FT:mat_peptide JQ707630_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707631_HBx_P-A Product feature CHAIN JQ707631_HBx_P-A of FT:mat_peptide JQ707631_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707632_HBx_P-A Product feature CHAIN JQ707632_HBx_P-A of FT:mat_peptide JQ707632_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707633_HBx_P-A Product feature CHAIN JQ707633_HBx_P-A of FT:mat_peptide JQ707633_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707634_HBx_P-A Product feature CHAIN JQ707634_HBx_P-A of FT:mat_peptide JQ707634_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707635_HBx_P-A Product feature CHAIN JQ707635_HBx_P-A of FT:mat_peptide JQ707635_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707636_HBx_P-A Product feature CHAIN JQ707636_HBx_P-A of FT:mat_peptide JQ707636_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707637_HBx_P-A Product feature CHAIN JQ707637_HBx_P-A of FT:mat_peptide JQ707637_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707638_HBx_P-A Product feature CHAIN JQ707638_HBx_P-A of FT:mat_peptide JQ707638_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707639_HBx_P-A Product feature CHAIN JQ707639_HBx_P-A of FT:mat_peptide JQ707639_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707640_HBx_P-A Product feature CHAIN JQ707640_HBx_P-A of FT:mat_peptide JQ707640_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707641_HBx_P-A Product feature CHAIN JQ707641_HBx_P-A of FT:mat_peptide JQ707641_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707642_HBx_P-A Product feature CHAIN JQ707642_HBx_P-A of FT:mat_peptide JQ707642_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRSLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707643_HBx_P-A Product feature CHAIN JQ707643_HBx_P-A of FT:mat_peptide JQ707643_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707644_HBx_P-A Product feature CHAIN JQ707644_HBx_P-A of FT:mat_peptide JQ707644_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707645_HBx_P-A Product feature CHAIN JQ707645_HBx_P-A of FT:mat_peptide JQ707645_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707646_HBx_P-A Product feature CHAIN JQ707646_HBx_P-A of FT:mat_peptide JQ707646_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707647_HBx_P-A Product feature CHAIN JQ707647_HBx_P-A of FT:mat_peptide JQ707647_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707648_HBx_P-A Product feature CHAIN JQ707648_HBx_P-A of FT:mat_peptide JQ707648_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707649_HBx_P-A Product feature CHAIN JQ707649_HBx_P-A of FT:mat_peptide JQ707649_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707650_HBx_P-A Product feature CHAIN JQ707650_HBx_P-A of FT:mat_peptide JQ707650_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDYMFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707651_HBx_P-A Product feature CHAIN JQ707651_HBx_P-A of FT:mat_peptide JQ707651_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707652_HBx_P-A Product feature CHAIN JQ707652_HBx_P-A of FT:mat_peptide JQ707652_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707653_HBx_P-A Product feature CHAIN JQ707653_HBx_P-A of FT:mat_peptide JQ707653_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707654_HBx_P-A Product feature CHAIN JQ707654_HBx_P-A of FT:mat_peptide JQ707654_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707655_HBx_P-A Product feature CHAIN JQ707655_HBx_P-A of FT:mat_peptide JQ707655_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707656_HBx_P-A Product feature CHAIN JQ707656_HBx_P-A of FT:mat_peptide JQ707656_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707658_HBx_P-A Product feature CHAIN JQ707658_HBx_P-A of FT:mat_peptide JQ707658_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707659_HBx_P-A Product feature CHAIN JQ707659_HBx_P-A of FT:mat_peptide JQ707659_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHTRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707661_HBx_P-A Product feature CHAIN JQ707661_HBx_P-A of FT:mat_peptide JQ707661_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707662_HBx_P-A Product feature CHAIN JQ707662_HBx_P-A of FT:mat_peptide JQ707662_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707663_HBx_P-A Product feature CHAIN JQ707663_HBx_P-A of FT:mat_peptide JQ707663_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707664_HBx_P-A Product feature CHAIN JQ707664_HBx_P-A of FT:mat_peptide JQ707664_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707665_HBx_P-A Product feature CHAIN JQ707665_HBx_P-A of FT:mat_peptide JQ707665_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707667_HBx_P-A Product feature CHAIN JQ707667_HBx_P-A of FT:mat_peptide JQ707667_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707669_HBx_P-A Product feature CHAIN JQ707669_HBx_P-A of FT:mat_peptide JQ707669_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707670_HBx_P-A Product feature CHAIN JQ707670_HBx_P-A of FT:mat_peptide JQ707670_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707672_HBx_P-A Product feature CHAIN JQ707672_HBx_P-A of FT:mat_peptide JQ707672_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707674_HBx_P-A Product feature CHAIN JQ707674_HBx_P-A of FT:mat_peptide JQ707674_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707675_HBx_P-A Product feature CHAIN JQ707675_HBx_P-A of FT:mat_peptide JQ707675_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707676_HBx_P-A Product feature CHAIN JQ707676_HBx_P-A of FT:mat_peptide JQ707676_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707681_HBx_P-A Product feature CHAIN JQ707681_HBx_P-A of FT:mat_peptide JQ707681_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX096952_HBx_P-A Product feature CHAIN JX096952_HBx_P-A of FT:mat_peptide JX096952_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX096953_HBx_P-A Product feature CHAIN JX096953_HBx_P-A of FT:mat_peptide JX096953_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX154579_HBx_P-A Product feature CHAIN JX154579_HBx_P-A of FT:mat_peptide JX154579_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|JX154580_HBx_P-A Product feature CHAIN JX154580_HBx_P-A of FT:mat_peptide JX154580_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|JX154581_HBx_P-A Product feature CHAIN JX154581_HBx_P-A of FT:mat_peptide JX154581_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|JX154582_HBx_P-A Product feature CHAIN JX154582_HBx_P-A of FT:mat_peptide JX154582_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMICVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX310722_HBx_P-A Product feature CHAIN JX310722_HBx_P-A of FT:mat_peptide JX310722_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXXXXXXXSA
>gnl|hbvpro|JX310723_HBx_P-A Product feature CHAIN JX310723_HBx_P-A of FT:mat_peptide JX310723_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXXXXXXXSA
>gnl|hbvpro|KC875251_HBx_P-A Product feature CHAIN KC875251_HBx_P-A of FT:mat_peptide KC875251_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTVGLPAMSTTDLEASFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875252_HBx_P-A Product feature CHAIN KC875252_HBx_P-A of FT:mat_peptide KC875252_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875253_HBx_P-A Product feature CHAIN KC875253_HBx_P-A of FT:mat_peptide KC875253_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSMTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875254_HBx_P-A Product feature CHAIN KC875254_HBx_P-A of FT:mat_peptide KC875254_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV12). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSTRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPDCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGSCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875255_HBx_P-A Product feature CHAIN KC875255_HBx_P-A of FT:mat_peptide KC875255_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHGAHLSLHGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875256_HBx_P-A Product feature CHAIN KC875256_HBx_P-A of FT:mat_peptide KC875256_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHGAHLSLHGLPVCAFSPAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSRNFFTSA
>gnl|hbvpro|KC875257_HBx_P-A Product feature CHAIN KC875257_HBx_P-A of FT:mat_peptide KC875257_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV14). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESPGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875258_HBx_P-A Product feature CHAIN KC875258_HBx_P-A of FT:mat_peptide KC875258_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV66). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875259_HBx_P-A Product feature CHAIN KC875259_HBx_P-A of FT:mat_peptide KC875259_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEITLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KC875260_HBx_P-A Product feature CHAIN KC875260_HBx_P-A of FT:mat_peptide KC875260_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSMTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF214657_HBx_P-A Product feature CHAIN KF214657_HBx_P-A of FT:mat_peptide KF214657_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KF214658_HBx_P-A Product feature CHAIN KF214658_HBx_P-A of FT:mat_peptide KF214658_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAHFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KF214659_HBx_P-A Product feature CHAIN KF214659_HBx_P-A of FT:mat_peptide KF214659_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF214660_HBx_P-A Product feature CHAIN KF214660_HBx_P-A of FT:mat_peptide KF214660_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSASAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPSMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF214661_HBx_P-A Product feature CHAIN KF214661_HBx_P-A of FT:mat_peptide KF214661_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHPVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF214662_HBx_P-A Product feature CHAIN KF214662_HBx_P-A of FT:mat_peptide KF214662_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEDLGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF214663_HBx_P-A Product feature CHAIN KF214663_HBx_P-A of FT:mat_peptide KF214663_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF214665_HBx_P-A Product feature CHAIN KF214665_HBx_P-A of FT:mat_peptide KF214665_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214666_HBx_P-A Product feature CHAIN KF214666_HBx_P-A of FT:mat_peptide KF214666_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLSAMSMTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922406_HBx_P-A Product feature CHAIN KF922406_HBx_P-A of FT:mat_peptide KF922406_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922407_HBx_P-A Product feature CHAIN KF922407_HBx_P-A of FT:mat_peptide KF922407_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922408_HBx_P-A Product feature CHAIN KF922408_HBx_P-A of FT:mat_peptide KF922408_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922409_HBx_P-A Product feature CHAIN KF922409_HBx_P-A of FT:mat_peptide KF922409_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922414_HBx_P-A Product feature CHAIN KF922414_HBx_P-A of FT:mat_peptide KF922414_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KF922415_HBx_P-A Product feature CHAIN KF922415_HBx_P-A of FT:mat_peptide KF922415_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KF922416_HBx_P-A Product feature CHAIN KF922416_HBx_P-A of FT:mat_peptide KF922416_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KF922417_HBx_P-A Product feature CHAIN KF922417_HBx_P-A of FT:mat_peptide KF922417_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922418_HBx_P-A Product feature CHAIN KF922418_HBx_P-A of FT:mat_peptide KF922418_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922419_HBx_P-A Product feature CHAIN KF922419_HBx_P-A of FT:mat_peptide KF922419_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922420_HBx_P-A Product feature CHAIN KF922420_HBx_P-A of FT:mat_peptide KF922420_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922421_HBx_P-A Product feature CHAIN KF922421_HBx_P-A of FT:mat_peptide KF922421_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEMRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922424_HBx_P-A Product feature CHAIN KF922424_HBx_P-A of FT:mat_peptide KF922424_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TSVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922425_HBx_P-A Product feature CHAIN KF922425_HBx_P-A of FT:mat_peptide KF922425_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TSVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922426_HBx_P-A Product feature CHAIN KF922426_HBx_P-A of FT:mat_peptide KF922426_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922427_HBx_P-A Product feature CHAIN KF922427_HBx_P-A of FT:mat_peptide KF922427_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922428_HBx_P-A Product feature CHAIN KF922428_HBx_P-A of FT:mat_peptide KF922428_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KF922429_HBx_P-A Product feature CHAIN KF922429_HBx_P-A of FT:mat_peptide KF922429_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922430_HBx_P-A Product feature CHAIN KF922430_HBx_P-A of FT:mat_peptide KF922430_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922431_HBx_P-A Product feature CHAIN KF922431_HBx_P-A of FT:mat_peptide KF922431_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922433_HBx_P-A Product feature CHAIN KF922433_HBx_P-A of FT:mat_peptide KF922433_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KF922434_HBx_P-A Product feature CHAIN KF922434_HBx_P-A of FT:mat_peptide KF922434_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KF922435_HBx_P-A Product feature CHAIN KF922435_HBx_P-A of FT:mat_peptide KF922435_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922436_HBx_P-A Product feature CHAIN KF922436_HBx_P-A of FT:mat_peptide KF922436_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922437_HBx_P-A Product feature CHAIN KF922437_HBx_P-A of FT:mat_peptide KF922437_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ010776_HBx_P-A Product feature CHAIN KJ010776_HBx_P-A of FT:mat_peptide KJ010776_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ010777_HBx_P-A Product feature CHAIN KJ010777_HBx_P-A of FT:mat_peptide KJ010777_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ010778_HBx_P-A Product feature CHAIN KJ010778_HBx_P-A of FT:mat_peptide KJ010778_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ586809_HBx_P-A Product feature CHAIN KJ586809_HBx_P-A of FT:mat_peptide KJ586809_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843166_HBx_P-A Product feature CHAIN KJ843166_HBx_P-A of FT:mat_peptide KJ843166_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843172_HBx_P-A Product feature CHAIN KJ843172_HBx_P-A of FT:mat_peptide KJ843172_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843173_HBx_P-A Product feature CHAIN KJ843173_HBx_P-A of FT:mat_peptide KJ843173_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843182_HBx_P-A Product feature CHAIN KJ843182_HBx_P-A of FT:mat_peptide KJ843182_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843183_HBx_P-A Product feature CHAIN KJ843183_HBx_P-A of FT:mat_peptide KJ843183_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KJ843184_HBx_P-A Product feature CHAIN KJ843184_HBx_P-A of FT:mat_peptide KJ843184_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPTVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCXXKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843186_HBx_P-A Product feature CHAIN KJ843186_HBx_P-A of FT:mat_peptide KJ843186_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843188_HBx_P-A Product feature CHAIN KJ843188_HBx_P-A of FT:mat_peptide KJ843188_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843192_HBx_P-A Product feature CHAIN KJ843192_HBx_P-A of FT:mat_peptide KJ843192_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843214_HBx_P-A Product feature CHAIN KJ843214_HBx_P-A of FT:mat_peptide KJ843214_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843215_HBx_P-A Product feature CHAIN KJ843215_HBx_P-A of FT:mat_peptide KJ843215_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSGMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843216_HBx_P-A Product feature CHAIN KJ843216_HBx_P-A of FT:mat_peptide KJ843216_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSGMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843217_HBx_P-A Product feature CHAIN KJ843217_HBx_P-A of FT:mat_peptide KJ843217_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843218_HBx_P-A Product feature CHAIN KJ843218_HBx_P-A of FT:mat_peptide KJ843218_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854685_HBx_P-A Product feature CHAIN KJ854685_HBx_P-A of FT:mat_peptide KJ854685_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854686_HBx_P-A Product feature CHAIN KJ854686_HBx_P-A of FT:mat_peptide KJ854686_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854687_HBx_P-A Product feature CHAIN KJ854687_HBx_P-A of FT:mat_peptide KJ854687_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCAVRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854688_HBx_P-A Product feature CHAIN KJ854688_HBx_P-A of FT:mat_peptide KJ854688_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854689_HBx_P-A Product feature CHAIN KJ854689_HBx_P-A of FT:mat_peptide KJ854689_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXPCNFFTSA
>gnl|hbvpro|KJ854690_HBx_P-A Product feature CHAIN KJ854690_HBx_P-A of FT:mat_peptide KJ854690_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSSSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854691_HBx_P-A Product feature CHAIN KJ854691_HBx_P-A of FT:mat_peptide KJ854691_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854692_HBx_P-A Product feature CHAIN KJ854692_HBx_P-A of FT:mat_peptide KJ854692_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854694_HBx_P-A Product feature CHAIN KJ854694_HBx_P-A of FT:mat_peptide KJ854694_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822-NE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854695_HBx_P-A Product feature CHAIN KJ854695_HBx_P-A of FT:mat_peptide KJ854695_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1814-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLXKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFXXXX
>gnl|hbvpro|KJ854696_HBx_P-A Product feature CHAIN KJ854696_HBx_P-A of FT:mat_peptide KJ854696_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854697_HBx_P-A Product feature CHAIN KJ854697_HBx_P-A of FT:mat_peptide KJ854697_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854699_HBx_P-A Product feature CHAIN KJ854699_HBx_P-A of FT:mat_peptide KJ854699_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340-N-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHGAHFSLRSLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854700_HBx_P-A Product feature CHAIN KJ854700_HBx_P-A of FT:mat_peptide KJ854700_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313-N-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGSLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854701_HBx_P-A Product feature CHAIN KJ854701_HBx_P-A of FT:mat_peptide KJ854701_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854702_HBx_P-A Product feature CHAIN KJ854702_HBx_P-A of FT:mat_peptide KJ854702_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41-CW-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854703_HBx_P-A Product feature CHAIN KJ854703_HBx_P-A of FT:mat_peptide KJ854703_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854704_HBx_P-A Product feature CHAIN KJ854704_HBx_P-A of FT:mat_peptide KJ854704_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66-CW-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVCAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854705_HBx_P-A Product feature CHAIN KJ854705_HBx_P-A of FT:mat_peptide KJ854705_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67-CW-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854706_HBx_P-A Product feature CHAIN KJ854706_HBx_P-A of FT:mat_peptide KJ854706_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753-CW-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854707_HBx_P-A Product feature CHAIN KJ854707_HBx_P-A of FT:mat_peptide KJ854707_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895-N-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLTRPLGNLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854708_HBx_P-A Product feature CHAIN KJ854708_HBx_P-A of FT:mat_peptide KJ854708_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16-S-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ854709_HBx_P-A Product feature CHAIN KJ854709_HBx_P-A of FT:mat_peptide KJ854709_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24-S-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSGGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVXXXXXXXFFTSA
>gnl|hbvpro|KJ854710_HBx_P-A Product feature CHAIN KJ854710_HBx_P-A of FT:mat_peptide KJ854710_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274-SE-BRA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM243029_HBx_P-A Product feature CHAIN KM243029_HBx_P-A of FT:mat_peptide KM243029_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TAC455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM519452_HBx_P-A Product feature CHAIN KM519452_HBx_P-A of FT:mat_peptide KM519452_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KM519453_HBx_P-A Product feature CHAIN KM519453_HBx_P-A of FT:mat_peptide KM519453_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KM519454_HBx_P-A Product feature CHAIN KM519454_HBx_P-A of FT:mat_peptide KM519454_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIKLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606737_HBx_P-A Product feature CHAIN KM606737_HBx_P-A of FT:mat_peptide KM606737_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPTSCNFFTSA
>gnl|hbvpro|KM606742_HBx_P-A Product feature CHAIN KM606742_HBx_P-A of FT:mat_peptide KM606742_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606746_HBx_P-A Product feature CHAIN KM606746_HBx_P-A of FT:mat_peptide KM606746_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606748_HBx_P-A Product feature CHAIN KM606748_HBx_P-A of FT:mat_peptide KM606748_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KM606749_HBx_P-A Product feature CHAIN KM606749_HBx_P-A of FT:mat_peptide KM606749_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168422_HBx_P-A Product feature CHAIN KP168422_HBx_P-A of FT:mat_peptide KP168422_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN136). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHWILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168423_HBx_P-A Product feature CHAIN KP168423_HBx_P-A of FT:mat_peptide KP168423_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSTSTVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168424_HBx_P-A Product feature CHAIN KP168424_HBx_P-A of FT:mat_peptide KP168424_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYWQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALPFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168425_HBx_P-A Product feature CHAIN KP168425_HBx_P-A of FT:mat_peptide KP168425_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLXLPTMSATDLEAYFKDCVFKDWEELGEEIKLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168426_HBx_P-A Product feature CHAIN KP168426_HBx_P-A of FT:mat_peptide KP168426_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGTLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168427_HBx_P-A Product feature CHAIN KP168427_HBx_P-A of FT:mat_peptide KP168427_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRXRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168428_HBx_P-A Product feature CHAIN KP168428_HBx_P-A of FT:mat_peptide KP168428_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KP168429_HBx_P-A Product feature CHAIN KP168429_HBx_P-A of FT:mat_peptide KP168429_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDILCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168430_HBx_P-A Product feature CHAIN KP168430_HBx_P-A of FT:mat_peptide KP168430_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KP168431_HBx_P-A Product feature CHAIN KP168431_HBx_P-A of FT:mat_peptide KP168431_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM03). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPXCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KP168432_HBx_P-A Product feature CHAIN KP168432_HBx_P-A of FT:mat_peptide KP168432_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGAESRGRPLARPLGNLSSPSPSAVPSDHGAHLSLRGLPICAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSACNFFTSA
>gnl|hbvpro|KP168433_HBx_P-A Product feature CHAIN KP168433_HBx_P-A of FT:mat_peptide KP168433_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHGAHLSLRGLPICAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPXXCNFFTSA
>gnl|hbvpro|KP168434_HBx_P-A Product feature CHAIN KP168434_HBx_P-A of FT:mat_peptide KP168434_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRNVLCLRPVGAESRGRPLARTLGSVSSPSPSTVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP168435_HBx_P-A Product feature CHAIN KP168435_HBx_P-A of FT:mat_peptide KP168435_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDSSRDVLCLRSVGAESRGRPLSGPLGALSAPSPSAVPSDHGAHLSLRGLPVRSSSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KP274925_HBx_P-A Product feature CHAIN KP274925_HBx_P-A of FT:mat_peptide KP274925_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP274927_HBx_P-A Product feature CHAIN KP274927_HBx_P-A of FT:mat_peptide KP274927_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQLLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP274928_HBx_P-A Product feature CHAIN KP274928_HBx_P-A of FT:mat_peptide KP274928_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718085_HBx_P-A Product feature CHAIN KP718085_HBx_P-A of FT:mat_peptide KP718085_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-12-1-26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRXLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718086_HBx_P-A Product feature CHAIN KP718086_HBx_P-A of FT:mat_peptide KP718086_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-03-02-1-60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKXTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718087_HBx_P-A Product feature CHAIN KP718087_HBx_P-A of FT:mat_peptide KP718087_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1897). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718088_HBx_P-A Product feature CHAIN KP718088_HBx_P-A of FT:mat_peptide KP718088_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1162). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718089_HBx_P-A Product feature CHAIN KP718089_HBx_P-A of FT:mat_peptide KP718089_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1249). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718090_HBx_P-A Product feature CHAIN KP718090_HBx_P-A of FT:mat_peptide KP718090_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1348). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTXA
>gnl|hbvpro|KP718091_HBx_P-A Product feature CHAIN KP718091_HBx_P-A of FT:mat_peptide KP718091_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1771). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTXA
>gnl|hbvpro|KP718092_HBx_P-A Product feature CHAIN KP718092_HBx_P-A of FT:mat_peptide KP718092_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1891). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718093_HBx_P-A Product feature CHAIN KP718093_HBx_P-A of FT:mat_peptide KP718093_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1202). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFYTSA
>gnl|hbvpro|KP718094_HBx_P-A Product feature CHAIN KP718094_HBx_P-A of FT:mat_peptide KP718094_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718095_HBx_P-A Product feature CHAIN KP718095_HBx_P-A of FT:mat_peptide KP718095_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718096_HBx_P-A Product feature CHAIN KP718096_HBx_P-A of FT:mat_peptide KP718096_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-0004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718097_HBx_P-A Product feature CHAIN KP718097_HBx_P-A of FT:mat_peptide KP718097_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-1943). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718098_HBx_P-A Product feature CHAIN KP718098_HBx_P-A of FT:mat_peptide KP718098_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718099_HBx_P-A Product feature CHAIN KP718099_HBx_P-A of FT:mat_peptide KP718099_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-378). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718100_HBx_P-A Product feature CHAIN KP718100_HBx_P-A of FT:mat_peptide KP718100_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718101_HBx_P-A Product feature CHAIN KP718101_HBx_P-A of FT:mat_peptide KP718101_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11-3018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP718102_HBx_P-A Product feature CHAIN KP718102_HBx_P-A of FT:mat_peptide KP718102_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP12-1400). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALHFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP995108_HBx_P-A Product feature CHAIN KP995108_HBx_P-A of FT:mat_peptide KP995108_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203-Cirrhosis). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAVLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR905425_HBx_P-A Product feature CHAIN KR905425_HBx_P-A of FT:mat_peptide KR905425_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905426_HBx_P-A Product feature CHAIN KR905426_HBx_P-A of FT:mat_peptide KR905426_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905427_HBx_P-A Product feature CHAIN KR905427_HBx_P-A of FT:mat_peptide KR905427_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHPVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905429_HBx_P-A Product feature CHAIN KR905429_HBx_P-A of FT:mat_peptide KR905429_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLRLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905430_HBx_P-A Product feature CHAIN KR905430_HBx_P-A of FT:mat_peptide KR905430_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KR905431_HBx_P-A Product feature CHAIN KR905431_HBx_P-A of FT:mat_peptide KR905431_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-77). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151611_HBx_P-A Product feature CHAIN KT151611_HBx_P-A of FT:mat_peptide KT151611_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 398). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXSFGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTLNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151612_HBx_P-A Product feature CHAIN KT151612_HBx_P-A of FT:mat_peptide KT151612_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKMVCAPSSCNFFTSA
>gnl|hbvpro|KT151613_HBx_P-A Product feature CHAIN KT151613_HBx_P-A of FT:mat_peptide KT151613_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 792). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGBVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151614_HBx_P-A Product feature CHAIN KT151614_HBx_P-A of FT:mat_peptide KT151614_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLXAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT151615_HBx_P-A Product feature CHAIN KT151615_HBx_P-A of FT:mat_peptide KT151615_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLXKRTLGLSAMSTTDLEAYFKDCVFKDWEEXGEEIRLXXFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151616_HBx_P-A Product feature CHAIN KT151616_HBx_P-A of FT:mat_peptide KT151616_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 655). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT151617_HBx_P-A Product feature CHAIN KT151617_HBx_P-A of FT:mat_peptide KT151617_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSPXGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKMVCAPSSCNFFTSA
>gnl|hbvpro|KT151618_HBx_P-A Product feature CHAIN KT151618_HBx_P-A of FT:mat_peptide KT151618_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 590). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT347087_HBx_P-A Product feature CHAIN KT347087_HBx_P-A of FT:mat_peptide KT347087_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT347088_HBx_P-A Product feature CHAIN KT347088_HBx_P-A of FT:mat_peptide KT347088_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT347091_HBx_P-A Product feature CHAIN KT347091_HBx_P-A of FT:mat_peptide KT347091_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHRILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT347092_HBx_P-A Product feature CHAIN KT347092_HBx_P-A of FT:mat_peptide KT347092_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366466_HBx_P-A Product feature CHAIN KT366466_HBx_P-A of FT:mat_peptide KT366466_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366467_HBx_P-A Product feature CHAIN KT366467_HBx_P-A of FT:mat_peptide KT366467_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366468_HBx_P-A Product feature CHAIN KT366468_HBx_P-A of FT:mat_peptide KT366468_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366469_HBx_P-A Product feature CHAIN KT366469_HBx_P-A of FT:mat_peptide KT366469_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366470_HBx_P-A Product feature CHAIN KT366470_HBx_P-A of FT:mat_peptide KT366470_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT366471_HBx_P-A Product feature CHAIN KT366471_HBx_P-A of FT:mat_peptide KT366471_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KT749822_HBx_P-A Product feature CHAIN KT749822_HBx_P-A of FT:mat_peptide KT749822_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749824_HBx_P-A Product feature CHAIN KT749824_HBx_P-A of FT:mat_peptide KT749824_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749825_HBx_P-A Product feature CHAIN KT749825_HBx_P-A of FT:mat_peptide KT749825_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749826_HBx_P-A Product feature CHAIN KT749826_HBx_P-A of FT:mat_peptide KT749826_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749829_HBx_P-A Product feature CHAIN KT749829_HBx_P-A of FT:mat_peptide KT749829_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749830_HBx_P-A Product feature CHAIN KT749830_HBx_P-A of FT:mat_peptide KT749830_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749831_HBx_P-A Product feature CHAIN KT749831_HBx_P-A of FT:mat_peptide KT749831_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749832_HBx_P-A Product feature CHAIN KT749832_HBx_P-A of FT:mat_peptide KT749832_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749833_HBx_P-A Product feature CHAIN KT749833_HBx_P-A of FT:mat_peptide KT749833_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9b). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749834_HBx_P-A Product feature CHAIN KT749834_HBx_P-A of FT:mat_peptide KT749834_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749835_HBx_P-A Product feature CHAIN KT749835_HBx_P-A of FT:mat_peptide KT749835_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749836_HBx_P-A Product feature CHAIN KT749836_HBx_P-A of FT:mat_peptide KT749836_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749837_HBx_P-A Product feature CHAIN KT749837_HBx_P-A of FT:mat_peptide KT749837_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749838_HBx_P-A Product feature CHAIN KT749838_HBx_P-A of FT:mat_peptide KT749838_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749839_HBx_P-A Product feature CHAIN KT749839_HBx_P-A of FT:mat_peptide KT749839_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749840_HBx_P-A Product feature CHAIN KT749840_HBx_P-A of FT:mat_peptide KT749840_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TPVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749842_HBx_P-A Product feature CHAIN KT749842_HBx_P-A of FT:mat_peptide KT749842_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KT749843_HBx_P-A Product feature CHAIN KT749843_HBx_P-A of FT:mat_peptide KT749843_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749844_HBx_P-A Product feature CHAIN KT749844_HBx_P-A of FT:mat_peptide KT749844_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749846_HBx_P-A Product feature CHAIN KT749846_HBx_P-A of FT:mat_peptide KT749846_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749847_HBx_P-A Product feature CHAIN KT749847_HBx_P-A of FT:mat_peptide KT749847_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749849_HBx_P-A Product feature CHAIN KT749849_HBx_P-A of FT:mat_peptide KT749849_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749850_HBx_P-A Product feature CHAIN KT749850_HBx_P-A of FT:mat_peptide KT749850_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU605532_HBx_P-A Product feature CHAIN KU605532_HBx_P-A of FT:mat_peptide KU605532_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPRTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU605533_HBx_P-A Product feature CHAIN KU605533_HBx_P-A of FT:mat_peptide KU605533_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRSKVFVLGGCRHKLVCAPSSCKFFTSA
>gnl|hbvpro|KU605534_HBx_P-A Product feature CHAIN KU605534_HBx_P-A of FT:mat_peptide KU605534_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTGNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDSMFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KU605535_HBx_P-A Product feature CHAIN KU605535_HBx_P-A of FT:mat_peptide KU605535_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=153 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRQLKLVCAPCNFFTSA
>gnl|hbvpro|KU605536_HBx_P-A Product feature CHAIN KU605536_HBx_P-A of FT:mat_peptide KU605536_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=153 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSRSPKFFTSA
>gnl|hbvpro|KU605537_HBx_P-A Product feature CHAIN KU605537_HBx_P-A of FT:mat_peptide KU605537_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU605538_HBx_P-A Product feature CHAIN KU605538_HBx_P-A of FT:mat_peptide KU605538_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU605539_HBx_P-A Product feature CHAIN KU605539_HBx_P-A of FT:mat_peptide KU605539_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736918_HBx_P-A Product feature CHAIN KU736918_HBx_P-A of FT:mat_peptide KU736918_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KU736919_HBx_P-A Product feature CHAIN KU736919_HBx_P-A of FT:mat_peptide KU736919_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KU736920_HBx_P-A Product feature CHAIN KU736920_HBx_P-A of FT:mat_peptide KU736920_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHGAHLSLXGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX276769_HBx_P-A Product feature CHAIN KX276769_HBx_P-A of FT:mat_peptide KX276769_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVXAESRGRPLAGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357642_HBx_P-A Product feature CHAIN KX357642_HBx_P-A of FT:mat_peptide KX357642_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357643_HBx_P-A Product feature CHAIN KX357643_HBx_P-A of FT:mat_peptide KX357643_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357644_HBx_P-A Product feature CHAIN KX357644_HBx_P-A of FT:mat_peptide KX357644_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA152ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHRSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357645_HBx_P-A Product feature CHAIN KX357645_HBx_P-A of FT:mat_peptide KX357645_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357646_HBx_P-A Product feature CHAIN KX357646_HBx_P-A of FT:mat_peptide KX357646_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357647_HBx_P-A Product feature CHAIN KX357647_HBx_P-A of FT:mat_peptide KX357647_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSNHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHWILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357649_HBx_P-A Product feature CHAIN KX357649_HBx_P-A of FT:mat_peptide KX357649_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRSLARPLGSLSSPSSSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTIGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX357650_HBx_P-A Product feature CHAIN KX357650_HBx_P-A of FT:mat_peptide KX357650_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA46ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRIKIFVLGGRRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX648547_HBx_P-A Product feature CHAIN KX648547_HBx_P-A of FT:mat_peptide KX648547_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi12_103). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX648548_HBx_P-A Product feature CHAIN KX648548_HBx_P-A of FT:mat_peptide KX648548_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX648549_HBx_P-A Product feature CHAIN KX648549_HBx_P-A of FT:mat_peptide KX648549_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_172). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|KX827293_HBx_P-A Product feature CHAIN KX827293_HBx_P-A of FT:mat_peptide KX827293_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5.4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827294_HBx_P-A Product feature CHAIN KX827294_HBx_P-A of FT:mat_peptide KX827294_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827295_HBx_P-A Product feature CHAIN KX827295_HBx_P-A of FT:mat_peptide KX827295_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827296_HBx_P-A Product feature CHAIN KX827296_HBx_P-A of FT:mat_peptide KX827296_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827297_HBx_P-A Product feature CHAIN KX827297_HBx_P-A of FT:mat_peptide KX827297_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827298_HBx_P-A Product feature CHAIN KX827298_HBx_P-A of FT:mat_peptide KX827298_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVSAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY003230_HBx_P-A Product feature CHAIN KY003230_HBx_P-A of FT:mat_peptide KY003230_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20160922). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY382410_HBx_P-A Product feature CHAIN KY382410_HBx_P-A of FT:mat_peptide KY382410_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY886219_HBx_P-A Product feature CHAIN KY886219_HBx_P-A of FT:mat_peptide KY886219_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|L13994_HBx_P-A Product feature CHAIN L13994_HBx_P-A of FT:mat_peptide L13994_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MGARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVCVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC051141_HBx_P-A Product feature CHAIN LC051141_HBx_P-A of FT:mat_peptide LC051141_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0620). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPPSCNFFTSA
>gnl|hbvpro|LC074724_HBx_P-A Product feature CHAIN LC074724_HBx_P-A of FT:mat_peptide LC074724_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC311241_HBx_P-A Product feature CHAIN LC311241_HBx_P-A of FT:mat_peptide LC311241_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC311242_HBx_P-A Product feature CHAIN LC311242_HBx_P-A of FT:mat_peptide LC311242_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC311243_HBx_P-A Product feature CHAIN LC311243_HBx_P-A of FT:mat_peptide LC311243_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC458430_HBx_P-A Product feature CHAIN LC458430_HBx_P-A of FT:mat_peptide LC458430_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC458431_HBx_P-A Product feature CHAIN LC458431_HBx_P-A of FT:mat_peptide LC458431_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LT992441_HBx_P-A Product feature CHAIN LT992441_HBx_P-A of FT:mat_peptide LT992441_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGFLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALHFTXARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|M57663_HBx_P-A Product feature CHAIN M57663_HBx_P-A of FT:mat_peptide M57663_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
IAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPLSCNFFTSA
>gnl|hbvpro|MF772344_HBx_P-A Product feature CHAIN MF772344_HBx_P-A of FT:mat_peptide MF772344_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772345_HBx_P-A Product feature CHAIN MF772345_HBx_P-A of FT:mat_peptide MF772345_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1959). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772346_HBx_P-A Product feature CHAIN MF772346_HBx_P-A of FT:mat_peptide MF772346_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFTSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772347_HBx_P-A Product feature CHAIN MF772347_HBx_P-A of FT:mat_peptide MF772347_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 970). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772348_HBx_P-A Product feature CHAIN MF772348_HBx_P-A of FT:mat_peptide MF772348_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEMRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772349_HBx_P-A Product feature CHAIN MF772349_HBx_P-A of FT:mat_peptide MF772349_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1840). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQXLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772350_HBx_P-A Product feature CHAIN MF772350_HBx_P-A of FT:mat_peptide MF772350_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCKHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772351_HBx_P-A Product feature CHAIN MF772351_HBx_P-A of FT:mat_peptide MF772351_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHLILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF772353_HBx_P-A Product feature CHAIN MF772353_HBx_P-A of FT:mat_peptide MF772353_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF925361_HBx_P-A Product feature CHAIN MF925361_HBx_P-A of FT:mat_peptide MF925361_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925362_HBx_P-A Product feature CHAIN MF925362_HBx_P-A of FT:mat_peptide MF925362_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV05). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALPSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925368_HBx_P-A Product feature CHAIN MF925368_HBx_P-A of FT:mat_peptide MF925368_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPALSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925372_HBx_P-A Product feature CHAIN MF925372_HBx_P-A of FT:mat_peptide MF925372_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSLSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925373_HBx_P-A Product feature CHAIN MF925373_HBx_P-A of FT:mat_peptide MF925373_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925385_HBx_P-A Product feature CHAIN MF925385_HBx_P-A of FT:mat_peptide MF925385_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925400_HBx_P-A Product feature CHAIN MF925400_HBx_P-A of FT:mat_peptide MF925400_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGDLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MF925407_HBx_P-A Product feature CHAIN MF925407_HBx_P-A of FT:mat_peptide MF925407_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464808_HBx_P-A Product feature CHAIN MH464808_HBx_P-A of FT:mat_peptide MH464808_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPLTGPLXTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAXQILPKVLXKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMXFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464809_HBx_P-A Product feature CHAIN MH464809_HBx_P-A of FT:mat_peptide MH464809_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA87). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVXVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464810_HBx_P-A Product feature CHAIN MH464810_HBx_P-A of FT:mat_peptide MH464810_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSXNFFTSA
>gnl|hbvpro|MH464811_HBx_P-A Product feature CHAIN MH464811_HBx_P-A of FT:mat_peptide MH464811_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA89). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARXME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|MH464812_HBx_P-A Product feature CHAIN MH464812_HBx_P-A of FT:mat_peptide MH464812_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA90). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVSSVHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464813_HBx_P-A Product feature CHAIN MH464813_HBx_P-A of FT:mat_peptide MH464813_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464814_HBx_P-A Product feature CHAIN MH464814_HBx_P-A of FT:mat_peptide MH464814_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464815_HBx_P-A Product feature CHAIN MH464815_HBx_P-A of FT:mat_peptide MH464815_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464817_HBx_P-A Product feature CHAIN MH464817_HBx_P-A of FT:mat_peptide MH464817_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464818_HBx_P-A Product feature CHAIN MH464818_HBx_P-A of FT:mat_peptide MH464818_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464825_HBx_P-A Product feature CHAIN MH464825_HBx_P-A of FT:mat_peptide MH464825_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPFSCNFFTSA
>gnl|hbvpro|MH464828_HBx_P-A Product feature CHAIN MH464828_HBx_P-A of FT:mat_peptide MH464828_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464830_HBx_P-A Product feature CHAIN MH464830_HBx_P-A of FT:mat_peptide MH464830_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH580627_HBx_P-A Product feature CHAIN MH580627_HBx_P-A of FT:mat_peptide MH580627_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 299). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH580639_HBx_P-A Product feature CHAIN MH580639_HBx_P-A of FT:mat_peptide MH580639_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 420). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH580642_HBx_P-A Product feature CHAIN MH580642_HBx_P-A of FT:mat_peptide MH580642_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 443). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH580643_HBx_P-A Product feature CHAIN MH580643_HBx_P-A of FT:mat_peptide MH580643_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 446). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH932713_HBx_P-A Product feature CHAIN MH932713_HBx_P-A of FT:mat_peptide MH932713_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Hiroshima GtA CL1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK512456_HBx_P-A Product feature CHAIN MK512456_HBx_P-A of FT:mat_peptide MK512456_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3531). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVGAFSPAGPCALRVTSARCME
TTVNAHQSLPKVLHKRTLGLPAMATTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPYSCNFFTSA
>gnl|hbvpro|MK512457_HBx_P-A Product feature CHAIN MK512457_HBx_P-A of FT:mat_peptide MK512457_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3173). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPWSCNFFTSA
>gnl|hbvpro|MK512458_HBx_P-A Product feature CHAIN MK512458_HBx_P-A of FT:mat_peptide MK512458_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2244). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSTVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512459_HBx_P-A Product feature CHAIN MK512459_HBx_P-A of FT:mat_peptide MK512459_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2226). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512461_HBx_P-A Product feature CHAIN MK512461_HBx_P-A of FT:mat_peptide MK512461_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2157). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSLAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512462_HBx_P-A Product feature CHAIN MK512462_HBx_P-A of FT:mat_peptide MK512462_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSSNFFTSA
>gnl|hbvpro|MK512463_HBx_P-A Product feature CHAIN MK512463_HBx_P-A of FT:mat_peptide MK512463_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2086). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKYCVFKDWEELGEEIRLKVYVLGGCRHKLVCSPSSCNFFTSA
>gnl|hbvpro|MK512464_HBx_P-A Product feature CHAIN MK512464_HBx_P-A of FT:mat_peptide MK512464_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2016). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRSVGSESRGRPLAGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSPAGPCALRVTSARCME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGDEIRLMVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512465_HBx_P-A Product feature CHAIN MK512465_HBx_P-A of FT:mat_peptide MK512465_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSSSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLSIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512466_HBx_P-A Product feature CHAIN MK512466_HBx_P-A of FT:mat_peptide MK512466_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-226). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYLLRGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512468_HBx_P-A Product feature CHAIN MK512468_HBx_P-A of FT:mat_peptide MK512468_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-203). Complete genome. [Hepadnaviridae] (length=154 residues).
MAPRLLCQPDSSRDVLCLRPVGAESRGRPLQGPLGALSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512469_HBx_P-A Product feature CHAIN MK512469_HBx_P-A of FT:mat_peptide MK512469_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-136). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYYQQDSSLDVLCLRSVGAESRARPLQVPPGTGSSPSPSAIPSYHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|MK512470_HBx_P-A Product feature CHAIN MK512470_HBx_P-A of FT:mat_peptide MK512470_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRHVGAESRGRPLQETLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGSCALRFTSARCMA
TNVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512471_HBx_P-A Product feature CHAIN MK512471_HBx_P-A of FT:mat_peptide MK512471_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGALGTLPSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512472_HBx_P-A Product feature CHAIN MK512472_HBx_P-A of FT:mat_peptide MK512472_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPFSCNFFTSA
>gnl|hbvpro|MK512473_HBx_P-A Product feature CHAIN MK512473_HBx_P-A of FT:mat_peptide MK512473_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512474_HBx_P-A Product feature CHAIN MK512474_HBx_P-A of FT:mat_peptide MK512474_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-37). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512475_HBx_P-A Product feature CHAIN MK512475_HBx_P-A of FT:mat_peptide MK512475_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512476_HBx_P-A Product feature CHAIN MK512476_HBx_P-A of FT:mat_peptide MK512476_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MK512477_HBx_P-A Product feature CHAIN MK512477_HBx_P-A of FT:mat_peptide MK512477_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-03). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGPLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILRKVLHKRTLGLPAMSTTDREAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|V00866_HBx_P-A Product feature CHAIN V00866_HBx_P-A of FT:mat_peptide V00866_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X02763_HBx_C-A Product feature CHAIN X02763_HBx_C-A of FT:mat_peptide X02763_HBx_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X51970_HBx_P-A Product feature CHAIN X51970_HBx_P-A of FT:mat_peptide X51970_HBx_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=154 residues).
MATRLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X70185_HBx_P-A Product feature CHAIN X70185_HBx_P-A of FT:mat_peptide X70185_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A938). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|Z35717_HBx_P-A Product feature CHAIN Z35717_HBx_P-A of FT:mat_peptide Z35717_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hb614). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCMA
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|Z72478_HBx_P-A Product feature CHAIN Z72478_HBx_P-A of FT:mat_peptide Z72478_HBx_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A317). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB010289_HBx_P-B Product feature CHAIN AB010289_HBx_P-B of FT:mat_peptide AB010289_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB010290_HBx_P-B Product feature CHAIN AB010290_HBx_P-B of FT:mat_peptide AB010290_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB010291_HBx_P-B Product feature CHAIN AB010291_HBx_P-B of FT:mat_peptide AB010291_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB010292_HBx_P-B Product feature CHAIN AB010292_HBx_P-B of FT:mat_peptide AB010292_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB031266_HBx_P-B Product feature CHAIN AB031266_HBx_P-B of FT:mat_peptide AB031266_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB031267_HBx_P-B Product feature CHAIN AB031267_HBx_P-B of FT:mat_peptide AB031267_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV VietF-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMLTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033554_HBx_P-B Product feature CHAIN AB033554_HBx_P-B of FT:mat_peptide AB033554_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033555_HBx_P-B Product feature CHAIN AB033555_HBx_P-B of FT:mat_peptide AB033555_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB048705_HBx_P-B Product feature CHAIN AB048705_HBx_P-B of FT:mat_peptide AB048705_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGDLPSPSASTVPTIDGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073821_HBx_P-B Product feature CHAIN AB073821_HBx_P-B of FT:mat_peptide AB073821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVSTXHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073822_HBx_P-B Product feature CHAIN AB073822_HBx_P-B of FT:mat_peptide AB073822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073823_HBx_P-B Product feature CHAIN AB073823_HBx_P-B of FT:mat_peptide AB073823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073824_HBx_P-B Product feature CHAIN AB073824_HBx_P-B of FT:mat_peptide AB073824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073825_HBx_P-B Product feature CHAIN AB073825_HBx_P-B of FT:mat_peptide AB073825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AB073826_HBx_P-B Product feature CHAIN AB073826_HBx_P-B of FT:mat_peptide AB073826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073827_HBx_P-B Product feature CHAIN AB073827_HBx_P-B of FT:mat_peptide AB073827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTKHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073828_HBx_P-B Product feature CHAIN AB073828_HBx_P-B of FT:mat_peptide AB073828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073829_HBx_P-B Product feature CHAIN AB073829_HBx_P-B of FT:mat_peptide AB073829_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073830_HBx_P-B Product feature CHAIN AB073830_HBx_P-B of FT:mat_peptide AB073830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH57). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSSRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073831_HBx_P-B Product feature CHAIN AB073831_HBx_P-B of FT:mat_peptide AB073831_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGIPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073832_HBx_P-B Product feature CHAIN AB073832_HBx_P-B of FT:mat_peptide AB073832_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Th65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073833_HBx_P-B Product feature CHAIN AB073833_HBx_P-B of FT:mat_peptide AB073833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073834_HBx_P-B Product feature CHAIN AB073834_HBx_P-B of FT:mat_peptide AB073834_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073835_HBx_P-B Product feature CHAIN AB073835_HBx_P-B of FT:mat_peptide AB073835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073836_HBx_P-B Product feature CHAIN AB073836_HBx_P-B of FT:mat_peptide AB073836_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AB073837_HBx_P-B Product feature CHAIN AB073837_HBx_P-B of FT:mat_peptide AB073837_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ku1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073838_HBx_P-B Product feature CHAIN AB073838_HBx_P-B of FT:mat_peptide AB073838_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ho7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073839_HBx_P-B Product feature CHAIN AB073839_HBx_P-B of FT:mat_peptide AB073839_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw174). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073840_HBx_P-B Product feature CHAIN AB073840_HBx_P-B of FT:mat_peptide AB073840_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073841_HBx_P-B Product feature CHAIN AB073841_HBx_P-B of FT:mat_peptide AB073841_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073842_HBx_P-B Product feature CHAIN AB073842_HBx_P-B of FT:mat_peptide AB073842_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGPLPPAFPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073843_HBx_P-B Product feature CHAIN AB073843_HBx_P-B of FT:mat_peptide AB073843_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Iw27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLXKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073844_HBx_P-B Product feature CHAIN AB073844_HBx_P-B of FT:mat_peptide AB073844_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-T11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPATPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073845_HBx_P-B Product feature CHAIN AB073845_HBx_P-B of FT:mat_peptide AB073845_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ya16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073846_HBx_P-B Product feature CHAIN AB073846_HBx_P-B of FT:mat_peptide AB073846_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRRRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073847_HBx_P-B Product feature CHAIN AB073847_HBx_P-B of FT:mat_peptide AB073847_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Fu53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073848_HBx_P-B Product feature CHAIN AB073848_HBx_P-B of FT:mat_peptide AB073848_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073849_HBx_P-B Product feature CHAIN AB073849_HBx_P-B of FT:mat_peptide AB073849_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSTPPCNFFTSA
>gnl|hbvpro|AB073850_HBx_P-B Product feature CHAIN AB073850_HBx_P-B of FT:mat_peptide AB073850_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPRNFFTSA
>gnl|hbvpro|AB073851_HBx_P-B Product feature CHAIN AB073851_HBx_P-B of FT:mat_peptide AB073851_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073852_HBx_P-B Product feature CHAIN AB073852_HBx_P-B of FT:mat_peptide AB073852_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEMGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073853_HBx_P-B Product feature CHAIN AB073853_HBx_P-B of FT:mat_peptide AB073853_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGDESRGRPLPGPLGALPPASPSAVPTDDGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEETRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AB073854_HBx_P-B Product feature CHAIN AB073854_HBx_P-B of FT:mat_peptide AB073854_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073855_HBx_P-B Product feature CHAIN AB073855_HBx_P-B of FT:mat_peptide AB073855_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry34). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVGAESCGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073856_HBx_P-B Product feature CHAIN AB073856_HBx_P-B of FT:mat_peptide AB073856_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry46). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEERRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073857_HBx_P-B Product feature CHAIN AB073857_HBx_P-B of FT:mat_peptide AB073857_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCKLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB073858_HBx_P-B Product feature CHAIN AB073858_HBx_P-B of FT:mat_peptide AB073858_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Shin). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKIYVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|AB100695_HBx_P-B Product feature CHAIN AB100695_HBx_P-B of FT:mat_peptide AB100695_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHGAHLSLRGLPVCAFSCAGPCALRFTSARRME
TTVNAHRILSKDLRTMTLELSGLSTSDLEAYFKDRVFTEWEELGEEIRLMIFVLGGCTHTLLFSPSPCNFLNSA
>gnl|hbvpro|AB104890_HBx_P-B Product feature CHAIN AB104890_HBx_P-B of FT:mat_peptide AB104890_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNDHRNLSKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCPPVPCNFFTSA
>gnl|hbvpro|AB104891_HBx_P-B Product feature CHAIN AB104891_HBx_P-B of FT:mat_peptide AB104891_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNDHRNLSKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLMIFVLGGCRHKLVCPPVPCNFFTSA
>gnl|hbvpro|AB106884_HBx_P-B Product feature CHAIN AB106884_HBx_P-B of FT:mat_peptide AB106884_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPPGAIPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHQNLPKVLHKRTLGLSAVSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB115551_HBx_P-B Product feature CHAIN AB115551_HBx_P-B of FT:mat_peptide AB115551_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHHTLRGLPVCLFSAAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|AB117759_HBx_P-B Product feature CHAIN AB117759_HBx_P-B of FT:mat_peptide AB117759_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195933_HBx_P-B Product feature CHAIN AB195933_HBx_P-B of FT:mat_peptide AB195933_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195934_HBx_P-B Product feature CHAIN AB195934_HBx_P-B of FT:mat_peptide AB195934_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195935_HBx_P-B Product feature CHAIN AB195935_HBx_P-B of FT:mat_peptide AB195935_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205119_HBx_P-B Product feature CHAIN AB205119_HBx_P-B of FT:mat_peptide AB205119_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205120_HBx_P-B Product feature CHAIN AB205120_HBx_P-B of FT:mat_peptide AB205120_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205121_HBx_P-B Product feature CHAIN AB205121_HBx_P-B of FT:mat_peptide AB205121_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLPGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVLFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205122_HBx_P-B Product feature CHAIN AB205122_HBx_P-B of FT:mat_peptide AB205122_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH69-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTADLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB212625_HBx_P-B Product feature CHAIN AB212625_HBx_P-B of FT:mat_peptide AB212625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB212626_HBx_P-B Product feature CHAIN AB212626_HBx_P-B of FT:mat_peptide AB212626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1022). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKILHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219426_HBx_P-B Product feature CHAIN AB219426_HBx_P-B of FT:mat_peptide AB219426_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTXNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219427_HBx_P-B Product feature CHAIN AB219427_HBx_P-B of FT:mat_peptide AB219427_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4075, PNN2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGAEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219428_HBx_C-B Product feature CHAIN AB219428_HBx_C-B of FT:mat_peptide AB219428_HBx_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219429_HBx_P-B Product feature CHAIN AB219429_HBx_P-B of FT:mat_peptide AB219429_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB219430_HBx_P-B Product feature CHAIN AB219430_HBx_P-B of FT:mat_peptide AB219430_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB231909_HBx_P-B Product feature CHAIN AB231909_HBx_P-B of FT:mat_peptide AB231909_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCRQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB241116_HBx_P-B Product feature CHAIN AB241116_HBx_P-B of FT:mat_peptide AB241116_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC03). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB241117_HBx_P-B Product feature CHAIN AB241117_HBx_P-B of FT:mat_peptide AB241117_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246339_HBx_P-B Product feature CHAIN AB246339_HBx_P-B of FT:mat_peptide AB246339_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246340_HBx_P-B Product feature CHAIN AB246340_HBx_P-B of FT:mat_peptide AB246340_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246341_HBx_P-B Product feature CHAIN AB246341_HBx_P-B of FT:mat_peptide AB246341_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSACRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246342_HBx_P-B Product feature CHAIN AB246342_HBx_P-B of FT:mat_peptide AB246342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSPMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246343_HBx_P-B Product feature CHAIN AB246343_HBx_P-B of FT:mat_peptide AB246343_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSPMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRYKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287314_HBx_P-B Product feature CHAIN AB287314_HBx_P-B of FT:mat_peptide AB287314_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287315_HBx_P-B Product feature CHAIN AB287315_HBx_P-B of FT:mat_peptide AB287315_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287316_HBx_P-B Product feature CHAIN AB287316_HBx_P-B of FT:mat_peptide AB287316_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska427). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRSLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287317_HBx_P-B Product feature CHAIN AB287317_HBx_P-B of FT:mat_peptide AB287317_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska416). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287318_HBx_P-B Product feature CHAIN AB287318_HBx_P-B of FT:mat_peptide AB287318_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287319_HBx_P-B Product feature CHAIN AB287319_HBx_P-B of FT:mat_peptide AB287319_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AlaskaG23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFISARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287320_HBx_P-B Product feature CHAIN AB287320_HBx_P-B of FT:mat_peptide AB287320_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPPDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287321_HBx_P-B Product feature CHAIN AB287321_HBx_P-B of FT:mat_peptide AB287321_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287322_HBx_P-B Product feature CHAIN AB287322_HBx_P-B of FT:mat_peptide AB287322_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAYLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRSLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287323_HBx_P-B Product feature CHAIN AB287323_HBx_P-B of FT:mat_peptide AB287323_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287324_HBx_P-B Product feature CHAIN AB287324_HBx_P-B of FT:mat_peptide AB287324_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-5). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGAPPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287325_HBx_P-B Product feature CHAIN AB287325_HBx_P-B of FT:mat_peptide AB287325_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Greenland-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287326_HBx_P-B Product feature CHAIN AB287326_HBx_P-B of FT:mat_peptide AB287326_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287327_HBx_P-B Product feature CHAIN AB287327_HBx_P-B of FT:mat_peptide AB287327_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Bj A53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287328_HBx_P-B Product feature CHAIN AB287328_HBx_P-B of FT:mat_peptide AB287328_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB287329_HBx_P-B Product feature CHAIN AB287329_HBx_P-B of FT:mat_peptide AB287329_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300364_HBx_P-B Product feature CHAIN AB300364_HBx_P-B of FT:mat_peptide AB300364_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300370_HBx_P-B Product feature CHAIN AB300370_HBx_P-B of FT:mat_peptide AB300370_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302095_HBx_P-B Product feature CHAIN AB302095_HBx_P-B of FT:mat_peptide AB302095_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEQGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302942_HBx_P-B Product feature CHAIN AB302942_HBx_P-B of FT:mat_peptide AB302942_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3837NN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302943_HBx_P-B Product feature CHAIN AB302943_HBx_P-B of FT:mat_peptide AB302943_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3639NN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302944_HBx_P-B Product feature CHAIN AB302944_HBx_P-B of FT:mat_peptide AB302944_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3641NN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB302945_HBx_P-B Product feature CHAIN AB302945_HBx_P-B of FT:mat_peptide AB302945_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GRE3643NN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB362933_HBx_P-B Product feature CHAIN AB362933_HBx_P-B of FT:mat_peptide AB362933_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRALPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB365445_HBx_P-B Product feature CHAIN AB365445_HBx_P-B of FT:mat_peptide AB365445_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BOL1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB368295_HBx_P-B Product feature CHAIN AB368295_HBx_P-B of FT:mat_peptide AB368295_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSSASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471854_HBx_P-B Product feature CHAIN AB471854_HBx_P-B of FT:mat_peptide AB471854_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471855_HBx_P-B Product feature CHAIN AB471855_HBx_P-B of FT:mat_peptide AB471855_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493827_HBx_P-B Product feature CHAIN AB493827_HBx_P-B of FT:mat_peptide AB493827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVPGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493833_HBx_P-B Product feature CHAIN AB493833_HBx_P-B of FT:mat_peptide AB493833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493835_HBx_P-B Product feature CHAIN AB493835_HBx_P-B of FT:mat_peptide AB493835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB555498_HBx_P-B Product feature CHAIN AB555498_HBx_P-B of FT:mat_peptide AB555498_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|AB555499_HBx_P-B Product feature CHAIN AB555499_HBx_P-B of FT:mat_peptide AB555499_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TA62). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSFRGLPVCAFSSAGPSALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGKEFRLMAFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642093_HBx_P-B Product feature CHAIN AB642093_HBx_P-B of FT:mat_peptide AB642093_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642094_HBx_P-B Product feature CHAIN AB642094_HBx_P-B of FT:mat_peptide AB642094_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT1999-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642101_HBx_P-B Product feature CHAIN AB642101_HBx_P-B of FT:mat_peptide AB642101_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BFJT2009-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB675676_HBx_P-B Product feature CHAIN AB675676_HBx_P-B of FT:mat_peptide AB675676_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSSAPCNFFTSA
>gnl|hbvpro|AB713527_HBx_P-B Product feature CHAIN AB713527_HBx_P-B of FT:mat_peptide AB713527_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGTCALRFTSARRKE
NTVNAHRNLPQVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB713528_HBx_P-B Product feature CHAIN AB713528_HBx_P-B of FT:mat_peptide AB713528_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB713529_HBx_P-B Product feature CHAIN AB713529_HBx_P-B of FT:mat_peptide AB713529_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv68). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGTPVCAFSSAGPCALRFTSARRKE
TTVNAHWKLPQVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB713530_HBx_P-B Product feature CHAIN AB713530_HBx_P-B of FT:mat_peptide AB713530_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRRE
TTVNAHRNLPKVLHRRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFSTLAS
>gnl|hbvpro|AB713531_HBx_P-B Product feature CHAIN AB713531_HBx_P-B of FT:mat_peptide AB713531_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB828708_HBx_P-B Product feature CHAIN AB828708_HBx_P-B of FT:mat_peptide AB828708_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HB12-0626). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AB900095_HBx_P-B Product feature CHAIN AB900095_HBx_P-B of FT:mat_peptide AB900095_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900097_HBx_P-B Product feature CHAIN AB900097_HBx_P-B of FT:mat_peptide AB900097_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVVCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900098_HBx_P-B Product feature CHAIN AB900098_HBx_P-B of FT:mat_peptide AB900098_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMIFVXGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900102_HBx_P-B Product feature CHAIN AB900102_HBx_P-B of FT:mat_peptide AB900102_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSVMSTTDLEAYFKDCVFAEWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900103_HBx_P-B Product feature CHAIN AB900103_HBx_P-B of FT:mat_peptide AB900103_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900104_HBx_P-B Product feature CHAIN AB900104_HBx_P-B of FT:mat_peptide AB900104_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900105_HBx_P-B Product feature CHAIN AB900105_HBx_P-B of FT:mat_peptide AB900105_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900106_HBx_P-B Product feature CHAIN AB900106_HBx_P-B of FT:mat_peptide AB900106_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900107_HBx_P-B Product feature CHAIN AB900107_HBx_P-B of FT:mat_peptide AB900107_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCHFFTSA
>gnl|hbvpro|AB900108_HBx_P-B Product feature CHAIN AB900108_HBx_P-B of FT:mat_peptide AB900108_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900110_HBx_P-B Product feature CHAIN AB900110_HBx_P-B of FT:mat_peptide AB900110_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEGRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AB900111_HBx_P-B Product feature CHAIN AB900111_HBx_P-B of FT:mat_peptide AB900111_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLXXFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AB900112_HBx_P-B Product feature CHAIN AB900112_HBx_P-B of FT:mat_peptide AB900112_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRVE
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLXVFVLGGCRHKLVCSPAPRNFFTSA
>gnl|hbvpro|AB931168_HBx_P-B Product feature CHAIN AB931168_HBx_P-B of FT:mat_peptide AB931168_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1P_HB11-1417). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEEMGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB931169_HBx_P-B Product feature CHAIN AB931169_HBx_P-B of FT:mat_peptide AB931169_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1S_HB11-1418). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEEMGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB976562_HBx_P-B Product feature CHAIN AB976562_HBx_P-B of FT:mat_peptide AB976562_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AK8). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTYHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEISEKVAWRWCSKHILLCSPESCNFLTYAL
>gnl|hbvpro|AF100308_HBx_P-B Product feature CHAIN AF100308_HBx_P-B of FT:mat_peptide AF100308_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF100309_HBx_P-B Product feature CHAIN AF100309_HBx_P-B of FT:mat_peptide AF100309_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121243_HBx_P-B Product feature CHAIN AF121243_HBx_P-B of FT:mat_peptide AF121243_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AF121244_HBx_P-B Product feature CHAIN AF121244_HBx_P-B of FT:mat_peptide AF121244_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AF121245_HBx_P-B Product feature CHAIN AF121245_HBx_P-B of FT:mat_peptide AF121245_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AF121246_HBx_P-B Product feature CHAIN AF121246_HBx_P-B of FT:mat_peptide AF121246_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|AF121247_HBx_P-B Product feature CHAIN AF121247_HBx_P-B of FT:mat_peptide AF121247_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121248_HBx_P-B Product feature CHAIN AF121248_HBx_P-B of FT:mat_peptide AF121248_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/139-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121249_HBx_P-B Product feature CHAIN AF121249_HBx_P-B of FT:mat_peptide AF121249_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121250_HBx_P-B Product feature CHAIN AF121250_HBx_P-B of FT:mat_peptide AF121250_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/6395). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF121251_HBx_P-B Product feature CHAIN AF121251_HBx_P-B of FT:mat_peptide AF121251_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/9873). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF282917_HBx_P-B Product feature CHAIN AF282917_HBx_P-B of FT:mat_peptide AF282917_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKALHKRTLGLSATSTTDLEAYFKDCVFTEWEELGEEVRFKVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AF282918_HBx_P-B Product feature CHAIN AF282918_HBx_P-B of FT:mat_peptide AF282918_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDSVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF461360_HBx_P-B Product feature CHAIN AF461360_HBx_P-B of FT:mat_peptide AF461360_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH14-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF479684_HBx_P-B Product feature CHAIN AF479684_HBx_P-B of FT:mat_peptide AF479684_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AJ627225_HBx_P-B Product feature CHAIN AJ627225_HBx_P-B of FT:mat_peptide AJ627225_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 19749). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AP011084_HBx_P-B Product feature CHAIN AP011084_HBx_P-B of FT:mat_peptide AP011084_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPTSPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011085_HBx_P-B Product feature CHAIN AP011085_HBx_P-B of FT:mat_peptide AP011085_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011086_HBx_P-B Product feature CHAIN AP011086_HBx_P-B of FT:mat_peptide AP011086_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011087_HBx_P-B Product feature CHAIN AP011087_HBx_P-B of FT:mat_peptide AP011087_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAVSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011088_HBx_P-B Product feature CHAIN AP011088_HBx_P-B of FT:mat_peptide AP011088_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLYLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011089_HBx_P-B Product feature CHAIN AP011089_HBx_P-B of FT:mat_peptide AP011089_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTIHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011090_HBx_P-B Product feature CHAIN AP011090_HBx_P-B of FT:mat_peptide AP011090_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011091_HBx_P-B Product feature CHAIN AP011091_HBx_P-B of FT:mat_peptide AP011091_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011092_HBx_P-B Product feature CHAIN AP011092_HBx_P-B of FT:mat_peptide AP011092_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDILCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011093_HBx_P-B Product feature CHAIN AP011093_HBx_P-B of FT:mat_peptide AP011093_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011094_HBx_P-B Product feature CHAIN AP011094_HBx_P-B of FT:mat_peptide AP011094_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011095_HBx_P-B Product feature CHAIN AP011095_HBx_P-B of FT:mat_peptide AP011095_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011096_HBx_P-B Product feature CHAIN AP011096_HBx_P-B of FT:mat_peptide AP011096_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY033072_HBx_P-B Product feature CHAIN AY033072_HBx_P-B of FT:mat_peptide AY033072_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY033073_HBx_P-B Product feature CHAIN AY033073_HBx_P-B of FT:mat_peptide AY033073_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY163869_HBx_P-B Product feature CHAIN AY163869_HBx_P-B of FT:mat_peptide AY163869_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMClx-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY163870_HBx_P-B Product feature CHAIN AY163870_HBx_P-B of FT:mat_peptide AY163870_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU001). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167089_HBx_P-B Product feature CHAIN AY167089_HBx_P-B of FT:mat_peptide AY167089_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167093_HBx_P-B Product feature CHAIN AY167093_HBx_P-B of FT:mat_peptide AY167093_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIa). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPLVPTVNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGAEGRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167094_HBx_P-B Product feature CHAIN AY167094_HBx_P-B of FT:mat_peptide AY167094_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIb). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNGAHLSLRGLPVCAFSSTGPCALRFTSARRME
ATVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167097_HBx_P-B Product feature CHAIN AY167097_HBx_P-B of FT:mat_peptide AY167097_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IIIb). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167098_HBx_P-B Product feature CHAIN AY167098_HBx_P-B of FT:mat_peptide AY167098_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167100_HBx_P-B Product feature CHAIN AY167100_HBx_P-B of FT:mat_peptide AY167100_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Va). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVKLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167101_HBx_P-B Product feature CHAIN AY167101_HBx_P-B of FT:mat_peptide AY167101_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vb). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167102_HBx_P-B Product feature CHAIN AY167102_HBx_P-B of FT:mat_peptide AY167102_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vc). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPATPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AY206373_HBx_P-B Product feature CHAIN AY206373_HBx_P-B of FT:mat_peptide AY206373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHVNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AY206375_HBx_P-B Product feature CHAIN AY206375_HBx_P-B of FT:mat_peptide AY206375_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206383_HBx_P-B Product feature CHAIN AY206383_HBx_P-B of FT:mat_peptide AY206383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206387_HBx_P-B Product feature CHAIN AY206387_HBx_P-B of FT:mat_peptide AY206387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEVGNEGRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206390_HBx_P-B Product feature CHAIN AY206390_HBx_P-B of FT:mat_peptide AY206390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206391_HBx_P-B Product feature CHAIN AY206391_HBx_P-B of FT:mat_peptide AY206391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217355_HBx_P-B Product feature CHAIN AY217355_HBx_P-B of FT:mat_peptide AY217355_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A6-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217356_HBx_P-B Product feature CHAIN AY217356_HBx_P-B of FT:mat_peptide AY217356_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A9-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217357_HBx_P-B Product feature CHAIN AY217357_HBx_P-B of FT:mat_peptide AY217357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1r-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217358_HBx_P-B Product feature CHAIN AY217358_HBx_P-B of FT:mat_peptide AY217358_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B8r-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217359_HBx_P-B Product feature CHAIN AY217359_HBx_P-B of FT:mat_peptide AY217359_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217360_HBx_P-B Product feature CHAIN AY217360_HBx_P-B of FT:mat_peptide AY217360_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY217361_HBx_P-B Product feature CHAIN AY217361_HBx_P-B of FT:mat_peptide AY217361_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|AY217362_HBx_P-B Product feature CHAIN AY217362_HBx_P-B of FT:mat_peptide AY217362_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 582-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLSKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|AY217364_HBx_P-B Product feature CHAIN AY217364_HBx_P-B of FT:mat_peptide AY217364_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 586). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLRAVPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFLNSA
>gnl|hbvpro|AY217368_HBx_P-B Product feature CHAIN AY217368_HBx_P-B of FT:mat_peptide AY217368_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21949). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220697_HBx_P-B Product feature CHAIN AY220697_HBx_P-B of FT:mat_peptide AY220697_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEFKLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220698_HBx_P-B Product feature CHAIN AY220698_HBx_P-B of FT:mat_peptide AY220698_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220703_HBx_P-B Product feature CHAIN AY220703_HBx_P-B of FT:mat_peptide AY220703_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220704_HBx_P-B Product feature CHAIN AY220704_HBx_P-B of FT:mat_peptide AY220704_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY238972_HBx_P-B Product feature CHAIN AY238972_HBx_P-B of FT:mat_peptide AY238972_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FMU023). Partial genome (Contains: HBx, LHBs, MHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY283777_HBx_P-B Product feature CHAIN AY283777_HBx_P-B of FT:mat_peptide AY283777_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate spliced variant D-9). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLNPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLMCSPAPCNFFTSA
>gnl|hbvpro|AY293309_HBx_P-B Product feature CHAIN AY293309_HBx_P-B of FT:mat_peptide AY293309_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY310322_HBx_P-B Product feature CHAIN AY310322_HBx_P-B of FT:mat_peptide AY310322_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY518556_HBx_P-B Product feature CHAIN AY518556_HBx_P-B of FT:mat_peptide AY518556_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSATDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596102_HBx_P-B Product feature CHAIN AY596102_HBx_P-B of FT:mat_peptide AY596102_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596103_HBx_P-B Product feature CHAIN AY596103_HBx_P-B of FT:mat_peptide AY596103_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AY596104_HBx_P-B Product feature CHAIN AY596104_HBx_P-B of FT:mat_peptide AY596104_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNGAHLSLRGLPVCAFSSTGPCALRFTSARRME
ATVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596105_HBx_P-B Product feature CHAIN AY596105_HBx_P-B of FT:mat_peptide AY596105_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596106_HBx_P-B Product feature CHAIN AY596106_HBx_P-B of FT:mat_peptide AY596106_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596109_HBx_P-B Product feature CHAIN AY596109_HBx_P-B of FT:mat_peptide AY596109_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596110_HBx_P-B Product feature CHAIN AY596110_HBx_P-B of FT:mat_peptide AY596110_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596111_HBx_P-B Product feature CHAIN AY596111_HBx_P-B of FT:mat_peptide AY596111_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596112_HBx_P-B Product feature CHAIN AY596112_HBx_P-B of FT:mat_peptide AY596112_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY766463_HBx_P-B Product feature CHAIN AY766463_HBx_P-B of FT:mat_peptide AY766463_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY800389_HBx_P-B Product feature CHAIN AY800389_HBx_P-B of FT:mat_peptide AY800389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041024). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY800391_HBx_P-B Product feature CHAIN AY800391_HBx_P-B of FT:mat_peptide AY800391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY800392_HBx_P-B Product feature CHAIN AY800392_HBx_P-B of FT:mat_peptide AY800392_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ZY041027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D00329_HBx_P-B Product feature CHAIN D00329_HBx_P-B of FT:mat_peptide D00329_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D00330_HBx_P-B Product feature CHAIN D00330_HBx_P-B of FT:mat_peptide D00330_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D00331_HBx_C-B Product feature CHAIN D00331_HBx_C-B of FT:mat_peptide D00331_HBx_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAHFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D23678_HBx_P-B Product feature CHAIN D23678_HBx_P-B of FT:mat_peptide D23678_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-HBVYS2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D23679_HBx_P-B Product feature CHAIN D23679_HBx_P-B of FT:mat_peptide D23679_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-HBVMS2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNGHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D50521_HBx_P-B Product feature CHAIN D50521_HBx_P-B of FT:mat_peptide D50521_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D50522_HBx_P-B Product feature CHAIN D50522_HBx_P-B of FT:mat_peptide D50522_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ361535_HBx_P-B Product feature CHAIN DQ361535_HBx_P-B of FT:mat_peptide DQ361535_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CRP-228). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLHPVSAESRGRPLSGPLGALPPTSPSVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ377158_HBx_P-B Product feature CHAIN DQ377158_HBx_P-B of FT:mat_peptide DQ377158_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WJT31). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448619_HBx_P-B Product feature CHAIN DQ448619_HBx_P-B of FT:mat_peptide DQ448619_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448620_HBx_P-B Product feature CHAIN DQ448620_HBx_P-B of FT:mat_peptide DQ448620_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448621_HBx_P-B Product feature CHAIN DQ448621_HBx_P-B of FT:mat_peptide DQ448621_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448622_HBx_P-B Product feature CHAIN DQ448622_HBx_P-B of FT:mat_peptide DQ448622_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448623_HBx_P-B Product feature CHAIN DQ448623_HBx_P-B of FT:mat_peptide DQ448623_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448624_HBx_P-B Product feature CHAIN DQ448624_HBx_P-B of FT:mat_peptide DQ448624_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448625_HBx_P-B Product feature CHAIN DQ448625_HBx_P-B of FT:mat_peptide DQ448625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCTFFTSA
>gnl|hbvpro|DQ448626_HBx_P-B Product feature CHAIN DQ448626_HBx_P-B of FT:mat_peptide DQ448626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448627_HBx_P-B Product feature CHAIN DQ448627_HBx_P-B of FT:mat_peptide DQ448627_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ448628_HBx_P-B Product feature CHAIN DQ448628_HBx_P-B of FT:mat_peptide DQ448628_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463787_HBx_P-B Product feature CHAIN DQ463787_HBx_P-B of FT:mat_peptide DQ463787_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSSMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463788_HBx_P-B Product feature CHAIN DQ463788_HBx_P-B of FT:mat_peptide DQ463788_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463789_HBx_P-B Product feature CHAIN DQ463789_HBx_P-B of FT:mat_peptide DQ463789_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463790_HBx_P-B Product feature CHAIN DQ463790_HBx_P-B of FT:mat_peptide DQ463790_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463791_HBx_P-B Product feature CHAIN DQ463791_HBx_P-B of FT:mat_peptide DQ463791_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVAAESRGRPLSGTLGAVPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSTMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463792_HBx_P-B Product feature CHAIN DQ463792_HBx_P-B of FT:mat_peptide DQ463792_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463793_HBx_P-B Product feature CHAIN DQ463793_HBx_P-B of FT:mat_peptide DQ463793_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_1979). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463794_HBx_P-B Product feature CHAIN DQ463794_HBx_P-B of FT:mat_peptide DQ463794_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_1979). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463795_HBx_P-B Product feature CHAIN DQ463795_HBx_P-B of FT:mat_peptide DQ463795_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 928-9_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSSMSMTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463796_HBx_P-B Product feature CHAIN DQ463796_HBx_P-B of FT:mat_peptide DQ463796_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 739-11_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSMTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463797_HBx_P-B Product feature CHAIN DQ463797_HBx_P-B of FT:mat_peptide DQ463797_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 650-15_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463798_HBx_P-B Product feature CHAIN DQ463798_HBx_P-B of FT:mat_peptide DQ463798_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 621-14_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463799_HBx_P-B Product feature CHAIN DQ463799_HBx_P-B of FT:mat_peptide DQ463799_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 539-16_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463800_HBx_P-B Product feature CHAIN DQ463800_HBx_P-B of FT:mat_peptide DQ463800_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 524-3_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463801_HBx_P-B Product feature CHAIN DQ463801_HBx_P-B of FT:mat_peptide DQ463801_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 462-4_2004). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ463802_HBx_P-B Product feature CHAIN DQ463802_HBx_P-B of FT:mat_peptide DQ463802_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 234-6_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ904357_HBx_P-B Product feature CHAIN DQ904357_HBx_P-B of FT:mat_peptide DQ904357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ975271_HBx_P-B Product feature CHAIN DQ975271_HBx_P-B of FT:mat_peptide DQ975271_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993680_HBx_P-B Product feature CHAIN DQ993680_HBx_P-B of FT:mat_peptide DQ993680_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 268). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993681_HBx_P-B Product feature CHAIN DQ993681_HBx_P-B of FT:mat_peptide DQ993681_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 290). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTKVLHKRTLGLSAMSTTDLETYFKDCVFTEWEELGEEXRXKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993682_HBx_P-B Product feature CHAIN DQ993682_HBx_P-B of FT:mat_peptide DQ993682_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 479). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLXKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993683_HBx_P-B Product feature CHAIN DQ993683_HBx_P-B of FT:mat_peptide DQ993683_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNXHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993684_HBx_P-B Product feature CHAIN DQ993684_HBx_P-B of FT:mat_peptide DQ993684_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 336). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993685_HBx_P-B Product feature CHAIN DQ993685_HBx_P-B of FT:mat_peptide DQ993685_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 554). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEXGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993686_HBx_P-B Product feature CHAIN DQ993686_HBx_P-B of FT:mat_peptide DQ993686_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 342). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIXLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993687_HBx_P-B Product feature CHAIN DQ993687_HBx_P-B of FT:mat_peptide DQ993687_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGXEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993694_HBx_P-B Product feature CHAIN DQ993694_HBx_P-B of FT:mat_peptide DQ993694_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 234). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAXFKDCVFAEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993696_HBx_P-B Product feature CHAIN DQ993696_HBx_P-B of FT:mat_peptide DQ993696_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|DQ993697_HBx_P-B Product feature CHAIN DQ993697_HBx_P-B of FT:mat_peptide DQ993697_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKXTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|DQ993698_HBx_P-B Product feature CHAIN DQ993698_HBx_P-B of FT:mat_peptide DQ993698_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0327-ETCvs3TC-Naive). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|DQ993699_HBx_P-B Product feature CHAIN DQ993699_HBx_P-B of FT:mat_peptide DQ993699_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0226-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|DQ993700_HBx_P-B Product feature CHAIN DQ993700_HBx_P-B of FT:mat_peptide DQ993700_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993701_HBx_P-B Product feature CHAIN DQ993701_HBx_P-B of FT:mat_peptide DQ993701_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993702_HBx_P-B Product feature CHAIN DQ993702_HBx_P-B of FT:mat_peptide DQ993702_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0919-ETCvs3TC-Naive). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESPVLPLPGLLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993703_HBx_P-B Product feature CHAIN DQ993703_HBx_P-B of FT:mat_peptide DQ993703_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993704_HBx_P-B Product feature CHAIN DQ993704_HBx_P-B of FT:mat_peptide DQ993704_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-1127-Nature3.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993705_HBx_P-B Product feature CHAIN DQ993705_HBx_P-B of FT:mat_peptide DQ993705_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0625-Nature3.4-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993706_HBx_P-B Product feature CHAIN DQ993706_HBx_P-B of FT:mat_peptide DQ993706_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993707_HBx_P-B Product feature CHAIN DQ993707_HBx_P-B of FT:mat_peptide DQ993707_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLQERTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993708_HBx_P-B Product feature CHAIN DQ993708_HBx_P-B of FT:mat_peptide DQ993708_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993709_HBx_P-B Product feature CHAIN DQ993709_HBx_P-B of FT:mat_peptide DQ993709_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993710_HBx_P-B Product feature CHAIN DQ993710_HBx_P-B of FT:mat_peptide DQ993710_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6144-0718-ETC). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|DQ993711_HBx_P-B Product feature CHAIN DQ993711_HBx_P-B of FT:mat_peptide DQ993711_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 221-1120-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPDVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
ATVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ995802_HBx_P-B Product feature CHAIN DQ995802_HBx_P-B of FT:mat_peptide DQ995802_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H293-16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ995803_HBx_P-B Product feature CHAIN DQ995803_HBx_P-B of FT:mat_peptide DQ995803_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C265-15). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSSMSTTDLEAYFKDCVFTEWEELGVEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|DQ995804_HBx_P-B Product feature CHAIN DQ995804_HBx_P-B of FT:mat_peptide DQ995804_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1691-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ995805_HBx_P-B Product feature CHAIN DQ995805_HBx_P-B of FT:mat_peptide DQ995805_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-2.5KB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDHARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EF134945_HBx_P-B Product feature CHAIN EF134945_HBx_P-B of FT:mat_peptide EF134945_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF134946_HBx_P-B Product feature CHAIN EF134946_HBx_P-B of FT:mat_peptide EF134946_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDILYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473971_HBx_P-B Product feature CHAIN EF473971_HBx_P-B of FT:mat_peptide EF473971_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2059Java). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPAAVPTDHGAHLSLRGLPGCAFSSAGPGALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIMLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473972_HBx_P-B Product feature CHAIN EF473972_HBx_P-B of FT:mat_peptide EF473972_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473973_HBx_P-B Product feature CHAIN EF473973_HBx_P-B of FT:mat_peptide EF473973_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473974_HBx_P-B Product feature CHAIN EF473974_HBx_P-B of FT:mat_peptide EF473974_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPSALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCGFNEWEELGEEVRLKVFVLGGCRHKLLCSPAPCNFFTSA
>gnl|hbvpro|EF473975_HBx_P-B Product feature CHAIN EF473975_HBx_P-B of FT:mat_peptide EF473975_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473976_HBx_P-B Product feature CHAIN EF473976_HBx_P-B of FT:mat_peptide EF473976_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF473977_HBx_P-B Product feature CHAIN EF473977_HBx_P-B of FT:mat_peptide EF473977_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF494380_HBx_P-B Product feature CHAIN EF494380_HBx_P-B of FT:mat_peptide EF494380_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF494381_HBx_P-B Product feature CHAIN EF494381_HBx_P-B of FT:mat_peptide EF494381_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKALHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF494382_HBx_P-B Product feature CHAIN EF494382_HBx_P-B of FT:mat_peptide EF494382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPRTLPKVLHERTIGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU043342_HBx_P-B Product feature CHAIN EU043342_HBx_P-B of FT:mat_peptide EU043342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate XX259-2). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU043343_HBx_P-B Product feature CHAIN EU043343_HBx_P-B of FT:mat_peptide EU043343_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate XX259-5). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU043344_HBx_P-B Product feature CHAIN EU043344_HBx_P-B of FT:mat_peptide EU043344_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate XX259-14). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKGCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU043345_HBx_P-B Product feature CHAIN EU043345_HBx_P-B of FT:mat_peptide EU043345_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate XX259-20). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKGCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU139543_HBx_P-B Product feature CHAIN EU139543_HBx_P-B of FT:mat_peptide EU139543_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU158263_HBx_P-B Product feature CHAIN EU158263_HBx_P-B of FT:mat_peptide EU158263_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU305547_HBx_P-B Product feature CHAIN EU305547_HBx_P-B of FT:mat_peptide EU305547_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVSHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU305548_HBx_P-B Product feature CHAIN EU305548_HBx_P-B of FT:mat_peptide EU305548_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLRKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306677_HBx_P-B Product feature CHAIN EU306677_HBx_P-B of FT:mat_peptide EU306677_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306678_HBx_P-B Product feature CHAIN EU306678_HBx_P-B of FT:mat_peptide EU306678_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306679_HBx_P-B Product feature CHAIN EU306679_HBx_P-B of FT:mat_peptide EU306679_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306680_HBx_P-B Product feature CHAIN EU306680_HBx_P-B of FT:mat_peptide EU306680_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306681_HBx_P-B Product feature CHAIN EU306681_HBx_P-B of FT:mat_peptide EU306681_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306695_HBx_P-B Product feature CHAIN EU306695_HBx_P-B of FT:mat_peptide EU306695_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306696_HBx_P-B Product feature CHAIN EU306696_HBx_P-B of FT:mat_peptide EU306696_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306697_HBx_P-B Product feature CHAIN EU306697_HBx_P-B of FT:mat_peptide EU306697_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306698_HBx_P-B Product feature CHAIN EU306698_HBx_P-B of FT:mat_peptide EU306698_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306699_HBx_P-B Product feature CHAIN EU306699_HBx_P-B of FT:mat_peptide EU306699_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVWHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306700_HBx_P-B Product feature CHAIN EU306700_HBx_P-B of FT:mat_peptide EU306700_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCLPAPCNFFTSA
>gnl|hbvpro|EU306701_HBx_P-B Product feature CHAIN EU306701_HBx_P-B of FT:mat_peptide EU306701_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306702_HBx_P-B Product feature CHAIN EU306702_HBx_P-B of FT:mat_peptide EU306702_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306703_HBx_P-B Product feature CHAIN EU306703_HBx_P-B of FT:mat_peptide EU306703_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306704_HBx_P-B Product feature CHAIN EU306704_HBx_P-B of FT:mat_peptide EU306704_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306705_HBx_P-B Product feature CHAIN EU306705_HBx_P-B of FT:mat_peptide EU306705_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306706_HBx_P-B Product feature CHAIN EU306706_HBx_P-B of FT:mat_peptide EU306706_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306707_HBx_P-B Product feature CHAIN EU306707_HBx_P-B of FT:mat_peptide EU306707_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306708_HBx_P-B Product feature CHAIN EU306708_HBx_P-B of FT:mat_peptide EU306708_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306709_HBx_P-B Product feature CHAIN EU306709_HBx_P-B of FT:mat_peptide EU306709_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306710_HBx_P-B Product feature CHAIN EU306710_HBx_P-B of FT:mat_peptide EU306710_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306711_HBx_P-B Product feature CHAIN EU306711_HBx_P-B of FT:mat_peptide EU306711_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306712_HBx_P-B Product feature CHAIN EU306712_HBx_P-B of FT:mat_peptide EU306712_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330989_HBx_P-B Product feature CHAIN EU330989_HBx_P-B of FT:mat_peptide EU330989_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330990_HBx_P-B Product feature CHAIN EU330990_HBx_P-B of FT:mat_peptide EU330990_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330992_HBx_P-B Product feature CHAIN EU330992_HBx_P-B of FT:mat_peptide EU330992_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330994_HBx_P-B Product feature CHAIN EU330994_HBx_P-B of FT:mat_peptide EU330994_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCASSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330995_HBx_P-B Product feature CHAIN EU330995_HBx_P-B of FT:mat_peptide EU330995_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-80). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330996_HBx_P-B Product feature CHAIN EU330996_HBx_P-B of FT:mat_peptide EU330996_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCTLRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330997_HBx_P-B Product feature CHAIN EU330997_HBx_P-B of FT:mat_peptide EU330997_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330998_HBx_P-B Product feature CHAIN EU330998_HBx_P-B of FT:mat_peptide EU330998_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU330999_HBx_P-B Product feature CHAIN EU330999_HBx_P-B of FT:mat_peptide EU330999_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU331000_HBx_P-B Product feature CHAIN EU331000_HBx_P-B of FT:mat_peptide EU331000_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU331001_HBx_P-B Product feature CHAIN EU331001_HBx_P-B of FT:mat_peptide EU331001_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTTGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU350409_HBx_P-B Product feature CHAIN EU350409_HBx_P-B of FT:mat_peptide EU350409_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAACNFFTSA
>gnl|hbvpro|EU439018_HBx_P-B Product feature CHAIN EU439018_HBx_P-B of FT:mat_peptide EU439018_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRAPGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439020_HBx_P-B Product feature CHAIN EU439020_HBx_P-B of FT:mat_peptide EU439020_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439021_HBx_P-B Product feature CHAIN EU439021_HBx_P-B of FT:mat_peptide EU439021_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSX
>gnl|hbvpro|EU439022_HBx_P-B Product feature CHAIN EU439022_HBx_P-B of FT:mat_peptide EU439022_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439023_HBx_P-B Product feature CHAIN EU439023_HBx_P-B of FT:mat_peptide EU439023_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPEPCNFFTSA
>gnl|hbvpro|EU487256_HBx_P-B Product feature CHAIN EU487256_HBx_P-B of FT:mat_peptide EU487256_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU487257_HBx_P-B Product feature CHAIN EU487257_HBx_P-B of FT:mat_peptide EU487257_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522066_HBx_P-B Product feature CHAIN EU522066_HBx_P-B of FT:mat_peptide EU522066_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4N). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522067_HBx_P-B Product feature CHAIN EU522067_HBx_P-B of FT:mat_peptide EU522067_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 4T). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVLFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522072_HBx_P-B Product feature CHAIN EU522072_HBx_P-B of FT:mat_peptide EU522072_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU522073_HBx_P-B Product feature CHAIN EU522073_HBx_P-B of FT:mat_peptide EU522073_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU522074_HBx_P-B Product feature CHAIN EU522074_HBx_P-B of FT:mat_peptide EU522074_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU522075_HBx_P-B Product feature CHAIN EU522075_HBx_P-B of FT:mat_peptide EU522075_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 8T). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU547563_HBx_P-B Product feature CHAIN EU547563_HBx_P-B of FT:mat_peptide EU547563_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MC06). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU564822_HBx_P-B Product feature CHAIN EU564822_HBx_P-B of FT:mat_peptide EU564822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU564823_HBx_P-B Product feature CHAIN EU564823_HBx_P-B of FT:mat_peptide EU564823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10TB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU564824_HBx_P-B Product feature CHAIN EU564824_HBx_P-B of FT:mat_peptide EU564824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-10N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU564826_HBx_P-B Product feature CHAIN EU564826_HBx_P-B of FT:mat_peptide EU564826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-11N). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU570069_HBx_P-B Product feature CHAIN EU570069_HBx_P-B of FT:mat_peptide EU570069_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1-B24). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAVSRGRPLPGPLGALPPASPPVVPTDLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHGNLPKVLHKRTLGLSAMPTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570071_HBx_P-B Product feature CHAIN EU570071_HBx_P-B of FT:mat_peptide EU570071_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570075_HBx_P-B Product feature CHAIN EU570075_HBx_P-B of FT:mat_peptide EU570075_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11-S142). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHPSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU579441_HBx_P-B Product feature CHAIN EU579441_HBx_P-B of FT:mat_peptide EU579441_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU589335_HBx_P-B Product feature CHAIN EU589335_HBx_P-B of FT:mat_peptide EU589335_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142-5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU595031_HBx_P-B Product feature CHAIN EU595031_HBx_P-B of FT:mat_peptide EU595031_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLRKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660224_HBx_P-B Product feature CHAIN EU660224_HBx_P-B of FT:mat_peptide EU660224_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-12N). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660230_HBx_P-B Product feature CHAIN EU660230_HBx_P-B of FT:mat_peptide EU660230_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660231_HBx_P-B Product feature CHAIN EU660231_HBx_P-B of FT:mat_peptide EU660231_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16T-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660232_HBx_P-B Product feature CHAIN EU660232_HBx_P-B of FT:mat_peptide EU660232_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del1). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU660233_HBx_P-B Product feature CHAIN EU660233_HBx_P-B of FT:mat_peptide EU660233_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-16N-del2). Partial genome (Contains: HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796066_HBx_P-B Product feature CHAIN EU796066_HBx_P-B of FT:mat_peptide EU796066_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKNCVFTEWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796067_HBx_P-B Product feature CHAIN EU796067_HBx_P-B of FT:mat_peptide EU796067_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLGPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796068_HBx_P-B Product feature CHAIN EU796068_HBx_P-B of FT:mat_peptide EU796068_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796071_HBx_P-B Product feature CHAIN EU796071_HBx_P-B of FT:mat_peptide EU796071_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU881997_HBx_P-B Product feature CHAIN EU881997_HBx_P-B of FT:mat_peptide EU881997_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU881998_HBx_P-B Product feature CHAIN EU881998_HBx_P-B of FT:mat_peptide EU881998_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882002_HBx_P-B Product feature CHAIN EU882002_HBx_P-B of FT:mat_peptide EU882002_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882003_HBx_P-B Product feature CHAIN EU882003_HBx_P-B of FT:mat_peptide EU882003_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882004_HBx_P-B Product feature CHAIN EU882004_HBx_P-B of FT:mat_peptide EU882004_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919171_HBx_P-B Product feature CHAIN EU919171_HBx_P-B of FT:mat_peptide EU919171_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRPPAPCNFFTSA
>gnl|hbvpro|EU919172_HBx_P-B Product feature CHAIN EU919172_HBx_P-B of FT:mat_peptide EU919172_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919173_HBx_P-B Product feature CHAIN EU919173_HBx_P-B of FT:mat_peptide EU919173_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919175_HBx_P-B Product feature CHAIN EU919175_HBx_P-B of FT:mat_peptide EU919175_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDPWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919176_HBx_P-B Product feature CHAIN EU919176_HBx_P-B of FT:mat_peptide EU919176_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDPWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939559_HBx_P-B Product feature CHAIN EU939559_HBx_P-B of FT:mat_peptide EU939559_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGVEGRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|EU939633_HBx_P-B Product feature CHAIN EU939633_HBx_P-B of FT:mat_peptide EU939633_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939634_HBx_P-B Product feature CHAIN EU939634_HBx_P-B of FT:mat_peptide EU939634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRAKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939636_HBx_P-B Product feature CHAIN EU939636_HBx_P-B of FT:mat_peptide EU939636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939637_HBx_P-B Product feature CHAIN EU939637_HBx_P-B of FT:mat_peptide EU939637_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C13). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MVGRLYFQLDPARDVLFLRPVGDESRGRPFPGPLGDLPSASPPVVLTDHGAHLSLRGFPVCALSSAGPCALRFPSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLQAYFQDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939638_HBx_P-B Product feature CHAIN EU939638_HBx_P-B of FT:mat_peptide EU939638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939639_HBx_P-B Product feature CHAIN EU939639_HBx_P-B of FT:mat_peptide EU939639_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939660_HBx_P-B Product feature CHAIN EU939660_HBx_P-B of FT:mat_peptide EU939660_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C34). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDGEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939661_HBx_P-B Product feature CHAIN EU939661_HBx_P-B of FT:mat_peptide EU939661_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRLCCQLDTARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939663_HBx_P-B Product feature CHAIN EU939663_HBx_P-B of FT:mat_peptide EU939663_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFMEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939664_HBx_P-B Product feature CHAIN EU939664_HBx_P-B of FT:mat_peptide EU939664_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C85). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU939665_HBx_P-B Product feature CHAIN EU939665_HBx_P-B of FT:mat_peptide EU939665_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C129). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939666_HBx_P-B Product feature CHAIN EU939666_HBx_P-B of FT:mat_peptide EU939666_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939667_HBx_P-B Product feature CHAIN EU939667_HBx_P-B of FT:mat_peptide EU939667_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939669_HBx_P-B Product feature CHAIN EU939669_HBx_P-B of FT:mat_peptide EU939669_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLXKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU939670_HBx_P-B Product feature CHAIN EU939670_HBx_P-B of FT:mat_peptide EU939670_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C189). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU939671_HBx_P-B Product feature CHAIN EU939671_HBx_P-B of FT:mat_peptide EU939671_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C201). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939672_HBx_P-B Product feature CHAIN EU939672_HBx_P-B of FT:mat_peptide EU939672_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939673_HBx_P-B Product feature CHAIN EU939673_HBx_P-B of FT:mat_peptide EU939673_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C219). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939674_HBx_P-B Product feature CHAIN EU939674_HBx_P-B of FT:mat_peptide EU939674_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939675_HBx_P-B Product feature CHAIN EU939675_HBx_P-B of FT:mat_peptide EU939675_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C235). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFNEWEEMGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939676_HBx_P-B Product feature CHAIN EU939676_HBx_P-B of FT:mat_peptide EU939676_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939677_HBx_P-B Product feature CHAIN EU939677_HBx_P-B of FT:mat_peptide EU939677_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTEHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPWNFFTSA
>gnl|hbvpro|EU939678_HBx_P-B Product feature CHAIN EU939678_HBx_P-B of FT:mat_peptide EU939678_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939679_HBx_P-B Product feature CHAIN EU939679_HBx_P-B of FT:mat_peptide EU939679_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D134). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023631_HBx_P-B Product feature CHAIN FJ023631_HBx_P-B of FT:mat_peptide FJ023631_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2_C04-1213). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPLPGPLGPVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023632_HBx_P-B Product feature CHAIN FJ023632_HBx_P-B of FT:mat_peptide FJ023632_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0254). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLCPVGAESRGRPLPGPLGAVPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023633_HBx_P-B Product feature CHAIN FJ023633_HBx_P-B of FT:mat_peptide FJ023633_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023634_HBx_P-B Product feature CHAIN FJ023634_HBx_P-B of FT:mat_peptide FJ023634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023635_HBx_P-B Product feature CHAIN FJ023635_HBx_P-B of FT:mat_peptide FJ023635_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023636_HBx_P-B Product feature CHAIN FJ023636_HBx_P-B of FT:mat_peptide FJ023636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAVSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023637_HBx_P-B Product feature CHAIN FJ023637_HBx_P-B of FT:mat_peptide FJ023637_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTIGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023638_HBx_P-B Product feature CHAIN FJ023638_HBx_P-B of FT:mat_peptide FJ023638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPATPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWTLPKVLHKRTIGLSPMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032342_HBx_P-B Product feature CHAIN FJ032342_HBx_P-B of FT:mat_peptide FJ032342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVIAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032344_HBx_P-B Product feature CHAIN FJ032344_HBx_P-B of FT:mat_peptide FJ032344_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S659-5). Complete genome. [Hepadnaviridae] (length=154 residues).
LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVIAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032349_HBx_P-B Product feature CHAIN FJ032349_HBx_P-B of FT:mat_peptide FJ032349_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032353_HBx_P-B Product feature CHAIN FJ032353_HBx_P-B of FT:mat_peptide FJ032353_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSS
>gnl|hbvpro|FJ032354_HBx_P-B Product feature CHAIN FJ032354_HBx_P-B of FT:mat_peptide FJ032354_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTLSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032357_HBx_P-B Product feature CHAIN FJ032357_HBx_P-B of FT:mat_peptide FJ032357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032358_HBx_P-B Product feature CHAIN FJ032358_HBx_P-B of FT:mat_peptide FJ032358_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGRRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ349236_HBx_P-B Product feature CHAIN FJ349236_HBx_P-B of FT:mat_peptide FJ349236_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386582_HBx_P-B Product feature CHAIN FJ386582_HBx_P-B of FT:mat_peptide FJ386582_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386583_HBx_P-B Product feature CHAIN FJ386583_HBx_P-B of FT:mat_peptide FJ386583_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGHLSPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVKDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEESGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386584_HBx_P-B Product feature CHAIN FJ386584_HBx_P-B of FT:mat_peptide FJ386584_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386600_HBx_P-B Product feature CHAIN FJ386600_HBx_P-B of FT:mat_peptide FJ386600_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386608_HBx_P-B Product feature CHAIN FJ386608_HBx_P-B of FT:mat_peptide FJ386608_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1998). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386610_HBx_P-B Product feature CHAIN FJ386610_HBx_P-B of FT:mat_peptide FJ386610_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDDGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386615_HBx_P-B Product feature CHAIN FJ386615_HBx_P-B of FT:mat_peptide FJ386615_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ386634_HBx_P-B Product feature CHAIN FJ386634_HBx_P-B of FT:mat_peptide FJ386634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2392). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLGCSPAPCNFFTSA
>gnl|hbvpro|FJ386636_HBx_P-B Product feature CHAIN FJ386636_HBx_P-B of FT:mat_peptide FJ386636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386642_HBx_P-B Product feature CHAIN FJ386642_HBx_P-B of FT:mat_peptide FJ386642_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386648_HBx_P-B Product feature CHAIN FJ386648_HBx_P-B of FT:mat_peptide FJ386648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPXXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEVRLMIFVLGGCSNKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ386654_HBx_P-B Product feature CHAIN FJ386654_HBx_P-B of FT:mat_peptide FJ386654_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386655_HBx_P-B Product feature CHAIN FJ386655_HBx_P-B of FT:mat_peptide FJ386655_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALSPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386656_HBx_P-B Product feature CHAIN FJ386656_HBx_P-B of FT:mat_peptide FJ386656_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S142). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCSNKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386658_HBx_P-B Product feature CHAIN FJ386658_HBx_P-B of FT:mat_peptide FJ386658_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386660_HBx_P-B Product feature CHAIN FJ386660_HBx_P-B of FT:mat_peptide FJ386660_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLGCSPAPCNFFTSA
>gnl|hbvpro|FJ386666_HBx_P-B Product feature CHAIN FJ386666_HBx_P-B of FT:mat_peptide FJ386666_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386668_HBx_P-B Product feature CHAIN FJ386668_HBx_P-B of FT:mat_peptide FJ386668_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGDEVRLRNYVLGGCRDKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386669_HBx_P-B Product feature CHAIN FJ386669_HBx_P-B of FT:mat_peptide FJ386669_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S411). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386675_HBx_P-B Product feature CHAIN FJ386675_HBx_P-B of FT:mat_peptide FJ386675_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386676_HBx_P-B Product feature CHAIN FJ386676_HBx_P-B of FT:mat_peptide FJ386676_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386680_HBx_P-B Product feature CHAIN FJ386680_HBx_P-B of FT:mat_peptide FJ386680_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1244). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYIKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ386681_HBx_P-B Product feature CHAIN FJ386681_HBx_P-B of FT:mat_peptide FJ386681_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1336). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386682_HBx_P-B Product feature CHAIN FJ386682_HBx_P-B of FT:mat_peptide FJ386682_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1416). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386683_HBx_P-B Product feature CHAIN FJ386683_HBx_P-B of FT:mat_peptide FJ386683_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1450). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386684_HBx_P-B Product feature CHAIN FJ386684_HBx_P-B of FT:mat_peptide FJ386684_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386688_HBx_P-B Product feature CHAIN FJ386688_HBx_P-B of FT:mat_peptide FJ386688_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGSLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ518811_HBx_P-B Product feature CHAIN FJ518811_HBx_P-B of FT:mat_peptide FJ518811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ518812_HBx_P-B Product feature CHAIN FJ518812_HBx_P-B of FT:mat_peptide FJ518812_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRSLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562219_HBx_P-B Product feature CHAIN FJ562219_HBx_P-B of FT:mat_peptide FJ562219_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562222_HBx_P-B Product feature CHAIN FJ562222_HBx_P-B of FT:mat_peptide FJ562222_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I14). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562224_HBx_P-B Product feature CHAIN FJ562224_HBx_P-B of FT:mat_peptide FJ562224_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSXMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562231_HBx_P-B Product feature CHAIN FJ562231_HBx_P-B of FT:mat_peptide FJ562231_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562234_HBx_P-B Product feature CHAIN FJ562234_HBx_P-B of FT:mat_peptide FJ562234_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562236_HBx_P-B Product feature CHAIN FJ562236_HBx_P-B of FT:mat_peptide FJ562236_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562237_HBx_P-B Product feature CHAIN FJ562237_HBx_P-B of FT:mat_peptide FJ562237_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562240_HBx_P-B Product feature CHAIN FJ562240_HBx_P-B of FT:mat_peptide FJ562240_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562246_HBx_P-B Product feature CHAIN FJ562246_HBx_P-B of FT:mat_peptide FJ562246_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562253_HBx_P-B Product feature CHAIN FJ562253_HBx_P-B of FT:mat_peptide FJ562253_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562254_HBx_P-B Product feature CHAIN FJ562254_HBx_P-B of FT:mat_peptide FJ562254_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I87). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562257_HBx_P-B Product feature CHAIN FJ562257_HBx_P-B of FT:mat_peptide FJ562257_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLSPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562259_HBx_P-B Product feature CHAIN FJ562259_HBx_P-B of FT:mat_peptide FJ562259_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ562260_HBx_P-B Product feature CHAIN FJ562260_HBx_P-B of FT:mat_peptide FJ562260_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ562262_HBx_P-B Product feature CHAIN FJ562262_HBx_P-B of FT:mat_peptide FJ562262_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I111). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ562289_HBx_P-B Product feature CHAIN FJ562289_HBx_P-B of FT:mat_peptide FJ562289_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEESGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562296_HBx_P-B Product feature CHAIN FJ562296_HBx_P-B of FT:mat_peptide FJ562296_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562303_HBx_P-B Product feature CHAIN FJ562303_HBx_P-B of FT:mat_peptide FJ562303_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I189). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562311_HBx_P-B Product feature CHAIN FJ562311_HBx_P-B of FT:mat_peptide FJ562311_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ562312_HBx_P-B Product feature CHAIN FJ562312_HBx_P-B of FT:mat_peptide FJ562312_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I203). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPASCNFFTSA
>gnl|hbvpro|FJ562316_HBx_P-B Product feature CHAIN FJ562316_HBx_P-B of FT:mat_peptide FJ562316_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I208). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562321_HBx_P-B Product feature CHAIN FJ562321_HBx_P-B of FT:mat_peptide FJ562321_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I214). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562322_HBx_P-B Product feature CHAIN FJ562322_HBx_P-B of FT:mat_peptide FJ562322_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ751769_HBx_P-B Product feature CHAIN FJ751769_HBx_P-B of FT:mat_peptide FJ751769_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ755833_HBx_P-B Product feature CHAIN FJ755833_HBx_P-B of FT:mat_peptide FJ755833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
GLSRLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVLTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787444_HBx_P-B Product feature CHAIN FJ787444_HBx_P-B of FT:mat_peptide FJ787444_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787475_HBx_P-B Product feature CHAIN FJ787475_HBx_P-B of FT:mat_peptide FJ787475_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-2). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVLFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ787476_HBx_P-B Product feature CHAIN FJ787476_HBx_P-B of FT:mat_peptide FJ787476_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX-3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLRGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ787477_HBx_P-B Product feature CHAIN FJ787477_HBx_P-B of FT:mat_peptide FJ787477_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LWM-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899779_HBx_P-B Product feature CHAIN FJ899779_HBx_P-B of FT:mat_peptide FJ899779_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ899784_HBx_P-B Product feature CHAIN FJ899784_HBx_P-B of FT:mat_peptide FJ899784_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899785_HBx_P-B Product feature CHAIN FJ899785_HBx_P-B of FT:mat_peptide FJ899785_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRSTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899786_HBx_P-B Product feature CHAIN FJ899786_HBx_P-B of FT:mat_peptide FJ899786_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899787_HBx_P-B Product feature CHAIN FJ899787_HBx_P-B of FT:mat_peptide FJ899787_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C215-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPSASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899790_HBx_P-B Product feature CHAIN FJ899790_HBx_P-B of FT:mat_peptide FJ899790_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899791_HBx_P-B Product feature CHAIN FJ899791_HBx_P-B of FT:mat_peptide FJ899791_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C232-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358136_HBx_P-B Product feature CHAIN GQ358136_HBx_P-B of FT:mat_peptide GQ358136_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTCARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEDIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358137_HBx_P-B Product feature CHAIN GQ358137_HBx_P-B of FT:mat_peptide GQ358137_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFPSA
>gnl|hbvpro|GQ358138_HBx_P-B Product feature CHAIN GQ358138_HBx_P-B of FT:mat_peptide GQ358138_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358140_HBx_P-B Product feature CHAIN GQ358140_HBx_P-B of FT:mat_peptide GQ358140_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FLT020). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358141_HBx_P-B Product feature CHAIN GQ358141_HBx_P-B of FT:mat_peptide GQ358141_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358143_HBx_P-B Product feature CHAIN GQ358143_HBx_P-B of FT:mat_peptide GQ358143_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358144_HBx_P-B Product feature CHAIN GQ358144_HBx_P-B of FT:mat_peptide GQ358144_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKGFVLGGCRHKLVWSPAPCNFFPSA
>gnl|hbvpro|GQ358145_HBx_P-B Product feature CHAIN GQ358145_HBx_P-B of FT:mat_peptide GQ358145_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGAVPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358146_HBx_P-B Product feature CHAIN GQ358146_HBx_P-B of FT:mat_peptide GQ358146_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358147_HBx_P-B Product feature CHAIN GQ358147_HBx_P-B of FT:mat_peptide GQ358147_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358148_HBx_P-B Product feature CHAIN GQ358148_HBx_P-B of FT:mat_peptide GQ358148_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358149_HBx_P-B Product feature CHAIN GQ358149_HBx_P-B of FT:mat_peptide GQ358149_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358150_HBx_P-B Product feature CHAIN GQ358150_HBx_P-B of FT:mat_peptide GQ358150_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|GQ358151_HBx_P-B Product feature CHAIN GQ358151_HBx_P-B of FT:mat_peptide GQ358151_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358152_HBx_P-B Product feature CHAIN GQ358152_HBx_P-B of FT:mat_peptide GQ358152_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377525_HBx_P-B Product feature CHAIN GQ377525_HBx_P-B of FT:mat_peptide GQ377525_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSALSTTDLEAYFKDCVYTEWDELGEEVRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377537_HBx_P-B Product feature CHAIN GQ377537_HBx_P-B of FT:mat_peptide GQ377537_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEARLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377542_HBx_P-B Product feature CHAIN GQ377542_HBx_P-B of FT:mat_peptide GQ377542_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGDEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377547_HBx_P-B Product feature CHAIN GQ377547_HBx_P-B of FT:mat_peptide GQ377547_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377550_HBx_P-B Product feature CHAIN GQ377550_HBx_P-B of FT:mat_peptide GQ377550_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J81). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKIFVLGGCRDKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377558_HBx_P-B Product feature CHAIN GQ377558_HBx_P-B of FT:mat_peptide GQ377558_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377561_HBx_P-B Product feature CHAIN GQ377561_HBx_P-B of FT:mat_peptide GQ377561_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377566_HBx_P-B Product feature CHAIN GQ377566_HBx_P-B of FT:mat_peptide GQ377566_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377567_HBx_P-B Product feature CHAIN GQ377567_HBx_P-B of FT:mat_peptide GQ377567_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J102). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPYVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSPVSTTDLEAYFKDCLFNDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377568_HBx_P-B Product feature CHAIN GQ377568_HBx_P-B of FT:mat_peptide GQ377568_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ377569_HBx_P-B Product feature CHAIN GQ377569_HBx_P-B of FT:mat_peptide GQ377569_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377582_HBx_P-B Product feature CHAIN GQ377582_HBx_P-B of FT:mat_peptide GQ377582_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J131). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLQKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|GQ377587_HBx_P-B Product feature CHAIN GQ377587_HBx_P-B of FT:mat_peptide GQ377587_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEFRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377588_HBx_P-B Product feature CHAIN GQ377588_HBx_P-B of FT:mat_peptide GQ377588_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377606_HBx_P-B Product feature CHAIN GQ377606_HBx_P-B of FT:mat_peptide GQ377606_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377610_HBx_P-B Product feature CHAIN GQ377610_HBx_P-B of FT:mat_peptide GQ377610_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J177). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEEFGEEIRLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|GQ377612_HBx_P-B Product feature CHAIN GQ377612_HBx_P-B of FT:mat_peptide GQ377612_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377622_HBx_P-B Product feature CHAIN GQ377622_HBx_P-B of FT:mat_peptide GQ377622_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J207). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVSLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377625_HBx_P-B Product feature CHAIN GQ377625_HBx_P-B of FT:mat_peptide GQ377625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVGSPAPCNFFTSA
>gnl|hbvpro|GQ377629_HBx_P-B Product feature CHAIN GQ377629_HBx_P-B of FT:mat_peptide GQ377629_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377638_HBx_P-B Product feature CHAIN GQ377638_HBx_P-B of FT:mat_peptide GQ377638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVKLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377641_HBx_P-B Product feature CHAIN GQ377641_HBx_P-B of FT:mat_peptide GQ377641_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|GQ377643_HBx_P-B Product feature CHAIN GQ377643_HBx_P-B of FT:mat_peptide GQ377643_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377644_HBx_P-B Product feature CHAIN GQ377644_HBx_P-B of FT:mat_peptide GQ377644_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGAEGRLMSFVLVSCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475340_HBx_P-B Product feature CHAIN GQ475340_HBx_P-B of FT:mat_peptide GQ475340_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEESGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855522_HBx_P-B Product feature CHAIN GQ855522_HBx_P-B of FT:mat_peptide GQ855522_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 23). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCMFTEWEELGEEVRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|GQ855526_HBx_P-B Product feature CHAIN GQ855526_HBx_P-B of FT:mat_peptide GQ855526_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 103). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSPVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLTTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855529_HBx_P-B Product feature CHAIN GQ855529_HBx_P-B of FT:mat_peptide GQ855529_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 198). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855689_HBx_P-B Product feature CHAIN GQ855689_HBx_P-B of FT:mat_peptide GQ855689_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 3469). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHGAHLSLPGLPVCAFSSAGPCALRFTSARRME
TTANAHQNLTKALHNRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924603_HBx_P-B Product feature CHAIN GQ924603_HBx_P-B of FT:mat_peptide GQ924603_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924605_HBx_P-B Product feature CHAIN GQ924605_HBx_P-B of FT:mat_peptide GQ924605_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924606_HBx_P-B Product feature CHAIN GQ924606_HBx_P-B of FT:mat_peptide GQ924606_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924607_HBx_P-B Product feature CHAIN GQ924607_HBx_P-B of FT:mat_peptide GQ924607_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924608_HBx_P-B Product feature CHAIN GQ924608_HBx_P-B of FT:mat_peptide GQ924608_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924610_HBx_P-B Product feature CHAIN GQ924610_HBx_P-B of FT:mat_peptide GQ924610_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924611_HBx_P-B Product feature CHAIN GQ924611_HBx_P-B of FT:mat_peptide GQ924611_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924617_HBx_P-B Product feature CHAIN GQ924617_HBx_P-B of FT:mat_peptide GQ924617_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924621_HBx_P-B Product feature CHAIN GQ924621_HBx_P-B of FT:mat_peptide GQ924621_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSALSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924624_HBx_P-B Product feature CHAIN GQ924624_HBx_P-B of FT:mat_peptide GQ924624_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGTLGTLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924625_HBx_P-B Product feature CHAIN GQ924625_HBx_P-B of FT:mat_peptide GQ924625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924626_HBx_P-B Product feature CHAIN GQ924626_HBx_P-B of FT:mat_peptide GQ924626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924627_HBx_P-B Product feature CHAIN GQ924627_HBx_P-B of FT:mat_peptide GQ924627_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924628_HBx_P-B Product feature CHAIN GQ924628_HBx_P-B of FT:mat_peptide GQ924628_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPAASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETKLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924630_HBx_P-B Product feature CHAIN GQ924630_HBx_P-B of FT:mat_peptide GQ924630_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924631_HBx_P-B Product feature CHAIN GQ924631_HBx_P-B of FT:mat_peptide GQ924631_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924632_HBx_P-B Product feature CHAIN GQ924632_HBx_P-B of FT:mat_peptide GQ924632_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924634_HBx_P-B Product feature CHAIN GQ924634_HBx_P-B of FT:mat_peptide GQ924634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924635_HBx_P-B Product feature CHAIN GQ924635_HBx_P-B of FT:mat_peptide GQ924635_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|GQ924637_HBx_P-B Product feature CHAIN GQ924637_HBx_P-B of FT:mat_peptide GQ924637_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRTLPKVLHKRTLGLSAMSTIDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924638_HBx_P-B Product feature CHAIN GQ924638_HBx_P-B of FT:mat_peptide GQ924638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924639_HBx_P-B Product feature CHAIN GQ924639_HBx_P-B of FT:mat_peptide GQ924639_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M71). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924640_HBx_P-B Product feature CHAIN GQ924640_HBx_P-B of FT:mat_peptide GQ924640_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924641_HBx_P-B Product feature CHAIN GQ924641_HBx_P-B of FT:mat_peptide GQ924641_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEMRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924645_HBx_P-B Product feature CHAIN GQ924645_HBx_P-B of FT:mat_peptide GQ924645_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924646_HBx_P-B Product feature CHAIN GQ924646_HBx_P-B of FT:mat_peptide GQ924646_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924647_HBx_P-B Product feature CHAIN GQ924647_HBx_P-B of FT:mat_peptide GQ924647_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVSTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924648_HBx_P-B Product feature CHAIN GQ924648_HBx_P-B of FT:mat_peptide GQ924648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924651_HBx_P-B Product feature CHAIN GQ924651_HBx_P-B of FT:mat_peptide GQ924651_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924653_HBx_P-B Product feature CHAIN GQ924653_HBx_P-B of FT:mat_peptide GQ924653_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924654_HBx_P-B Product feature CHAIN GQ924654_HBx_P-B of FT:mat_peptide GQ924654_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924656_HBx_P-B Product feature CHAIN GQ924656_HBx_P-B of FT:mat_peptide GQ924656_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHTRTLGLSVMSTTDLEAYFKDCVFTEWEESGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU357842_HBx_P-B Product feature CHAIN GU357842_HBx_P-B of FT:mat_peptide GU357842_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU434372_HBx_P-B Product feature CHAIN GU434372_HBx_P-B of FT:mat_peptide GU434372_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|GU434373_HBx_P-B Product feature CHAIN GU434373_HBx_P-B of FT:mat_peptide GU434373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|GU451682_HBx_P-B Product feature CHAIN GU451682_HBx_P-B of FT:mat_peptide GU451682_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815548_HBx_P-B Product feature CHAIN GU815548_HBx_P-B of FT:mat_peptide GU815548_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU815549_HBx_P-B Product feature CHAIN GU815549_HBx_P-B of FT:mat_peptide GU815549_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815550_HBx_P-B Product feature CHAIN GU815550_HBx_P-B of FT:mat_peptide GU815550_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815551_HBx_P-B Product feature CHAIN GU815551_HBx_P-B of FT:mat_peptide GU815551_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815552_HBx_P-B Product feature CHAIN GU815552_HBx_P-B of FT:mat_peptide GU815552_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815553_HBx_P-B Product feature CHAIN GU815553_HBx_P-B of FT:mat_peptide GU815553_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815554_HBx_P-B Product feature CHAIN GU815554_HBx_P-B of FT:mat_peptide GU815554_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815555_HBx_P-B Product feature CHAIN GU815555_HBx_P-B of FT:mat_peptide GU815555_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815556_HBx_P-B Product feature CHAIN GU815556_HBx_P-B of FT:mat_peptide GU815556_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815557_HBx_P-B Product feature CHAIN GU815557_HBx_P-B of FT:mat_peptide GU815557_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815558_HBx_P-B Product feature CHAIN GU815558_HBx_P-B of FT:mat_peptide GU815558_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815559_HBx_P-B Product feature CHAIN GU815559_HBx_P-B of FT:mat_peptide GU815559_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815560_HBx_P-B Product feature CHAIN GU815560_HBx_P-B of FT:mat_peptide GU815560_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815561_HBx_P-B Product feature CHAIN GU815561_HBx_P-B of FT:mat_peptide GU815561_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815562_HBx_P-B Product feature CHAIN GU815562_HBx_P-B of FT:mat_peptide GU815562_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815563_HBx_P-B Product feature CHAIN GU815563_HBx_P-B of FT:mat_peptide GU815563_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815564_HBx_P-B Product feature CHAIN GU815564_HBx_P-B of FT:mat_peptide GU815564_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815565_HBx_P-B Product feature CHAIN GU815565_HBx_P-B of FT:mat_peptide GU815565_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815566_HBx_P-B Product feature CHAIN GU815566_HBx_P-B of FT:mat_peptide GU815566_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815567_HBx_P-B Product feature CHAIN GU815567_HBx_P-B of FT:mat_peptide GU815567_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815568_HBx_P-B Product feature CHAIN GU815568_HBx_P-B of FT:mat_peptide GU815568_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815569_HBx_P-B Product feature CHAIN GU815569_HBx_P-B of FT:mat_peptide GU815569_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815570_HBx_P-B Product feature CHAIN GU815570_HBx_P-B of FT:mat_peptide GU815570_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815571_HBx_P-B Product feature CHAIN GU815571_HBx_P-B of FT:mat_peptide GU815571_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A2-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815573_HBx_P-B Product feature CHAIN GU815573_HBx_P-B of FT:mat_peptide GU815573_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815574_HBx_P-B Product feature CHAIN GU815574_HBx_P-B of FT:mat_peptide GU815574_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNTPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815575_HBx_P-B Product feature CHAIN GU815575_HBx_P-B of FT:mat_peptide GU815575_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815576_HBx_P-B Product feature CHAIN GU815576_HBx_P-B of FT:mat_peptide GU815576_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815577_HBx_P-B Product feature CHAIN GU815577_HBx_P-B of FT:mat_peptide GU815577_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNTPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815578_HBx_P-B Product feature CHAIN GU815578_HBx_P-B of FT:mat_peptide GU815578_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815579_HBx_P-B Product feature CHAIN GU815579_HBx_P-B of FT:mat_peptide GU815579_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEGLGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815581_HBx_P-B Product feature CHAIN GU815581_HBx_P-B of FT:mat_peptide GU815581_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815583_HBx_P-B Product feature CHAIN GU815583_HBx_P-B of FT:mat_peptide GU815583_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815584_HBx_P-B Product feature CHAIN GU815584_HBx_P-B of FT:mat_peptide GU815584_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815585_HBx_P-B Product feature CHAIN GU815585_HBx_P-B of FT:mat_peptide GU815585_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815586_HBx_P-B Product feature CHAIN GU815586_HBx_P-B of FT:mat_peptide GU815586_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815587_HBx_P-B Product feature CHAIN GU815587_HBx_P-B of FT:mat_peptide GU815587_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815588_HBx_P-B Product feature CHAIN GU815588_HBx_P-B of FT:mat_peptide GU815588_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815589_HBx_P-B Product feature CHAIN GU815589_HBx_P-B of FT:mat_peptide GU815589_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815590_HBx_P-B Product feature CHAIN GU815590_HBx_P-B of FT:mat_peptide GU815590_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSTRRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815591_HBx_P-B Product feature CHAIN GU815591_HBx_P-B of FT:mat_peptide GU815591_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815593_HBx_P-B Product feature CHAIN GU815593_HBx_P-B of FT:mat_peptide GU815593_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815594_HBx_P-B Product feature CHAIN GU815594_HBx_P-B of FT:mat_peptide GU815594_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815595_HBx_P-B Product feature CHAIN GU815595_HBx_P-B of FT:mat_peptide GU815595_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815596_HBx_P-B Product feature CHAIN GU815596_HBx_P-B of FT:mat_peptide GU815596_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815597_HBx_P-B Product feature CHAIN GU815597_HBx_P-B of FT:mat_peptide GU815597_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815598_HBx_P-B Product feature CHAIN GU815598_HBx_P-B of FT:mat_peptide GU815598_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815599_HBx_P-B Product feature CHAIN GU815599_HBx_P-B of FT:mat_peptide GU815599_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815600_HBx_P-B Product feature CHAIN GU815600_HBx_P-B of FT:mat_peptide GU815600_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815601_HBx_P-B Product feature CHAIN GU815601_HBx_P-B of FT:mat_peptide GU815601_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRELPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815602_HBx_P-B Product feature CHAIN GU815602_HBx_P-B of FT:mat_peptide GU815602_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLPLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815603_HBx_P-B Product feature CHAIN GU815603_HBx_P-B of FT:mat_peptide GU815603_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815604_HBx_P-B Product feature CHAIN GU815604_HBx_P-B of FT:mat_peptide GU815604_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815605_HBx_P-B Product feature CHAIN GU815605_HBx_P-B of FT:mat_peptide GU815605_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHFSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815606_HBx_P-B Product feature CHAIN GU815606_HBx_P-B of FT:mat_peptide GU815606_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815607_HBx_P-B Product feature CHAIN GU815607_HBx_P-B of FT:mat_peptide GU815607_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815608_HBx_P-B Product feature CHAIN GU815608_HBx_P-B of FT:mat_peptide GU815608_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815609_HBx_P-B Product feature CHAIN GU815609_HBx_P-B of FT:mat_peptide GU815609_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815610_HBx_P-B Product feature CHAIN GU815610_HBx_P-B of FT:mat_peptide GU815610_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNPFTSA
