HBVdb

Dataset for protein SHBs of genotype all

[Download (right click)] [Alignment] [Repertoires]

26073 sequence(s)

>gnl|hbvpro|AB014370_SHBs_P-A Product feature CHAIN AB014370_SHBs_P-A of FT:mat_peptide AB014370_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB030513_SHBs_P-A Product feature CHAIN AB030513_SHBs_P-A of FT:mat_peptide AB030513_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBNP7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB064314_SHBs_P-A Product feature CHAIN AB064314_SHBs_P-A of FT:mat_peptide AB064314_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076678_SHBs_P-A Product feature CHAIN AB076678_SHBs_P-A of FT:mat_peptide AB076678_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076679_SHBs_P-A Product feature CHAIN AB076679_SHBs_P-A of FT:mat_peptide AB076679_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVPPVCRGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076680_SHBs_P-A Product feature CHAIN AB076680_SHBs_P-A of FT:mat_peptide AB076680_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076681_SHBs_P-A Product feature CHAIN AB076681_SHBs_P-A of FT:mat_peptide AB076681_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076682_SHBs_P-A Product feature CHAIN AB076682_SHBs_P-A of FT:mat_peptide AB076682_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076683_SHBs_P-A Product feature CHAIN AB076683_SHBs_P-A of FT:mat_peptide AB076683_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076685_SHBs_P-A Product feature CHAIN AB076685_SHBs_P-A of FT:mat_peptide AB076685_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPXLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIAGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLXPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076686_SHBs_P-A Product feature CHAIN AB076686_SHBs_P-A of FT:mat_peptide AB076686_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076687_SHBs_P-A Product feature CHAIN AB076687_SHBs_P-A of FT:mat_peptide AB076687_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQNLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLQRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076688_SHBs_P-A Product feature CHAIN AB076688_SHBs_P-A of FT:mat_peptide AB076688_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076689_SHBs_P-A Product feature CHAIN AB076689_SHBs_P-A of FT:mat_peptide AB076689_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB076690_SHBs_P-A Product feature CHAIN AB076690_SHBs_P-A of FT:mat_peptide AB076690_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116076_SHBs_P-A Product feature CHAIN AB116076_SHBs_P-A of FT:mat_peptide AB116076_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116077_SHBs_P-A Product feature CHAIN AB116077_SHBs_P-A of FT:mat_peptide AB116077_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA2126). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCMTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQCFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116078_SHBs_P-A Product feature CHAIN AB116078_SHBs_P-A of FT:mat_peptide AB116078_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116079_SHBs_P-A Product feature CHAIN AB116079_SHBs_P-A of FT:mat_peptide AB116079_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116080_SHBs_P-A Product feature CHAIN AB116080_SHBs_P-A of FT:mat_peptide AB116080_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116081_SHBs_P-A Product feature CHAIN AB116081_SHBs_P-A of FT:mat_peptide AB116081_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116082_SHBs_P-A Product feature CHAIN AB116082_SHBs_P-A of FT:mat_peptide AB116082_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGRSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116083_SHBs_P-A Product feature CHAIN AB116083_SHBs_P-A of FT:mat_peptide AB116083_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116084_SHBs_P-A Product feature CHAIN AB116084_SHBs_P-A of FT:mat_peptide AB116084_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116085_SHBs_P-A Product feature CHAIN AB116085_SHBs_P-A of FT:mat_peptide AB116085_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN83). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTFCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQLFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116086_SHBs_P-A Product feature CHAIN AB116086_SHBs_P-A of FT:mat_peptide AB116086_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116087_SHBs_P-A Product feature CHAIN AB116087_SHBs_P-A of FT:mat_peptide AB116087_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116088_SHBs_P-A Product feature CHAIN AB116088_SHBs_P-A of FT:mat_peptide AB116088_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPGCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWFWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB116089_SHBs_P-A Product feature CHAIN AB116089_SHBs_P-A of FT:mat_peptide AB116089_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116090_SHBs_P-A Product feature CHAIN AB116090_SHBs_P-A of FT:mat_peptide AB116090_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116091_SHBs_P-A Product feature CHAIN AB116091_SHBs_P-A of FT:mat_peptide AB116091_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116092_SHBs_P-A Product feature CHAIN AB116092_SHBs_P-A of FT:mat_peptide AB116092_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWGFAK
FLWEWASVRFSCLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|AB116093_SHBs_P-A Product feature CHAIN AB116093_SHBs_P-A of FT:mat_peptide AB116093_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB116094_SHBs_P-A Product feature CHAIN AB116094_SHBs_P-A of FT:mat_peptide AB116094_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCRTCTTPAQGNSTFPSCCCTKPTGGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB126580_SHBs_P-A Product feature CHAIN AB126580_SHBs_P-A of FT:mat_peptide AB126580_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVNPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194950_SHBs_P-A Product feature CHAIN AB194950_SHBs_P-A of FT:mat_peptide AB194950_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194951_SHBs_P-A Product feature CHAIN AB194951_SHBs_P-A of FT:mat_peptide AB194951_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFWLWAYI
>gnl|hbvpro|AB194952_SHBs_P-A Product feature CHAIN AB194952_SHBs_P-A of FT:mat_peptide AB194952_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB194953_SHBs_P-A Product feature CHAIN AB194953_SHBs_P-A of FT:mat_peptide AB194953_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR991). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLKPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDRNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|AB205118_SHBs_P-A Product feature CHAIN AB205118_SHBs_P-A of FT:mat_peptide AB205118_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGPTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB222707_SHBs_P-A Product feature CHAIN AB222707_SHBs_P-A of FT:mat_peptide AB222707_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWAYI
>gnl|hbvpro|AB222742_SHBs_P-A Product feature CHAIN AB222742_SHBs_P-A of FT:mat_peptide AB222742_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IF722). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB241114_SHBs_P-A Product feature CHAIN AB241114_SHBs_P-A of FT:mat_peptide AB241114_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB241115_SHBs_P-A Product feature CHAIN AB241115_SHBs_P-A of FT:mat_peptide AB241115_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246317_SHBs_P-A Product feature CHAIN AB246317_SHBs_P-A of FT:mat_peptide AB246317_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILTPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246335_SHBs_P-A Product feature CHAIN AB246335_SHBs_P-A of FT:mat_peptide AB246335_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246336_SHBs_P-A Product feature CHAIN AB246336_SHBs_P-A of FT:mat_peptide AB246336_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB246337_SHBs_P-A Product feature CHAIN AB246337_SHBs_P-A of FT:mat_peptide AB246337_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246338_SHBs_P-A Product feature CHAIN AB246338_SHBs_P-A of FT:mat_peptide AB246338_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB263406_SHBs_P-A Product feature CHAIN AB263406_SHBs_P-A of FT:mat_peptide AB263406_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MonB04-023E). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB289692_SHBs_P-A Product feature CHAIN AB289692_SHBs_P-A of FT:mat_peptide AB289692_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB289693_SHBs_P-A Product feature CHAIN AB289693_SHBs_P-A of FT:mat_peptide AB289693_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLRLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVNPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB289694_SHBs_P-A Product feature CHAIN AB289694_SHBs_P-A of FT:mat_peptide AB289694_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVXLSPTVWLSAIWMMWYWGXSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB289704_SHBs_P-A Product feature CHAIN AB289704_SHBs_P-A of FT:mat_peptide AB289704_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB289706_SHBs_P-A Product feature CHAIN AB289706_SHBs_P-A of FT:mat_peptide AB289706_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYGGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB289711_SHBs_P-A Product feature CHAIN AB289711_SHBs_P-A of FT:mat_peptide AB289711_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB289727_SHBs_P-A Product feature CHAIN AB289727_SHBs_P-A of FT:mat_peptide AB289727_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYGGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB289737_SHBs_P-A Product feature CHAIN AB289737_SHBs_P-A of FT:mat_peptide AB289737_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 46). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYGGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB300366_SHBs_P-A Product feature CHAIN AB300366_SHBs_P-A of FT:mat_peptide AB300366_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB300367_SHBs_P-A Product feature CHAIN AB300367_SHBs_P-A of FT:mat_peptide AB300367_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB362931_SHBs_P-A Product feature CHAIN AB362931_SHBs_P-A of FT:mat_peptide AB362931_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453979_SHBs_P-A Product feature CHAIN AB453979_SHBs_P-A of FT:mat_peptide AB453979_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453980_SHBs_P-A Product feature CHAIN AB453980_SHBs_P-A of FT:mat_peptide AB453980_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453981_SHBs_P-A Product feature CHAIN AB453981_SHBs_P-A of FT:mat_peptide AB453981_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453982_SHBs_P-A Product feature CHAIN AB453982_SHBs_P-A of FT:mat_peptide AB453982_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453983_SHBs_P-A Product feature CHAIN AB453983_SHBs_P-A of FT:mat_peptide AB453983_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGRSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453984_SHBs_P-A Product feature CHAIN AB453984_SHBs_P-A of FT:mat_peptide AB453984_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453986_SHBs_P-A Product feature CHAIN AB453986_SHBs_P-A of FT:mat_peptide AB453986_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453987_SHBs_P-A Product feature CHAIN AB453987_SHBs_P-A of FT:mat_peptide AB453987_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB453988_SHBs_P-A Product feature CHAIN AB453988_SHBs_P-A of FT:mat_peptide AB453988_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGQSLYNILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|AB453989_SHBs_P-A Product feature CHAIN AB453989_SHBs_P-A of FT:mat_peptide AB453989_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGATVCLGQNSQSPTSNHSPTSCPPTCAGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480036_SHBs_P-A Product feature CHAIN AB480036_SHBs_P-A of FT:mat_peptide AB480036_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480038_SHBs_P-A Product feature CHAIN AB480038_SHBs_P-A of FT:mat_peptide AB480038_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480039_SHBs_P-A Product feature CHAIN AB480039_SHBs_P-A of FT:mat_peptide AB480039_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480040_SHBs_P-A Product feature CHAIN AB480040_SHBs_P-A of FT:mat_peptide AB480040_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB480041_SHBs_P-A Product feature CHAIN AB480041_SHBs_P-A of FT:mat_peptide AB480041_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB549213_SHBs_P-A Product feature CHAIN AB549213_SHBs_P-A of FT:mat_peptide AB549213_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWAYI
>gnl|hbvpro|AB697487_SHBs_P-A Product feature CHAIN AB697487_SHBs_P-A of FT:mat_peptide AB697487_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697488_SHBs_P-A Product feature CHAIN AB697488_SHBs_P-A of FT:mat_peptide AB697488_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697489_SHBs_P-A Product feature CHAIN AB697489_SHBs_P-A of FT:mat_peptide AB697489_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697491_SHBs_P-A Product feature CHAIN AB697491_SHBs_P-A of FT:mat_peptide AB697491_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697492_SHBs_P-A Product feature CHAIN AB697492_SHBs_P-A of FT:mat_peptide AB697492_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697493_SHBs_P-A Product feature CHAIN AB697493_SHBs_P-A of FT:mat_peptide AB697493_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697495_SHBs_P-A Product feature CHAIN AB697495_SHBs_P-A of FT:mat_peptide AB697495_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697496_SHBs_P-A Product feature CHAIN AB697496_SHBs_P-A of FT:mat_peptide AB697496_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697497_SHBs_P-A Product feature CHAIN AB697497_SHBs_P-A of FT:mat_peptide AB697497_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697498_SHBs_P-A Product feature CHAIN AB697498_SHBs_P-A of FT:mat_peptide AB697498_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697499_SHBs_P-A Product feature CHAIN AB697499_SHBs_P-A of FT:mat_peptide AB697499_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697501_SHBs_P-A Product feature CHAIN AB697501_SHBs_P-A of FT:mat_peptide AB697501_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697503_SHBs_P-A Product feature CHAIN AB697503_SHBs_P-A of FT:mat_peptide AB697503_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697504_SHBs_P-A Product feature CHAIN AB697504_SHBs_P-A of FT:mat_peptide AB697504_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697505_SHBs_P-A Product feature CHAIN AB697505_SHBs_P-A of FT:mat_peptide AB697505_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697506_SHBs_P-A Product feature CHAIN AB697506_SHBs_P-A of FT:mat_peptide AB697506_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697507_SHBs_P-A Product feature CHAIN AB697507_SHBs_P-A of FT:mat_peptide AB697507_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697508_SHBs_P-A Product feature CHAIN AB697508_SHBs_P-A of FT:mat_peptide AB697508_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697509_SHBs_P-A Product feature CHAIN AB697509_SHBs_P-A