>gnl|hbvpro|GU815611_HBx_P-B Product feature CHAIN GU815611_HBx_P-B of FT:mat_peptide GU815611_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815612_HBx_P-B Product feature CHAIN GU815612_HBx_P-B of FT:mat_peptide GU815612_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815613_HBx_P-B Product feature CHAIN GU815613_HBx_P-B of FT:mat_peptide GU815613_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815614_HBx_P-B Product feature CHAIN GU815614_HBx_P-B of FT:mat_peptide GU815614_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815616_HBx_P-B Product feature CHAIN GU815616_HBx_P-B of FT:mat_peptide GU815616_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815617_HBx_P-B Product feature CHAIN GU815617_HBx_P-B of FT:mat_peptide GU815617_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815618_HBx_P-B Product feature CHAIN GU815618_HBx_P-B of FT:mat_peptide GU815618_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815619_HBx_P-B Product feature CHAIN GU815619_HBx_P-B of FT:mat_peptide GU815619_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815620_HBx_P-B Product feature CHAIN GU815620_HBx_P-B of FT:mat_peptide GU815620_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815621_HBx_P-B Product feature CHAIN GU815621_HBx_P-B of FT:mat_peptide GU815621_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815622_HBx_P-B Product feature CHAIN GU815622_HBx_P-B of FT:mat_peptide GU815622_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815623_HBx_P-B Product feature CHAIN GU815623_HBx_P-B of FT:mat_peptide GU815623_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815624_HBx_P-B Product feature CHAIN GU815624_HBx_P-B of FT:mat_peptide GU815624_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815625_HBx_P-B Product feature CHAIN GU815625_HBx_P-B of FT:mat_peptide GU815625_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815626_HBx_P-B Product feature CHAIN GU815626_HBx_P-B of FT:mat_peptide GU815626_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815627_HBx_P-B Product feature CHAIN GU815627_HBx_P-B of FT:mat_peptide GU815627_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815628_HBx_P-B Product feature CHAIN GU815628_HBx_P-B of FT:mat_peptide GU815628_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815629_HBx_P-B Product feature CHAIN GU815629_HBx_P-B of FT:mat_peptide GU815629_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815630_HBx_P-B Product feature CHAIN GU815630_HBx_P-B of FT:mat_peptide GU815630_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815631_HBx_P-B Product feature CHAIN GU815631_HBx_P-B of FT:mat_peptide GU815631_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815632_HBx_P-B Product feature CHAIN GU815632_HBx_P-B of FT:mat_peptide GU815632_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815633_HBx_P-B Product feature CHAIN GU815633_HBx_P-B of FT:mat_peptide GU815633_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815634_HBx_P-B Product feature CHAIN GU815634_HBx_P-B of FT:mat_peptide GU815634_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815635_HBx_P-B Product feature CHAIN GU815635_HBx_P-B of FT:mat_peptide GU815635_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815636_HBx_P-B Product feature CHAIN GU815636_HBx_P-B of FT:mat_peptide GU815636_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815637_HBx_P-B Product feature CHAIN GU815637_HBx_P-B of FT:mat_peptide GU815637_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815638_HBx_P-B Product feature CHAIN GU815638_HBx_P-B of FT:mat_peptide GU815638_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815639_HBx_P-B Product feature CHAIN GU815639_HBx_P-B of FT:mat_peptide GU815639_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815640_HBx_P-B Product feature CHAIN GU815640_HBx_P-B of FT:mat_peptide GU815640_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815641_HBx_P-B Product feature CHAIN GU815641_HBx_P-B of FT:mat_peptide GU815641_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815642_HBx_P-B Product feature CHAIN GU815642_HBx_P-B of FT:mat_peptide GU815642_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815643_HBx_P-B Product feature CHAIN GU815643_HBx_P-B of FT:mat_peptide GU815643_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815644_HBx_P-B Product feature CHAIN GU815644_HBx_P-B of FT:mat_peptide GU815644_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815645_HBx_P-B Product feature CHAIN GU815645_HBx_P-B of FT:mat_peptide GU815645_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815646_HBx_P-B Product feature CHAIN GU815646_HBx_P-B of FT:mat_peptide GU815646_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1.D1.5-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815647_HBx_P-B Product feature CHAIN GU815647_HBx_P-B of FT:mat_peptide GU815647_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2.D1.5-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815648_HBx_P-B Product feature CHAIN GU815648_HBx_P-B of FT:mat_peptide GU815648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3.D1.5-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815649_HBx_P-B Product feature CHAIN GU815649_HBx_P-B of FT:mat_peptide GU815649_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4.D1.5-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815650_HBx_P-B Product feature CHAIN GU815650_HBx_P-B of FT:mat_peptide GU815650_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5.D1.5-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815651_HBx_P-B Product feature CHAIN GU815651_HBx_P-B of FT:mat_peptide GU815651_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6.D1.5-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815652_HBx_P-B Product feature CHAIN GU815652_HBx_P-B of FT:mat_peptide GU815652_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 7.D1.5-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815653_HBx_P-B Product feature CHAIN GU815653_HBx_P-B of FT:mat_peptide GU815653_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8.D1.5-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815654_HBx_P-B Product feature CHAIN GU815654_HBx_P-B of FT:mat_peptide GU815654_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 9.D1.5-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815656_HBx_P-B Product feature CHAIN GU815656_HBx_P-B of FT:mat_peptide GU815656_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 11.D1.5-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGSCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815657_HBx_P-B Product feature CHAIN GU815657_HBx_P-B of FT:mat_peptide GU815657_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 12.D1.5-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815658_HBx_P-B Product feature CHAIN GU815658_HBx_P-B of FT:mat_peptide GU815658_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815659_HBx_P-B Product feature CHAIN GU815659_HBx_P-B of FT:mat_peptide GU815659_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815660_HBx_P-B Product feature CHAIN GU815660_HBx_P-B of FT:mat_peptide GU815660_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815661_HBx_P-B Product feature CHAIN GU815661_HBx_P-B of FT:mat_peptide GU815661_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815662_HBx_P-B Product feature CHAIN GU815662_HBx_P-B of FT:mat_peptide GU815662_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815663_HBx_P-B Product feature CHAIN GU815663_HBx_P-B of FT:mat_peptide GU815663_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815664_HBx_P-B Product feature CHAIN GU815664_HBx_P-B of FT:mat_peptide GU815664_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815665_HBx_P-B Product feature CHAIN GU815665_HBx_P-B of FT:mat_peptide GU815665_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815666_HBx_P-B Product feature CHAIN GU815666_HBx_P-B of FT:mat_peptide GU815666_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815667_HBx_P-B Product feature CHAIN GU815667_HBx_P-B of FT:mat_peptide GU815667_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815668_HBx_P-B Product feature CHAIN GU815668_HBx_P-B of FT:mat_peptide GU815668_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815669_HBx_P-B Product feature CHAIN GU815669_HBx_P-B of FT:mat_peptide GU815669_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815670_HBx_P-B Product feature CHAIN GU815670_HBx_P-B of FT:mat_peptide GU815670_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCALSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTNLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815672_HBx_P-B Product feature CHAIN GU815672_HBx_P-B of FT:mat_peptide GU815672_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815673_HBx_P-B Product feature CHAIN GU815673_HBx_P-B of FT:mat_peptide GU815673_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815674_HBx_P-B Product feature CHAIN GU815674_HBx_P-B of FT:mat_peptide GU815674_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815675_HBx_P-B Product feature CHAIN GU815675_HBx_P-B of FT:mat_peptide GU815675_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815676_HBx_P-B Product feature CHAIN GU815676_HBx_P-B of FT:mat_peptide GU815676_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815677_HBx_P-B Product feature CHAIN GU815677_HBx_P-B of FT:mat_peptide GU815677_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815678_HBx_P-B Product feature CHAIN GU815678_HBx_P-B of FT:mat_peptide GU815678_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815679_HBx_P-B Product feature CHAIN GU815679_HBx_P-B of FT:mat_peptide GU815679_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSPGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815680_HBx_P-B Product feature CHAIN GU815680_HBx_P-B of FT:mat_peptide GU815680_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815681_HBx_P-B Product feature CHAIN GU815681_HBx_P-B of FT:mat_peptide GU815681_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815683_HBx_P-B Product feature CHAIN GU815683_HBx_P-B of FT:mat_peptide GU815683_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815684_HBx_P-B Product feature CHAIN GU815684_HBx_P-B of FT:mat_peptide GU815684_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815685_HBx_P-B Product feature CHAIN GU815685_HBx_P-B of FT:mat_peptide GU815685_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815686_HBx_P-B Product feature CHAIN GU815686_HBx_P-B of FT:mat_peptide GU815686_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815687_HBx_P-B Product feature CHAIN GU815687_HBx_P-B of FT:mat_peptide GU815687_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815688_HBx_P-B Product feature CHAIN GU815688_HBx_P-B of FT:mat_peptide GU815688_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNLFTSA
>gnl|hbvpro|GU815689_HBx_P-B Product feature CHAIN GU815689_HBx_P-B of FT:mat_peptide GU815689_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E1-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815691_HBx_P-B Product feature CHAIN GU815691_HBx_P-B of FT:mat_peptide GU815691_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815692_HBx_P-B Product feature CHAIN GU815692_HBx_P-B of FT:mat_peptide GU815692_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815693_HBx_P-B Product feature CHAIN GU815693_HBx_P-B of FT:mat_peptide GU815693_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815695_HBx_P-B Product feature CHAIN GU815695_HBx_P-B of FT:mat_peptide GU815695_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815696_HBx_P-B Product feature CHAIN GU815696_HBx_P-B of FT:mat_peptide GU815696_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815697_HBx_P-B Product feature CHAIN GU815697_HBx_P-B of FT:mat_peptide GU815697_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815698_HBx_P-B Product feature CHAIN GU815698_HBx_P-B of FT:mat_peptide GU815698_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815699_HBx_P-B Product feature CHAIN GU815699_HBx_P-B of FT:mat_peptide GU815699_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815700_HBx_P-B Product feature CHAIN GU815700_HBx_P-B of FT:mat_peptide GU815700_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815701_HBx_P-B Product feature CHAIN GU815701_HBx_P-B of FT:mat_peptide GU815701_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815702_HBx_P-B Product feature CHAIN GU815702_HBx_P-B of FT:mat_peptide GU815702_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815703_HBx_P-B Product feature CHAIN GU815703_HBx_P-B of FT:mat_peptide GU815703_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815704_HBx_P-B Product feature CHAIN GU815704_HBx_P-B of FT:mat_peptide GU815704_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRSKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815705_HBx_P-B Product feature CHAIN GU815705_HBx_P-B of FT:mat_peptide GU815705_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815706_HBx_P-B Product feature CHAIN GU815706_HBx_P-B of FT:mat_peptide GU815706_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815707_HBx_P-B Product feature CHAIN GU815707_HBx_P-B of FT:mat_peptide GU815707_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNPFTSA
>gnl|hbvpro|GU815708_HBx_P-B Product feature CHAIN GU815708_HBx_P-B of FT:mat_peptide GU815708_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815709_HBx_P-B Product feature CHAIN GU815709_HBx_P-B of FT:mat_peptide GU815709_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815710_HBx_P-B Product feature CHAIN GU815710_HBx_P-B of FT:mat_peptide GU815710_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate E3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815711_HBx_P-B Product feature CHAIN GU815711_HBx_P-B of FT:mat_peptide GU815711_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815712_HBx_P-B Product feature CHAIN GU815712_HBx_P-B of FT:mat_peptide GU815712_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815713_HBx_P-B Product feature CHAIN GU815713_HBx_P-B of FT:mat_peptide GU815713_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815715_HBx_P-B Product feature CHAIN GU815715_HBx_P-B of FT:mat_peptide GU815715_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815716_HBx_P-B Product feature CHAIN GU815716_HBx_P-B of FT:mat_peptide GU815716_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815717_HBx_P-B Product feature CHAIN GU815717_HBx_P-B of FT:mat_peptide GU815717_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815718_HBx_P-B Product feature CHAIN GU815718_HBx_P-B of FT:mat_peptide GU815718_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815719_HBx_P-B Product feature CHAIN GU815719_HBx_P-B of FT:mat_peptide GU815719_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815720_HBx_P-B Product feature CHAIN GU815720_HBx_P-B of FT:mat_peptide GU815720_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815721_HBx_P-B Product feature CHAIN GU815721_HBx_P-B of FT:mat_peptide GU815721_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815722_HBx_P-B Product feature CHAIN GU815722_HBx_P-B of FT:mat_peptide GU815722_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815723_HBx_P-B Product feature CHAIN GU815723_HBx_P-B of FT:mat_peptide GU815723_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815724_HBx_P-B Product feature CHAIN GU815724_HBx_P-B of FT:mat_peptide GU815724_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPADHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815725_HBx_P-B Product feature CHAIN GU815725_HBx_P-B of FT:mat_peptide GU815725_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815726_HBx_P-B Product feature CHAIN GU815726_HBx_P-B of FT:mat_peptide GU815726_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815727_HBx_P-B Product feature CHAIN GU815727_HBx_P-B of FT:mat_peptide GU815727_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDRGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815728_HBx_P-B Product feature CHAIN GU815728_HBx_P-B of FT:mat_peptide GU815728_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815729_HBx_P-B Product feature CHAIN GU815729_HBx_P-B of FT:mat_peptide GU815729_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815730_HBx_P-B Product feature CHAIN GU815730_HBx_P-B of FT:mat_peptide GU815730_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815731_HBx_P-B Product feature CHAIN GU815731_HBx_P-B of FT:mat_peptide GU815731_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815732_HBx_P-B Product feature CHAIN GU815732_HBx_P-B of FT:mat_peptide GU815732_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMPTTDLEAYFKDCVFTEWEELGEEIRLEVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815733_HBx_P-B Product feature CHAIN GU815733_HBx_P-B of FT:mat_peptide GU815733_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSTAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815734_HBx_P-B Product feature CHAIN GU815734_HBx_P-B of FT:mat_peptide GU815734_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815735_HBx_P-B Product feature CHAIN GU815735_HBx_P-B of FT:mat_peptide GU815735_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815736_HBx_P-B Product feature CHAIN GU815736_HBx_P-B of FT:mat_peptide GU815736_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815737_HBx_P-B Product feature CHAIN GU815737_HBx_P-B of FT:mat_peptide GU815737_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815738_HBx_P-B Product feature CHAIN GU815738_HBx_P-B of FT:mat_peptide GU815738_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815739_HBx_P-B Product feature CHAIN GU815739_HBx_P-B of FT:mat_peptide GU815739_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815740_HBx_P-B Product feature CHAIN GU815740_HBx_P-B of FT:mat_peptide GU815740_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815741_HBx_P-B Product feature CHAIN GU815741_HBx_P-B of FT:mat_peptide GU815741_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815742_HBx_P-B Product feature CHAIN GU815742_HBx_P-B of FT:mat_peptide GU815742_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815743_HBx_P-B Product feature CHAIN GU815743_HBx_P-B of FT:mat_peptide GU815743_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815744_HBx_P-B Product feature CHAIN GU815744_HBx_P-B of FT:mat_peptide GU815744_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815745_HBx_P-B Product feature CHAIN GU815745_HBx_P-B of FT:mat_peptide GU815745_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815746_HBx_P-B Product feature CHAIN GU815746_HBx_P-B of FT:mat_peptide GU815746_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHQRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815747_HBx_P-B Product feature CHAIN GU815747_HBx_P-B of FT:mat_peptide GU815747_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815748_HBx_P-B Product feature CHAIN GU815748_HBx_P-B of FT:mat_peptide GU815748_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815749_HBx_P-B Product feature CHAIN GU815749_HBx_P-B of FT:mat_peptide GU815749_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815750_HBx_P-B Product feature CHAIN GU815750_HBx_P-B of FT:mat_peptide GU815750_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815751_HBx_P-B Product feature CHAIN GU815751_HBx_P-B of FT:mat_peptide GU815751_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815752_HBx_P-B Product feature CHAIN GU815752_HBx_P-B of FT:mat_peptide GU815752_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815753_HBx_P-B Product feature CHAIN GU815753_HBx_P-B of FT:mat_peptide GU815753_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815754_HBx_P-B Product feature CHAIN GU815754_HBx_P-B of FT:mat_peptide GU815754_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815755_HBx_P-B Product feature CHAIN GU815755_HBx_P-B of FT:mat_peptide GU815755_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815756_HBx_P-B Product feature CHAIN GU815756_HBx_P-B of FT:mat_peptide GU815756_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815757_HBx_P-B Product feature CHAIN GU815757_HBx_P-B of FT:mat_peptide GU815757_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815759_HBx_P-B Product feature CHAIN GU815759_HBx_P-B of FT:mat_peptide GU815759_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G1-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815760_HBx_P-B Product feature CHAIN GU815760_HBx_P-B of FT:mat_peptide GU815760_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815761_HBx_P-B Product feature CHAIN GU815761_HBx_P-B of FT:mat_peptide GU815761_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815762_HBx_P-B Product feature CHAIN GU815762_HBx_P-B of FT:mat_peptide GU815762_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815764_HBx_P-B Product feature CHAIN GU815764_HBx_P-B of FT:mat_peptide GU815764_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815765_HBx_P-B Product feature CHAIN GU815765_HBx_P-B of FT:mat_peptide GU815765_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815766_HBx_P-B Product feature CHAIN GU815766_HBx_P-B of FT:mat_peptide GU815766_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815767_HBx_P-B Product feature CHAIN GU815767_HBx_P-B of FT:mat_peptide GU815767_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815768_HBx_P-B Product feature CHAIN GU815768_HBx_P-B of FT:mat_peptide GU815768_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815769_HBx_P-B Product feature CHAIN GU815769_HBx_P-B of FT:mat_peptide GU815769_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815770_HBx_P-B Product feature CHAIN GU815770_HBx_P-B of FT:mat_peptide GU815770_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPRVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815771_HBx_P-B Product feature CHAIN GU815771_HBx_P-B of FT:mat_peptide GU815771_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G2-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815772_HBx_P-B Product feature CHAIN GU815772_HBx_P-B of FT:mat_peptide GU815772_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815773_HBx_P-B Product feature CHAIN GU815773_HBx_P-B of FT:mat_peptide GU815773_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815774_HBx_P-B Product feature CHAIN GU815774_HBx_P-B of FT:mat_peptide GU815774_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815775_HBx_P-B Product feature CHAIN GU815775_HBx_P-B of FT:mat_peptide GU815775_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815776_HBx_P-B Product feature CHAIN GU815776_HBx_P-B of FT:mat_peptide GU815776_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815777_HBx_P-B Product feature CHAIN GU815777_HBx_P-B of FT:mat_peptide GU815777_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815778_HBx_P-B Product feature CHAIN GU815778_HBx_P-B of FT:mat_peptide GU815778_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815779_HBx_P-B Product feature CHAIN GU815779_HBx_P-B of FT:mat_peptide GU815779_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815780_HBx_P-B Product feature CHAIN GU815780_HBx_P-B of FT:mat_peptide GU815780_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815781_HBx_P-B Product feature CHAIN GU815781_HBx_P-B of FT:mat_peptide GU815781_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815782_HBx_P-B Product feature CHAIN GU815782_HBx_P-B of FT:mat_peptide GU815782_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU815783_HBx_P-B Product feature CHAIN GU815783_HBx_P-B of FT:mat_peptide GU815783_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G3-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAQRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNPFTSA
>gnl|hbvpro|HM011466_HBx_P-B Product feature CHAIN HM011466_HBx_P-B of FT:mat_peptide HM011466_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011467_HBx_P-B Product feature CHAIN HM011467_HBx_P-B of FT:mat_peptide HM011467_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011469_HBx_P-B Product feature CHAIN HM011469_HBx_P-B of FT:mat_peptide HM011469_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011470_HBx_P-B Product feature CHAIN HM011470_HBx_P-B of FT:mat_peptide HM011470_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011471_HBx_P-B Product feature CHAIN HM011471_HBx_P-B of FT:mat_peptide HM011471_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011473_HBx_P-B Product feature CHAIN HM011473_HBx_P-B of FT:mat_peptide HM011473_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSXGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCPPAPXBFFTSA
>gnl|hbvpro|HM011474_HBx_P-B Product feature CHAIN HM011474_HBx_P-B of FT:mat_peptide HM011474_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPLAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWTLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|HM011475_HBx_P-B Product feature CHAIN HM011475_HBx_P-B of FT:mat_peptide HM011475_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPXCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGXRHKLVRSPAPCNFFTSA
>gnl|hbvpro|HM011476_HBx_P-B Product feature CHAIN HM011476_HBx_P-B of FT:mat_peptide HM011476_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011477_HBx_P-B Product feature CHAIN HM011477_HBx_P-B of FT:mat_peptide HM011477_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPLDVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPRNFFTSA
>gnl|hbvpro|HM011478_HBx_P-B Product feature CHAIN HM011478_HBx_P-B of FT:mat_peptide HM011478_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNXXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011480_HBx_P-B Product feature CHAIN HM011480_HBx_P-B of FT:mat_peptide HM011480_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011482_HBx_P-B Product feature CHAIN HM011482_HBx_P-B of FT:mat_peptide HM011482_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPXNFFTSAX
>gnl|hbvpro|HM011483_HBx_P-B Product feature CHAIN HM011483_HBx_P-B of FT:mat_peptide HM011483_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011484_HBx_P-B Product feature CHAIN HM011484_HBx_P-B of FT:mat_peptide HM011484_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011487_HBx_P-B Product feature CHAIN HM011487_HBx_P-B of FT:mat_peptide HM011487_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGKENRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011490_HBx_P-B Product feature CHAIN HM011490_HBx_P-B of FT:mat_peptide HM011490_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011492_HBx_P-B Product feature CHAIN HM011492_HBx_P-B of FT:mat_peptide HM011492_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011494_HBx_P-B Product feature CHAIN HM011494_HBx_P-B of FT:mat_peptide HM011494_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|HM011496_HBx_P-B Product feature CHAIN HM011496_HBx_P-B of FT:mat_peptide HM011496_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011499_HBx_P-B Product feature CHAIN HM011499_HBx_P-B of FT:mat_peptide HM011499_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHGXHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011503_HBx_P-B Product feature CHAIN HM011503_HBx_P-B of FT:mat_peptide HM011503_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011504_HBx_P-B Product feature CHAIN HM011504_HBx_P-B of FT:mat_peptide HM011504_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM153811_HBx_P-B Product feature CHAIN HM153811_HBx_P-B of FT:mat_peptide HM153811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 712005001256). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700546_HBx_P-B Product feature CHAIN HQ700546_HBx_P-B of FT:mat_peptide HQ700546_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BC_NC_AM263). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700548_HBx_P-B Product feature CHAIN HQ700548_HBx_P-B of FT:mat_peptide HQ700548_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1031A). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700549_HBx_P-B Product feature CHAIN HQ700549_HBx_P-B of FT:mat_peptide HQ700549_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I_WA1098A). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF412801_HBx_P-B Product feature CHAIN JF412801_HBx_P-B of FT:mat_peptide JF412801_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVJSTZ3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF436921_HBx_P-B Product feature CHAIN JF436921_HBx_P-B of FT:mat_peptide JF436921_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SZ7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRELPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF899335_HBx_P-B Product feature CHAIN JF899335_HBx_P-B of FT:mat_peptide JF899335_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10B1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN406371_HBx_P-B Product feature CHAIN JN406371_HBx_P-B of FT:mat_peptide JN406371_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WHUB1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPEVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792893_HBx_P-B Product feature CHAIN JN792893_HBx_P-B of FT:mat_peptide JN792893_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2004). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792894_HBx_P-B Product feature CHAIN JN792894_HBx_P-B of FT:mat_peptide JN792894_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MN2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792895_HBx_P-B Product feature CHAIN JN792895_HBx_P-B of FT:mat_peptide JN792895_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792896_HBx_P-B Product feature CHAIN JN792896_HBx_P-B of FT:mat_peptide JN792896_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KM2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792897_HBx_P-B Product feature CHAIN JN792897_HBx_P-B of FT:mat_peptide JN792897_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792898_HBx_P-B Product feature CHAIN JN792898_HBx_P-B of FT:mat_peptide JN792898_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IT2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792899_HBx_P-B Product feature CHAIN JN792899_HBx_P-B of FT:mat_peptide JN792899_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792900_HBx_P-B Product feature CHAIN JN792900_HBx_P-B of FT:mat_peptide JN792900_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AT2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792901_HBx_P-B Product feature CHAIN JN792901_HBx_P-B of FT:mat_peptide JN792901_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN792902_HBx_P-B Product feature CHAIN JN792902_HBx_P-B of FT:mat_peptide JN792902_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AD2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827419_HBx_P-B Product feature CHAIN JN827419_HBx_P-B of FT:mat_peptide JN827419_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2539). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|JQ027311_HBx_P-B Product feature CHAIN JQ027311_HBx_P-B of FT:mat_peptide JQ027311_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPYNFFTSA
>gnl|hbvpro|JQ027313_HBx_P-B Product feature CHAIN JQ027313_HBx_P-B of FT:mat_peptide JQ027313_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027315_HBx_P-B Product feature CHAIN JQ027315_HBx_P-B of FT:mat_peptide JQ027315_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEELRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ027316_HBx_P-B Product feature CHAIN JQ027316_HBx_P-B of FT:mat_peptide JQ027316_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027325_HBx_P-B Product feature CHAIN JQ027325_HBx_P-B of FT:mat_peptide JQ027325_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027329_HBx_P-B Product feature CHAIN JQ027329_HBx_P-B of FT:mat_peptide JQ027329_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPGNFFTSA
>gnl|hbvpro|JQ027330_HBx_P-B Product feature CHAIN JQ027330_HBx_P-B of FT:mat_peptide JQ027330_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKVCVFIEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027331_HBx_P-B Product feature CHAIN JQ027331_HBx_P-B of FT:mat_peptide JQ027331_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKVCVFIEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027334_HBx_P-B Product feature CHAIN JQ027334_HBx_P-B of FT:mat_peptide JQ027334_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040125_HBx_P-B Product feature CHAIN JQ040125_HBx_P-B of FT:mat_peptide JQ040125_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040128_HBx_P-B Product feature CHAIN JQ040128_HBx_P-B of FT:mat_peptide JQ040128_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040138_HBx_P-B Product feature CHAIN JQ040138_HBx_P-B of FT:mat_peptide JQ040138_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 240). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040147_HBx_P-B Product feature CHAIN JQ040147_HBx_P-B of FT:mat_peptide JQ040147_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 280). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040157_HBx_P-B Product feature CHAIN JQ040157_HBx_P-B of FT:mat_peptide JQ040157_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G187). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040169_HBx_P-B Product feature CHAIN JQ040169_HBx_P-B of FT:mat_peptide JQ040169_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G237). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPIVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ040170_HBx_P-B Product feature CHAIN JQ040170_HBx_P-B of FT:mat_peptide JQ040170_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G238). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLXPMSTTDLEAYFKDCVFNEWEEXGEEVRXKVXVLGGCMHXLVCXPXPCNFFTSA
>gnl|hbvpro|JQ040171_HBx_P-B Product feature CHAIN JQ040171_HBx_P-B of FT:mat_peptide JQ040171_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G239). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040173_HBx_P-B Product feature CHAIN JQ040173_HBx_P-B of FT:mat_peptide JQ040173_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G244). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ341793_HBx_P-B Product feature CHAIN JQ341793_HBx_P-B of FT:mat_peptide JQ341793_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno01). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341794_HBx_P-B Product feature CHAIN JQ341794_HBx_P-B of FT:mat_peptide JQ341794_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno02). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341795_HBx_P-B Product feature CHAIN JQ341795_HBx_P-B of FT:mat_peptide JQ341795_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno03). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEXRLKVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JQ341796_HBx_P-B Product feature CHAIN JQ341796_HBx_P-B of FT:mat_peptide JQ341796_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno04). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341797_HBx_P-B Product feature CHAIN JQ341797_HBx_P-B of FT:mat_peptide JQ341797_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno05). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341798_HBx_P-B Product feature CHAIN JQ341798_HBx_P-B of FT:mat_peptide JQ341798_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno06). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHGAHLSLRGLPVCAFSSAXPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELXEEIRXKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341799_HBx_P-B Product feature CHAIN JQ341799_HBx_P-B of FT:mat_peptide JQ341799_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno07). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341800_HBx_P-B Product feature CHAIN JQ341800_HBx_P-B of FT:mat_peptide JQ341800_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno08). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341802_HBx_P-B Product feature CHAIN JQ341802_HBx_P-B of FT:mat_peptide JQ341802_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno10). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341803_HBx_P-B Product feature CHAIN JQ341803_HBx_P-B of FT:mat_peptide JQ341803_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno11). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341804_HBx_P-B Product feature CHAIN JQ341804_HBx_P-B of FT:mat_peptide JQ341804_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno12). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ341807_HBx_P-B Product feature CHAIN JQ341807_HBx_P-B of FT:mat_peptide JQ341807_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno15). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341808_HBx_P-B Product feature CHAIN JQ341808_HBx_P-B of FT:mat_peptide JQ341808_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno16). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLXALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCXPAPCNFFTSA
>gnl|hbvpro|JQ341809_HBx_P-B Product feature CHAIN JQ341809_HBx_P-B of FT:mat_peptide JQ341809_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno17). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341810_HBx_P-B Product feature CHAIN JQ341810_HBx_P-B of FT:mat_peptide JQ341810_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno18). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341811_HBx_P-B Product feature CHAIN JQ341811_HBx_P-B of FT:mat_peptide JQ341811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno19). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXXPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEXRLKVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JQ341812_HBx_P-B Product feature CHAIN JQ341812_HBx_P-B of FT:mat_peptide JQ341812_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno20). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341813_HBx_P-B Product feature CHAIN JQ341813_HBx_P-B of FT:mat_peptide JQ341813_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno21). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRPPAPCNFFTSA
>gnl|hbvpro|JQ341814_HBx_P-B Product feature CHAIN JQ341814_HBx_P-B of FT:mat_peptide JQ341814_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno22). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341815_HBx_P-B Product feature CHAIN JQ341815_HBx_P-B of FT:mat_peptide JQ341815_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno23). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ341816_HBx_P-B Product feature CHAIN JQ341816_HBx_P-B of FT:mat_peptide JQ341816_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno24). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341817_HBx_P-B Product feature CHAIN JQ341817_HBx_P-B of FT:mat_peptide JQ341817_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno25). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ341818_HBx_P-B Product feature CHAIN JQ341818_HBx_P-B of FT:mat_peptide JQ341818_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno26). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341819_HBx_P-B Product feature CHAIN JQ341819_HBx_P-B of FT:mat_peptide JQ341819_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno27). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341821_HBx_P-B Product feature CHAIN JQ341821_HBx_P-B of FT:mat_peptide JQ341821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno29). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JQ341822_HBx_P-B Product feature CHAIN JQ341822_HBx_P-B of FT:mat_peptide JQ341822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno30). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341823_HBx_P-B Product feature CHAIN JQ341823_HBx_P-B of FT:mat_peptide JQ341823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno31). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPAASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341824_HBx_P-B Product feature CHAIN JQ341824_HBx_P-B of FT:mat_peptide JQ341824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno32). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341825_HBx_P-B Product feature CHAIN JQ341825_HBx_P-B of FT:mat_peptide JQ341825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno33). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSEMSTTDLEAYFKDCVFNEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341826_HBx_P-B Product feature CHAIN JQ341826_HBx_P-B of FT:mat_peptide JQ341826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno34). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341827_HBx_P-B Product feature CHAIN JQ341827_HBx_P-B of FT:mat_peptide JQ341827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno35). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341828_HBx_P-B Product feature CHAIN JQ341828_HBx_P-B of FT:mat_peptide JQ341828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno36). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341830_HBx_P-B Product feature CHAIN JQ341830_HBx_P-B of FT:mat_peptide JQ341830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno38). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341831_HBx_P-B Product feature CHAIN JQ341831_HBx_P-B of FT:mat_peptide JQ341831_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno39). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGVETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341833_HBx_P-B Product feature CHAIN JQ341833_HBx_P-B of FT:mat_peptide JQ341833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno41). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDRVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341835_HBx_P-B Product feature CHAIN JQ341835_HBx_P-B of FT:mat_peptide JQ341835_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno43). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARXNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341836_HBx_P-B Product feature CHAIN JQ341836_HBx_P-B of FT:mat_peptide JQ341836_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno44). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPPVXPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEARLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ341837_HBx_P-B Product feature CHAIN JQ341837_HBx_P-B of FT:mat_peptide JQ341837_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno45). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341838_HBx_P-B Product feature CHAIN JQ341838_HBx_P-B of FT:mat_peptide JQ341838_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno46). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALGNLPKVLHKRTLGLSAMSTTDLEAYFKDCEDTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341839_HBx_P-B Product feature CHAIN JQ341839_HBx_P-B of FT:mat_peptide JQ341839_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno47). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ341840_HBx_P-B Product feature CHAIN JQ341840_HBx_P-B of FT:mat_peptide JQ341840_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno48). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVXAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRXE
TTVNAHRNLPTVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341842_HBx_P-B Product feature CHAIN JQ341842_HBx_P-B of FT:mat_peptide JQ341842_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno50). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341843_HBx_P-B Product feature CHAIN JQ341843_HBx_P-B of FT:mat_peptide JQ341843_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno51). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341844_HBx_P-B Product feature CHAIN JQ341844_HBx_P-B of FT:mat_peptide JQ341844_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno52). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341845_HBx_P-B Product feature CHAIN JQ341845_HBx_P-B of FT:mat_peptide JQ341845_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno53). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRXKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341848_HBx_P-B Product feature CHAIN JQ341848_HBx_P-B of FT:mat_peptide JQ341848_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno56). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXNLXKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341850_HBx_P-B Product feature CHAIN JQ341850_HBx_P-B of FT:mat_peptide JQ341850_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno58). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVXPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXEWEELGAEARLMIFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|JQ341853_HBx_P-B Product feature CHAIN JQ341853_HBx_P-B of FT:mat_peptide JQ341853_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Bgeno61). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429079_HBx_P-B Product feature CHAIN JQ429079_HBx_P-B of FT:mat_peptide JQ429079_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 08.10.002). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429080_HBx_P-B Product feature CHAIN JQ429080_HBx_P-B of FT:mat_peptide JQ429080_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.40.033). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429081_HBx_P-B Product feature CHAIN JQ429081_HBx_P-B of FT:mat_peptide JQ429081_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.80.055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429082_HBx_P-B Product feature CHAIN JQ429082_HBx_P-B of FT:mat_peptide JQ429082_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 09.41.591). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ688405_HBx_P-B Product feature CHAIN JQ688405_HBx_P-B of FT:mat_peptide JQ688405_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBVB2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707734_HBx_P-B Product feature CHAIN JQ707734_HBx_P-B of FT:mat_peptide JQ707734_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707735_HBx_P-B Product feature CHAIN JQ707735_HBx_P-B of FT:mat_peptide JQ707735_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707736_HBx_P-B Product feature CHAIN JQ707736_HBx_P-B of FT:mat_peptide JQ707736_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_11). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707737_HBx_P-B Product feature CHAIN JQ707737_HBx_P-B of FT:mat_peptide JQ707737_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707738_HBx_P-B Product feature CHAIN JQ707738_HBx_P-B of FT:mat_peptide JQ707738_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707739_HBx_P-B Product feature CHAIN JQ707739_HBx_P-B of FT:mat_peptide JQ707739_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707740_HBx_P-B Product feature CHAIN JQ707740_HBx_P-B of FT:mat_peptide JQ707740_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707741_HBx_P-B Product feature CHAIN JQ707741_HBx_P-B of FT:mat_peptide JQ707741_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_19). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707742_HBx_P-B Product feature CHAIN JQ707742_HBx_P-B of FT:mat_peptide JQ707742_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707743_HBx_P-B Product feature CHAIN JQ707743_HBx_P-B of FT:mat_peptide JQ707743_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_20-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707744_HBx_P-B Product feature CHAIN JQ707744_HBx_P-B of FT:mat_peptide JQ707744_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALQPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707745_HBx_P-B Product feature CHAIN JQ707745_HBx_P-B of FT:mat_peptide JQ707745_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707746_HBx_P-B Product feature CHAIN JQ707746_HBx_P-B of FT:mat_peptide JQ707746_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_24-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707747_HBx_P-B Product feature CHAIN JQ707747_HBx_P-B of FT:mat_peptide JQ707747_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707748_HBx_P-B Product feature CHAIN JQ707748_HBx_P-B of FT:mat_peptide JQ707748_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_26). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707749_HBx_P-B Product feature CHAIN JQ707749_HBx_P-B of FT:mat_peptide JQ707749_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707750_HBx_P-B Product feature CHAIN JQ707750_HBx_P-B of FT:mat_peptide JQ707750_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707751_HBx_P-B Product feature CHAIN JQ707751_HBx_P-B of FT:mat_peptide JQ707751_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_30). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707752_HBx_P-B Product feature CHAIN JQ707752_HBx_P-B of FT:mat_peptide JQ707752_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_31). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707753_HBx_P-B Product feature CHAIN JQ707753_HBx_P-B of FT:mat_peptide JQ707753_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707754_HBx_P-B Product feature CHAIN JQ707754_HBx_P-B of FT:mat_peptide JQ707754_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_33). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707755_HBx_P-B Product feature CHAIN JQ707755_HBx_P-B of FT:mat_peptide JQ707755_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707756_HBx_P-B Product feature CHAIN JQ707756_HBx_P-B of FT:mat_peptide JQ707756_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_39). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707757_HBx_P-B Product feature CHAIN JQ707757_HBx_P-B of FT:mat_peptide JQ707757_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_40). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MVARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707758_HBx_P-B Product feature CHAIN JQ707758_HBx_P-B of FT:mat_peptide JQ707758_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707759_HBx_P-B Product feature CHAIN JQ707759_HBx_P-B of FT:mat_peptide JQ707759_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707760_HBx_P-B Product feature CHAIN JQ707760_HBx_P-B of FT:mat_peptide JQ707760_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_44). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707761_HBx_P-B Product feature CHAIN JQ707761_HBx_P-B of FT:mat_peptide JQ707761_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_45). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707762_HBx_P-B Product feature CHAIN JQ707762_HBx_P-B of FT:mat_peptide JQ707762_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPERDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707763_HBx_P-B Product feature CHAIN JQ707763_HBx_P-B of FT:mat_peptide JQ707763_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707764_HBx_P-B Product feature CHAIN JQ707764_HBx_P-B of FT:mat_peptide JQ707764_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707765_HBx_P-B Product feature CHAIN JQ707765_HBx_P-B of FT:mat_peptide JQ707765_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707766_HBx_P-B Product feature CHAIN JQ707766_HBx_P-B of FT:mat_peptide JQ707766_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707767_HBx_P-B Product feature CHAIN JQ707767_HBx_P-B of FT:mat_peptide JQ707767_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S35_9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801471_HBx_P-B Product feature CHAIN JQ801471_HBx_P-B of FT:mat_peptide JQ801471_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801474_HBx_P-B Product feature CHAIN JQ801474_HBx_P-B of FT:mat_peptide JQ801474_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801479_HBx_P-B Product feature CHAIN JQ801479_HBx_P-B of FT:mat_peptide JQ801479_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801485_HBx_P-B Product feature CHAIN JQ801485_HBx_P-B of FT:mat_peptide JQ801485_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate AIDS32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLAALSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JQ801494_HBx_P-B Product feature CHAIN JQ801494_HBx_P-B of FT:mat_peptide JQ801494_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801506_HBx_P-B Product feature CHAIN JQ801506_HBx_P-B of FT:mat_peptide JQ801506_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPSVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFAEWEELGEEMRLKVFVLGGCRHKLVCSPXPCHFFTSA
>gnl|hbvpro|JQ801507_HBx_P-B Product feature CHAIN JQ801507_HBx_P-B of FT:mat_peptide JQ801507_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDQRAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801512_HBx_P-B Product feature CHAIN JQ801512_HBx_P-B of FT:mat_peptide JQ801512_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLPAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSLAPCNFFTSA
>gnl|hbvpro|JQ801514_HBx_P-B Product feature CHAIN JQ801514_HBx_P-B of FT:mat_peptide JQ801514_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801516_HBx_P-B Product feature CHAIN JQ801516_HBx_P-B of FT:mat_peptide JQ801516_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801524_HBx_P-B Product feature CHAIN JQ801524_HBx_P-B of FT:mat_peptide JQ801524_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CONTROL32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026879_HBx_P-B Product feature CHAIN JX026879_HBx_P-B of FT:mat_peptide JX026879_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLAAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX026883_HBx_P-B Product feature CHAIN JX026883_HBx_P-B of FT:mat_peptide JX026883_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-50). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHERTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIYALGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026886_HBx_P-B Product feature CHAIN JX026886_HBx_P-B of FT:mat_peptide JX026886_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NJ-73). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQPDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429897_HBx_P-B Product feature CHAIN JX429897_HBx_P-B of FT:mat_peptide JX429897_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLSLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX429899_HBx_P-B Product feature CHAIN JX429899_HBx_P-B of FT:mat_peptide JX429899_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429900_HBx_P-B Product feature CHAIN JX429900_HBx_P-B of FT:mat_peptide JX429900_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-24). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429901_HBx_P-B Product feature CHAIN JX429901_HBx_P-B of FT:mat_peptide JX429901_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429902_HBx_P-B Product feature CHAIN JX429902_HBx_P-B of FT:mat_peptide JX429902_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429908_HBx_P-B Product feature CHAIN JX429908_HBx_P-B of FT:mat_peptide JX429908_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-58). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429910_HBx_P-B Product feature CHAIN JX429910_HBx_P-B of FT:mat_peptide JX429910_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504531_HBx_P-B Product feature CHAIN JX504531_HBx_P-B of FT:mat_peptide JX504531_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-1). Non-functional genomic sequence. [Hepadnaviridae] (length=153 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMV
LVNTHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEDLGEEVRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX504532_HBx_P-B Product feature CHAIN JX504532_HBx_P-B of FT:mat_peptide JX504532_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGAEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504533_HBx_P-B Product feature CHAIN JX504533_HBx_P-B of FT:mat_peptide JX504533_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNVHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFNEWEELGAEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504538_HBx_P-B Product feature CHAIN JX504538_HBx_P-B of FT:mat_peptide JX504538_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-HZ-65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKSTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504543_HBx_P-B Product feature CHAIN JX504543_HBx_P-B of FT:mat_peptide JX504543_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate WY-NNJ-19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX507210_HBx_P-B Product feature CHAIN JX507210_HBx_P-B of FT:mat_peptide JX507210_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHENLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX507213_HBx_P-B Product feature CHAIN JX507213_HBx_P-B of FT:mat_peptide JX507213_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTXGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLXVFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JX507215_HBx_P-B Product feature CHAIN JX507215_HBx_P-B of FT:mat_peptide JX507215_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 310). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEEFGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661470_HBx_P-B Product feature CHAIN JX661470_HBx_P-B of FT:mat_peptide JX661470_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1221-B12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSNYGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLETYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661471_HBx_P-B Product feature CHAIN JX661471_HBx_P-B of FT:mat_peptide JX661471_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1202-B1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661472_HBx_P-B Product feature CHAIN JX661472_HBx_P-B of FT:mat_peptide JX661472_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1224-B13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661473_HBx_P-B Product feature CHAIN JX661473_HBx_P-B of FT:mat_peptide JX661473_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1220-B11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPHLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661474_HBx_P-B Product feature CHAIN JX661474_HBx_P-B of FT:mat_peptide JX661474_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1229-B15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661475_HBx_P-B Product feature CHAIN JX661475_HBx_P-B of FT:mat_peptide JX661475_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1216-B9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661476_HBx_P-B Product feature CHAIN JX661476_HBx_P-B of FT:mat_peptide JX661476_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1227-B14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661477_HBx_P-B Product feature CHAIN JX661477_HBx_P-B of FT:mat_peptide JX661477_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1209-B5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGDEVRLKVLYLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661478_HBx_P-B Product feature CHAIN JX661478_HBx_P-B of FT:mat_peptide JX661478_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1211-B7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661479_HBx_P-B Product feature CHAIN JX661479_HBx_P-B of FT:mat_peptide JX661479_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1219-B10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGAEVRLMIFVLGGLRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661480_HBx_P-B Product feature CHAIN JX661480_HBx_P-B of FT:mat_peptide JX661480_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1210-B6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661481_HBx_P-B Product feature CHAIN JX661481_HBx_P-B of FT:mat_peptide JX661481_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1214-B8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVFPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVLYLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661482_HBx_P-B Product feature CHAIN JX661482_HBx_P-B of FT:mat_peptide JX661482_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1204-B2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVCVLGGCCYERVCSPAPCNFFTLA
>gnl|hbvpro|JX661483_HBx_P-B Product feature CHAIN JX661483_HBx_P-B of FT:mat_peptide JX661483_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1205-B3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKVCVLGGCCYERVCSPAPCNFFTLA
>gnl|hbvpro|JX661484_HBx_P-B Product feature CHAIN JX661484_HBx_P-B of FT:mat_peptide JX661484_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate SH1206-B4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX869998_HBx_P-B Product feature CHAIN JX869998_HBx_P-B of FT:mat_peptide JX869998_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 317). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX869999_HBx_P-B Product feature CHAIN JX869999_HBx_P-B of FT:mat_peptide JX869999_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGTLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX870001_HBx_P-B Product feature CHAIN JX870001_HBx_P-B of FT:mat_peptide JX870001_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JX978431_HBx_P-B Product feature CHAIN JX978431_HBx_P-B of FT:mat_peptide JX978431_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate X02). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163805_HBx_P-B Product feature CHAIN KC163805_HBx_P-B of FT:mat_peptide KC163805_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3009). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTEWEELGEEMRLTVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163809_HBx_P-B Product feature CHAIN KC163809_HBx_P-B of FT:mat_peptide KC163809_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3043). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLEALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEKLGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163810_HBx_P-B Product feature CHAIN KC163810_HBx_P-B of FT:mat_peptide KC163810_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3004). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163811_HBx_P-B Product feature CHAIN KC163811_HBx_P-B of FT:mat_peptide KC163811_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3010). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163812_HBx_P-B Product feature CHAIN KC163812_HBx_P-B of FT:mat_peptide KC163812_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3024). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163813_HBx_P-B Product feature CHAIN KC163813_HBx_P-B of FT:mat_peptide KC163813_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3029). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163814_HBx_P-B Product feature CHAIN KC163814_HBx_P-B of FT:mat_peptide KC163814_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3046). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCRLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163815_HBx_P-B Product feature CHAIN KC163815_HBx_P-B of FT:mat_peptide KC163815_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3048). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRILGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163816_HBx_P-B Product feature CHAIN KC163816_HBx_P-B of FT:mat_peptide KC163816_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3002). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163817_HBx_P-B Product feature CHAIN KC163817_HBx_P-B of FT:mat_peptide KC163817_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3003). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163818_HBx_P-B Product feature CHAIN KC163818_HBx_P-B of FT:mat_peptide KC163818_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3013). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163819_HBx_P-B Product feature CHAIN KC163819_HBx_P-B of FT:mat_peptide KC163819_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163820_HBx_P-B Product feature CHAIN KC163820_HBx_P-B of FT:mat_peptide KC163820_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3016). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163821_HBx_P-B Product feature CHAIN KC163821_HBx_P-B of FT:mat_peptide KC163821_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3018). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163822_HBx_P-B Product feature CHAIN KC163822_HBx_P-B of FT:mat_peptide KC163822_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3025). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163823_HBx_P-B Product feature CHAIN KC163823_HBx_P-B of FT:mat_peptide KC163823_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3026). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163824_HBx_P-B Product feature CHAIN KC163824_HBx_P-B of FT:mat_peptide KC163824_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3027). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163825_HBx_P-B Product feature CHAIN KC163825_HBx_P-B of FT:mat_peptide KC163825_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3031). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163826_HBx_P-B Product feature CHAIN KC163826_HBx_P-B of FT:mat_peptide KC163826_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3033). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163827_HBx_P-B Product feature CHAIN KC163827_HBx_P-B of FT:mat_peptide KC163827_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3036). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163828_HBx_P-B Product feature CHAIN KC163828_HBx_P-B of FT:mat_peptide KC163828_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3035). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163829_HBx_P-B Product feature CHAIN KC163829_HBx_P-B of FT:mat_peptide KC163829_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3040). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163830_HBx_P-B Product feature CHAIN KC163830_HBx_P-B of FT:mat_peptide KC163830_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3021). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163831_HBx_P-B Product feature CHAIN KC163831_HBx_P-B of FT:mat_peptide KC163831_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3044). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC163833_HBx_P-B Product feature CHAIN KC163833_HBx_P-B of FT:mat_peptide KC163833_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3017). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KC315393_HBx_P-B Product feature CHAIN KC315393_HBx_P-B of FT:mat_peptide KC315393_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0912). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC492739_HBx_P-B Product feature CHAIN KC492739_HBx_P-B of FT:mat_peptide KC492739_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate MT). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC492740_HBx_P-B Product feature CHAIN KC492740_HBx_P-B of FT:mat_peptide KC492740_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Del). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC510641_HBx_P-B Product feature CHAIN KC510641_HBx_P-B of FT:mat_peptide KC510641_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLETYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCGFFTSA
>gnl|hbvpro|KC510642_HBx_P-B Product feature CHAIN KC510642_HBx_P-B of FT:mat_peptide KC510642_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVRSRGPRGFFTSA
>gnl|hbvpro|KC510643_HBx_P-B Product feature CHAIN KC510643_HBx_P-B of FT:mat_peptide KC510643_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC510644_HBx_P-B Product feature CHAIN KC510644_HBx_P-B of FT:mat_peptide KC510644_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNPHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLMRSRCPRDFFTSA
>gnl|hbvpro|KC510646_HBx_P-B Product feature CHAIN KC510646_HBx_P-B of FT:mat_peptide KC510646_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSPTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVRSRGPRGFFTSA
>gnl|hbvpro|KC510647_HBx_P-B Product feature CHAIN KC510647_HBx_P-B of FT:mat_peptide KC510647_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC510648_HBx_P-B Product feature CHAIN KC510648_HBx_P-B of FT:mat_peptide KC510648_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNPHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLMRSRCPCGFFTSA
>gnl|hbvpro|KC510649_HBx_P-B Product feature CHAIN KC510649_HBx_P-B of FT:mat_peptide KC510649_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLETYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCGFFTSA
>gnl|hbvpro|KC510650_HBx_P-B Product feature CHAIN KC510650_HBx_P-B of FT:mat_peptide KC510650_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC510651_HBx_P-B Product feature CHAIN KC510651_HBx_P-B of FT:mat_peptide KC510651_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510652_HBx_P-B Product feature CHAIN KC510652_HBx_P-B of FT:mat_peptide KC510652_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510653_HBx_P-B Product feature CHAIN KC510653_HBx_P-B of FT:mat_peptide KC510653_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSPTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVRSRGPCGFFTSA
>gnl|hbvpro|KC510654_HBx_P-B Product feature CHAIN KC510654_HBx_P-B of FT:mat_peptide KC510654_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC510655_HBx_P-B Product feature CHAIN KC510655_HBx_P-B of FT:mat_peptide KC510655_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510656_HBx_P-B Product feature CHAIN KC510656_HBx_P-B of FT:mat_peptide KC510656_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVRSRGPCGFFTSA
>gnl|hbvpro|KC510657_HBx_P-B Product feature CHAIN KC510657_HBx_P-B of FT:mat_peptide KC510657_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEETRLMIFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510658_HBx_P-B Product feature CHAIN KC510658_HBx_P-B of FT:mat_peptide KC510658_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRNLPTVLHKRTLGLSAMSTTDLETYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCGFFTSA
>gnl|hbvpro|KC510659_HBx_P-B Product feature CHAIN KC510659_HBx_P-B of FT:mat_peptide KC510659_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSPTDLEAYFKDCVFKEWEELGEEVRLMIFVLGGCRHKLVRSRGPCDFFTSA
>gnl|hbvpro|KC510660_HBx_P-B Product feature CHAIN KC510660_HBx_P-B of FT:mat_peptide KC510660_HBx_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCDFFTSA
>gnl|hbvpro|KC774362_HBx_P-B Product feature CHAIN KC774362_HBx_P-B of FT:mat_peptide KC774362_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz1107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDPGAHLSLRGLPVCAFSSTGPCALRFTSARSME
TTVNAHRNLPKVLHKRTLVLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774363_HBx_P-B Product feature CHAIN KC774363_HBx_P-B of FT:mat_peptide KC774363_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774365_HBx_P-B Product feature CHAIN KC774365_HBx_P-B of FT:mat_peptide KC774365_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774366_HBx_P-B Product feature CHAIN KC774366_HBx_P-B of FT:mat_peptide KC774366_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774367_HBx_P-B Product feature CHAIN KC774367_HBx_P-B of FT:mat_peptide KC774367_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate blz2147). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774368_HBx_P-B Product feature CHAIN KC774368_HBx_P-B of FT:mat_peptide KC774368_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1012). Complete genome. [Hepadnaviridae] (length=154 residues).
MGGRLCCQMDPARDVLCLRPVGAESRGRPLPGPLGALPPAFPPVVPTDHGAHLSLRGLPVCAFSFAGPCALCFTFARCKE
TPVNAHRNLPKVLHKRTLGLSAKSTTDLEAYFKDSLFTEWEELGEEVKLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774369_HBx_P-B Product feature CHAIN KC774369_HBx_P-B of FT:mat_peptide KC774369_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQMDPARDVLCLRPVGAESRGRPPPGPLGALPPASPFAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRNFGLLAMSTTDPEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774370_HBx_P-B Product feature CHAIN KC774370_HBx_P-B of FT:mat_peptide KC774370_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1014). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAFPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774371_HBx_P-B Product feature CHAIN KC774371_HBx_P-B of FT:mat_peptide KC774371_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1036). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774372_HBx_P-B Product feature CHAIN KC774372_HBx_P-B of FT:mat_peptide KC774372_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1040). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDPGGPLSLRGLPVCAFSSAGPCALCFPSARRME
TPVNAPRNFPKVLQKRIFVLSEMSTTDLEAYFKNCVFNEWEELGEDIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774373_HBx_P-B Product feature CHAIN KC774373_HBx_P-B of FT:mat_peptide KC774373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1044). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774374_HBx_P-B Product feature CHAIN KC774374_HBx_P-B of FT:mat_peptide KC774374_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1053). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEESGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774375_HBx_P-B Product feature CHAIN KC774375_HBx_P-B of FT:mat_peptide KC774375_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGDLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTYARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774376_HBx_P-B Product feature CHAIN KC774376_HBx_P-B of FT:mat_peptide KC774376_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1056). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774377_HBx_P-B Product feature CHAIN KC774377_HBx_P-B of FT:mat_peptide KC774377_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bur1064). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774378_HBx_P-B Product feature CHAIN KC774378_HBx_P-B of FT:mat_peptide KC774378_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1015). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774379_HBx_P-B Product feature CHAIN KC774379_HBx_P-B of FT:mat_peptide KC774379_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1023). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774380_HBx_P-B Product feature CHAIN KC774380_HBx_P-B of FT:mat_peptide KC774380_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774381_HBx_P-B Product feature CHAIN KC774381_HBx_P-B of FT:mat_peptide KC774381_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1062). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774382_HBx_P-B Product feature CHAIN KC774382_HBx_P-B of FT:mat_peptide KC774382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1063). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRNLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVVAGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774383_HBx_P-B Product feature CHAIN KC774383_HBx_P-B of FT:mat_peptide KC774383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1081). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNTHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774384_HBx_P-B Product feature CHAIN KC774384_HBx_P-B of FT:mat_peptide KC774384_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1091). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774385_HBx_P-B Product feature CHAIN KC774385_HBx_P-B of FT:mat_peptide KC774385_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1099). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774386_HBx_P-B Product feature CHAIN KC774386_HBx_P-B of FT:mat_peptide KC774386_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPTPPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774387_HBx_P-B Product feature CHAIN KC774387_HBx_P-B of FT:mat_peptide KC774387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774388_HBx_P-B Product feature CHAIN KC774388_HBx_P-B of FT:mat_peptide KC774388_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774389_HBx_P-B Product feature CHAIN KC774389_HBx_P-B of FT:mat_peptide KC774389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww1121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774390_HBx_P-B Product feature CHAIN KC774390_HBx_P-B of FT:mat_peptide KC774390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2158). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774391_HBx_P-B Product feature CHAIN KC774391_HBx_P-B of FT:mat_peptide KC774391_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2163). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774392_HBx_P-B Product feature CHAIN KC774392_HBx_P-B of FT:mat_peptide KC774392_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bww2169). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774393_HBx_P-B Product feature CHAIN KC774393_HBx_P-B of FT:mat_peptide KC774393_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1068). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLTGPLGALPPASPPIVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNSHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774394_HBx_P-B Product feature CHAIN KC774394_HBx_P-B of FT:mat_peptide KC774394_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1070). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774395_HBx_P-B Product feature CHAIN KC774395_HBx_P-B of FT:mat_peptide KC774395_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1073). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774396_HBx_P-B Product feature CHAIN KC774396_HBx_P-B of FT:mat_peptide KC774396_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1182). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774397_HBx_P-B Product feature CHAIN KC774397_HBx_P-B of FT:mat_peptide KC774397_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFRDCVFTEWEELGEEVRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774398_HBx_P-B Product feature CHAIN KC774398_HBx_P-B of FT:mat_peptide KC774398_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1202). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSVMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774399_HBx_P-B Product feature CHAIN KC774399_HBx_P-B of FT:mat_peptide KC774399_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1556). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774400_HBx_P-B Product feature CHAIN KC774400_HBx_P-B of FT:mat_peptide KC774400_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1585). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSVLSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774401_HBx_P-B Product feature CHAIN KC774401_HBx_P-B of FT:mat_peptide KC774401_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1663). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774402_HBx_P-B Product feature CHAIN KC774402_HBx_P-B of FT:mat_peptide KC774402_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa1670). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774403_HBx_P-B Product feature CHAIN KC774403_HBx_P-B of FT:mat_peptide KC774403_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774404_HBx_P-B Product feature CHAIN KC774404_HBx_P-B of FT:mat_peptide KC774404_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774405_HBx_P-B Product feature CHAIN KC774405_HBx_P-B of FT:mat_peptide KC774405_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLRALPPASPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYIKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774406_HBx_P-B Product feature CHAIN KC774406_HBx_P-B of FT:mat_peptide KC774406_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVICLRPVGAESCGRPLPGPLGALPPASPPCVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774407_HBx_P-B Product feature CHAIN KC774407_HBx_P-B of FT:mat_peptide KC774407_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSSMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774408_HBx_P-B Product feature CHAIN KC774408_HBx_P-B of FT:mat_peptide KC774408_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2012). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774409_HBx_P-B Product feature CHAIN KC774409_HBx_P-B of FT:mat_peptide KC774409_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774410_HBx_P-B Product feature CHAIN KC774410_HBx_P-B of FT:mat_peptide KC774410_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774411_HBx_P-B Product feature CHAIN KC774411_HBx_P-B of FT:mat_peptide KC774411_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2025). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774412_HBx_P-B Product feature CHAIN KC774412_HBx_P-B of FT:mat_peptide KC774412_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2034). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774413_HBx_P-B Product feature CHAIN KC774413_HBx_P-B of FT:mat_peptide KC774413_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2037). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774415_HBx_P-B Product feature CHAIN KC774415_HBx_P-B of FT:mat_peptide KC774415_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxa2064). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774416_HBx_P-B Product feature CHAIN KC774416_HBx_P-B of FT:mat_peptide KC774416_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1016). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLYLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774417_HBx_P-B Product feature CHAIN KC774417_HBx_P-B of FT:mat_peptide KC774417_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1028). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774418_HBx_P-B Product feature CHAIN KC774418_HBx_P-B of FT:mat_peptide KC774418_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774419_HBx_P-B Product feature CHAIN KC774419_HBx_P-B of FT:mat_peptide KC774419_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate bxn1083). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSMTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814873_HBx_P-B Product feature CHAIN KC814873_HBx_P-B of FT:mat_peptide KC814873_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209422C). Partial genome (Contains: HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLTNAREVLCLRPVGAESRGRPLPGPLGALPSASSPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLMIFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KC814875_HBx_P-B Product feature CHAIN KC814875_HBx_P-B of FT:mat_peptide KC814875_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209424C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
FAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKCCCLLAPCNFFTSA
>gnl|hbvpro|KC814883_HBx_P-B Product feature CHAIN KC814883_HBx_P-B of FT:mat_peptide KC814883_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209432C). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLTNRREVLCLRPVGAESRGRPLSGPLGALPPPSPPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRDLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFGLRGGRHRLICSPPPCNFFTSA
>gnl|hbvpro|KC814890_HBx_P-B Product feature CHAIN KC814890_HBx_P-B of FT:mat_peptide KC814890_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M020944P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSLIPCNFFTSS
>gnl|hbvpro|KC814917_HBx_P-B Product feature CHAIN KC814917_HBx_P-B of FT:mat_peptide KC814917_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209431P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSLIACNFFTSA
>gnl|hbvpro|KC814918_HBx_P-B Product feature CHAIN KC814918_HBx_P-B of FT:mat_peptide KC814918_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M0209432P). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLKLARDSLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSLPSCNFFTSA
>gnl|hbvpro|KJ173297_HBx_P-B Product feature CHAIN KJ173297_HBx_P-B of FT:mat_peptide KJ173297_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008C(e46n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173298_HBx_P-B Product feature CHAIN KJ173298_HBx_P-B of FT:mat_peptide KJ173298_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate FH008M(e47)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHWNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173339_HBx_P-B Product feature CHAIN KJ173339_HBx_P-B of FT:mat_peptide KJ173339_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001C(e201)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEDVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173340_HBx_P-B Product feature CHAIN KJ173340_HBx_P-B of FT:mat_peptide KJ173340_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX001M(e202)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEDVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173341_HBx_P-B Product feature CHAIN KJ173341_HBx_P-B of FT:mat_peptide KJ173341_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003C(e204)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173342_HBx_P-B Product feature CHAIN KJ173342_HBx_P-B of FT:mat_peptide KJ173342_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX003M(e205)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173343_HBx_P-B Product feature CHAIN KJ173343_HBx_P-B of FT:mat_peptide KJ173343_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX007C(e211)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173345_HBx_P-B Product feature CHAIN KJ173345_HBx_P-B of FT:mat_peptide KJ173345_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX008C(e214)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173347_HBx_P-B Product feature CHAIN KJ173347_HBx_P-B of FT:mat_peptide KJ173347_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012C(e220)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173348_HBx_P-B Product feature CHAIN KJ173348_HBx_P-B of FT:mat_peptide KJ173348_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX012M(e221)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173351_HBx_P-B Product feature CHAIN KJ173351_HBx_P-B of FT:mat_peptide KJ173351_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025C(e234)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTTYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173352_HBx_P-B Product feature CHAIN KJ173352_HBx_P-B of FT:mat_peptide KJ173352_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX025M(e235n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173353_HBx_P-B Product feature CHAIN KJ173353_HBx_P-B of FT:mat_peptide KJ173353_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027C(e237)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173354_HBx_P-B Product feature CHAIN KJ173354_HBx_P-B of FT:mat_peptide KJ173354_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX027M(e235n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173355_HBx_P-B Product feature CHAIN KJ173355_HBx_P-B of FT:mat_peptide KJ173355_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032C(e247n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173356_HBx_P-B Product feature CHAIN KJ173356_HBx_P-B of FT:mat_peptide KJ173356_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX032M(e248n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173357_HBx_P-B Product feature CHAIN KJ173357_HBx_P-B of FT:mat_peptide KJ173357_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CX065C(e313)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRAVPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEVLGAEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173359_HBx_P-B Product feature CHAIN KJ173359_HBx_P-B of FT:mat_peptide KJ173359_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161C(m162)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173360_HBx_P-B Product feature CHAIN KJ173360_HBx_P-B of FT:mat_peptide KJ173360_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB161M(m161)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARWNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173361_HBx_P-B Product feature CHAIN KJ173361_HBx_P-B of FT:mat_peptide KJ173361_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041C(m42)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173362_HBx_P-B Product feature CHAIN KJ173362_HBx_P-B of FT:mat_peptide KJ173362_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate NB041M(m41)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173363_HBx_P-B Product feature CHAIN KJ173363_HBx_P-B of FT:mat_peptide KJ173363_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-C(006)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173364_HBx_P-B Product feature CHAIN KJ173364_HBx_P-B of FT:mat_peptide KJ173364_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P002-M(007)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173365_HBx_P-B Product feature CHAIN KJ173365_HBx_P-B of FT:mat_peptide KJ173365_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-C(009)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173366_HBx_P-B Product feature CHAIN KJ173366_HBx_P-B of FT:mat_peptide KJ173366_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P003-M(011)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173367_HBx_P-B Product feature CHAIN KJ173367_HBx_P-B of FT:mat_peptide KJ173367_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-C(B1)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173368_HBx_P-B Product feature CHAIN KJ173368_HBx_P-B of FT:mat_peptide KJ173368_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P006-M(B3)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173369_HBx_P-B Product feature CHAIN KJ173369_HBx_P-B of FT:mat_peptide KJ173369_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-C(B37)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173370_HBx_P-B Product feature CHAIN KJ173370_HBx_P-B of FT:mat_peptide KJ173370_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P008-M(B39)). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHGNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173371_HBx_P-B Product feature CHAIN KJ173371_HBx_P-B of FT:mat_peptide KJ173371_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P009-C(B135)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173372_HBx_P-B Product feature CHAIN KJ173372_HBx_P-B of FT:mat_peptide KJ173372_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P009-M2(B137)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173373_HBx_P-B Product feature CHAIN KJ173373_HBx_P-B of FT:mat_peptide KJ173373_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-C1(147a)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYRNLPNVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173374_HBx_P-B Product feature CHAIN KJ173374_HBx_P-B of FT:mat_peptide KJ173374_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P010-M(B149)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173375_HBx_P-B Product feature CHAIN KJ173375_HBx_P-B of FT:mat_peptide KJ173375_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004C(e107)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173376_HBx_P-B Product feature CHAIN KJ173376_HBx_P-B of FT:mat_peptide KJ173376_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY004M(e108)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173377_HBx_P-B Product feature CHAIN KJ173377_HBx_P-B of FT:mat_peptide KJ173377_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY014C(e115)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ173378_HBx_P-B Product feature CHAIN KJ173378_HBx_P-B of FT:mat_peptide KJ173378_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY014M(e116)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEQYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ173379_HBx_P-B Product feature CHAIN KJ173379_HBx_P-B of FT:mat_peptide KJ173379_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY019C(e121)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173380_HBx_P-B Product feature CHAIN KJ173380_HBx_P-B of FT:mat_peptide KJ173380_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YY019M(e122)). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHNRTLGLLAMSTTDLEAYFKDCVFTECEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173381_HBx_P-B Product feature CHAIN KJ173381_HBx_P-B of FT:mat_peptide KJ173381_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16-C(FY137Cn).fas). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173382_HBx_P-B Product feature CHAIN KJ173382_HBx_P-B of FT:mat_peptide KJ173382_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N16_M(FY137An).fas). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173383_HBx_P-B Product feature CHAIN KJ173383_HBx_P-B of FT:mat_peptide KJ173383_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YZ009C(e30)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173384_HBx_P-B Product feature CHAIN KJ173384_HBx_P-B of FT:mat_peptide KJ173384_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YZ009M(e31)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173385_HBx_P-B Product feature CHAIN KJ173385_HBx_P-B of FT:mat_peptide KJ173385_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac02-M(m603)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173386_HBx_P-B Product feature CHAIN KJ173386_HBx_P-B of FT:mat_peptide KJ173386_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac02-C(m604)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHGAHLSLRGLPVCAFSSAGPSALRLTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173387_HBx_P-B Product feature CHAIN KJ173387_HBx_P-B of FT:mat_peptide KJ173387_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-M(m607)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173388_HBx_P-B Product feature CHAIN KJ173388_HBx_P-B of FT:mat_peptide KJ173388_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac03-C(m608)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173389_HBx_P-B Product feature CHAIN KJ173389_HBx_P-B of FT:mat_peptide KJ173389_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-M(m617)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173390_HBx_P-B Product feature CHAIN KJ173390_HBx_P-B of FT:mat_peptide KJ173390_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vac05-C(m618)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173397_HBx_P-B Product feature CHAIN KJ173397_HBx_P-B of FT:mat_peptide KJ173397_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-M(134A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173398_HBx_P-B Product feature CHAIN KJ173398_HBx_P-B of FT:mat_peptide KJ173398_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N03-C(134B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173399_HBx_P-B Product feature CHAIN KJ173399_HBx_P-B of FT:mat_peptide KJ173399_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-M(4161A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173400_HBx_P-B Product feature CHAIN KJ173400_HBx_P-B of FT:mat_peptide KJ173400_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N07-C(4230B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173401_HBx_P-B Product feature CHAIN KJ173401_HBx_P-B of FT:mat_peptide KJ173401_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-M(6720A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPAVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173402_HBx_P-B Product feature CHAIN KJ173402_HBx_P-B of FT:mat_peptide KJ173402_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N09-C(3733B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPAVLHKRTLGLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173403_HBx_P-B Product feature CHAIN KJ173403_HBx_P-B of FT:mat_peptide KJ173403_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-M(6641M)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KJ173404_HBx_P-B Product feature CHAIN KJ173404_HBx_P-B of FT:mat_peptide KJ173404_HBx_P-B of [Viruses] Hepatitis B Virus genotype B (isolate N10-C(3953B)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRNLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCPPAPCNFFTSA
>gnl|hbvpro|KJ173405_HBx_P-B Product feature CHAIN KJ173405_HBx_P-B of FT:mat_peptide KJ173405_HBx_P-B of [Viruses] H