of FT:mat_peptide AB697509_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697511_SHBs_P-A Product feature CHAIN AB697511_SHBs_P-A of FT:mat_peptide AB697511_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGXRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB697512_SHBs_P-A Product feature CHAIN AB697512_SHBs_P-A of FT:mat_peptide AB697512_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB775198_SHBs_P-A Product feature CHAIN AB775198_SHBs_P-A of FT:mat_peptide AB775198_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB775199_SHBs_P-A Product feature CHAIN AB775199_SHBs_P-A of FT:mat_peptide AB775199_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB775200_SHBs_P-A Product feature CHAIN AB775200_SHBs_P-A of FT:mat_peptide AB775200_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB775201_SHBs_P-A Product feature CHAIN AB775201_SHBs_P-A of FT:mat_peptide AB775201_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786643_SHBs_P-A Product feature CHAIN AB786643_SHBs_P-A of FT:mat_peptide AB786643_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20401). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786645_SHBs_P-A Product feature CHAIN AB786645_SHBs_P-A of FT:mat_peptide AB786645_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20403). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786646_SHBs_P-A Product feature CHAIN AB786646_SHBs_P-A of FT:mat_peptide AB786646_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20404). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786647_SHBs_P-A Product feature CHAIN AB786647_SHBs_P-A of FT:mat_peptide AB786647_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20405). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786648_SHBs_P-A Product feature CHAIN AB786648_SHBs_P-A of FT:mat_peptide AB786648_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20406). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786649_SHBs_P-A Product feature CHAIN AB786649_SHBs_P-A of FT:mat_peptide AB786649_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20407). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786651_SHBs_P-A Product feature CHAIN AB786651_SHBs_P-A of FT:mat_peptide AB786651_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20409). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYF
>gnl|hbvpro|AB786652_SHBs_P-A Product feature CHAIN AB786652_SHBs_P-A of FT:mat_peptide AB786652_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20410). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786654_SHBs_P-A Product feature CHAIN AB786654_SHBs_P-A of FT:mat_peptide AB786654_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20412). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786655_SHBs_P-A Product feature CHAIN AB786655_SHBs_P-A of FT:mat_peptide AB786655_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20413). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786656_SHBs_P-A Product feature CHAIN AB786656_SHBs_P-A of FT:mat_peptide AB786656_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20417). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786657_SHBs_P-A Product feature CHAIN AB786657_SHBs_P-A of FT:mat_peptide AB786657_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20419). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786658_SHBs_P-A Product feature CHAIN AB786658_SHBs_P-A of FT:mat_peptide AB786658_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20420). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786659_SHBs_P-A Product feature CHAIN AB786659_SHBs_P-A of FT:mat_peptide AB786659_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20421). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786660_SHBs_P-A Product feature CHAIN AB786660_SHBs_P-A of FT:mat_peptide AB786660_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20422). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYIK
>gnl|hbvpro|AB786661_SHBs_P-A Product feature CHAIN AB786661_SHBs_P-A of FT:mat_peptide AB786661_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20425). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPAVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786662_SHBs_P-A Product feature CHAIN AB786662_SHBs_P-A of FT:mat_peptide AB786662_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20427). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB786663_SHBs_P-A Product feature CHAIN AB786663_SHBs_P-A of FT:mat_peptide AB786663_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KE20429). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809471_SHBs_P-A Product feature CHAIN AB809471_SHBs_P-A of FT:mat_peptide AB809471_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809476_SHBs_P-A Product feature CHAIN AB809476_SHBs_P-A of FT:mat_peptide AB809476_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H128). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809477_SHBs_P-A Product feature CHAIN AB809477_SHBs_P-A of FT:mat_peptide AB809477_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate R41). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLFNTLRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809478_SHBs_P-A Product feature CHAIN AB809478_SHBs_P-A of FT:mat_peptide AB809478_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H129). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809479_SHBs_P-A Product feature CHAIN AB809479_SHBs_P-A of FT:mat_peptide AB809479_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H185). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809480_SHBs_P-A Product feature CHAIN AB809480_SHBs_P-A of FT:mat_peptide AB809480_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate K1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809481_SHBs_P-A Product feature CHAIN AB809481_SHBs_P-A of FT:mat_peptide AB809481_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate K2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPMCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809482_SHBs_P-A Product feature CHAIN AB809482_SHBs_P-A of FT:mat_peptide AB809482_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KW4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809483_SHBs_P-A Product feature CHAIN AB809483_SHBs_P-A of FT:mat_peptide AB809483_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KW6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809484_SHBs_P-A Product feature CHAIN AB809484_SHBs_P-A of FT:mat_peptide AB809484_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KW8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809485_SHBs_P-A Product feature CHAIN AB809485_SHBs_P-A of FT:mat_peptide AB809485_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KW12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFPEGTPACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809486_SHBs_P-A Product feature CHAIN AB809486_SHBs_P-A of FT:mat_peptide AB809486_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KW14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809489_SHBs_P-A Product feature CHAIN AB809489_SHBs_P-A of FT:mat_peptide AB809489_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809490_SHBs_P-A Product feature CHAIN AB809490_SHBs_P-A of FT:mat_peptide AB809490_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809491_SHBs_P-A Product feature CHAIN AB809491_SHBs_P-A of FT:mat_peptide AB809491_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809492_SHBs_P-A Product feature CHAIN AB809492_SHBs_P-A of FT:mat_peptide AB809492_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESAVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809493_SHBs_P-A Product feature CHAIN AB809493_SHBs_P-A of FT:mat_peptide AB809493_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate R25). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809532_SHBs_P-A Product feature CHAIN AB809532_SHBs_P-A of FT:mat_peptide AB809532_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Okayama1-S-2007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809533_SHBs_P-A Product feature CHAIN AB809533_SHBs_P-A of FT:mat_peptide AB809533_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Okayama2-S-2007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809534_SHBs_P-A Product feature CHAIN AB809534_SHBs_P-A of FT:mat_peptide AB809534_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Okayama3-S-2007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLLAIWMMWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809537_SHBs_P-A Product feature CHAIN AB809537_SHBs_P-A of FT:mat_peptide AB809537_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Osaka1-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809538_SHBs_P-A Product feature CHAIN AB809538_SHBs_P-A of FT:mat_peptide AB809538_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Osaka2-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809541_SHBs_P-A Product feature CHAIN AB809541_SHBs_P-A of FT:mat_peptide AB809541_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tottori-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809542_SHBs_P-A Product feature CHAIN AB809542_SHBs_P-A of FT:mat_peptide AB809542_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Fukuoka-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809543_SHBs_P-A Product feature CHAIN AB809543_SHBs_P-A of FT:mat_peptide AB809543_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Osaka5-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937791_SHBs_P-A Product feature CHAIN AB937791_SHBs_P-A of FT:mat_peptide AB937791_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937792_SHBs_P-A Product feature CHAIN AB937792_SHBs_P-A of FT:mat_peptide AB937792_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937793_SHBs_P-A Product feature CHAIN AB937793_SHBs_P-A of FT:mat_peptide AB937793_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937794_SHBs_P-A Product feature CHAIN AB937794_SHBs_P-A of FT:mat_peptide AB937794_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937795_SHBs_P-A Product feature CHAIN AB937795_SHBs_P-A of FT:mat_peptide AB937795_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937796_SHBs_P-A Product feature CHAIN AB937796_SHBs_P-A of FT:mat_peptide AB937796_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB937797_SHBs_P-A Product feature CHAIN AB937797_SHBs_P-A of FT:mat_peptide AB937797_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1204). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPRLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPXICXGYRWMCLRRF
IIFLFILPLCLIFLLVLLDYQGILPVCPLIPGSTXNXTGXCKXCTXPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMILYWGPNLYSIVSPFILLLPIFFCLWVYI
>gnl|hbvpro|AB937798_SHBs_P-A Product feature CHAIN AB937798_SHBs_P-A of FT:mat_peptide AB937798_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF043560_SHBs_P-A Product feature CHAIN AF043560_SHBs_P-A of FT:mat_peptide AF043560_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF043580_SHBs_P-A Product feature CHAIN AF043580_SHBs_P-A of FT:mat_peptide AF043580_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF061525_SHBs_P-A Product feature CHAIN AF061525_SHBs_P-A of FT:mat_peptide AF061525_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate tl647). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AF061526_SHBs_P-A Product feature CHAIN AF061526_SHBs_P-A of FT:mat_peptide AF061526_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate wp2380). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLVTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF065111_SHBs_P-A Product feature CHAIN AF065111_SHBs_P-A of FT:mat_peptide AF065111_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sn387). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLILGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF065113_SHBs_P-A Product feature CHAIN AF065113_SHBs_P-A of FT:mat_peptide AF065113_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sn1288). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF065114_SHBs_P-A Product feature CHAIN AF065114_SHBs_P-A of FT:mat_peptide AF065114_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sn2882). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF065115_SHBs_P-A Product feature CHAIN AF065115_SHBs_P-A of FT:mat_peptide AF065115_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sn4222). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF065116_SHBs_P-A Product feature CHAIN AF065116_SHBs_P-A of FT:mat_peptide AF065116_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sn4651). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLXRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAXGNSMSPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF083634_SHBs_P-A Product feature CHAIN AF083634_SHBs_P-A of FT:mat_peptide AF083634_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 1-1991). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSKFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF083635_SHBs_P-A Product feature CHAIN AF083635_SHBs_P-A of FT:mat_peptide AF083635_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 1-1996). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGYLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTAGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF083636_SHBs_P-A Product feature CHAIN AF083636_SHBs_P-A of FT:mat_peptide AF083636_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 2-1987). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPISFCLWVYI
>gnl|hbvpro|AF083637_SHBs_P-A Product feature CHAIN AF083637_SHBs_P-A of FT:mat_peptide AF083637_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 2-1992). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGILPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPISFCLWVYI
>gnl|hbvpro|AF083638_SHBs_P-A Product feature CHAIN AF083638_SHBs_P-A of FT:mat_peptide AF083638_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 3-1987). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTTNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF083639_SHBs_P-A Product feature CHAIN AF083639_SHBs_P-A of FT:mat_peptide AF083639_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient 3-1995). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLMPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFLPLLPIFLCLWVYI
>gnl|hbvpro|AF090838_SHBs_P-A Product feature CHAIN AF090838_SHBs_P-A of FT:mat_peptide AF090838_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090839_SHBs_P-A Product feature CHAIN AF090839_SHBs_P-A of FT:mat_peptide AF090839_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090840_SHBs_P-A Product feature CHAIN AF090840_SHBs_P-A of FT:mat_peptide AF090840_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090841_SHBs_P-A Product feature CHAIN AF090841_SHBs_P-A of FT:mat_peptide AF090841_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF090842_SHBs_P-A Product feature CHAIN AF090842_SHBs_P-A of FT:mat_peptide AF090842_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFIPVLPIFFCLWVYI
>gnl|hbvpro|AF129506_SHBs_P-A Product feature CHAIN AF129506_SHBs_P-A of FT:mat_peptide AF129506_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWVWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF132442_SHBs_P-A Product feature CHAIN AF132442_SHBs_P-A of FT:mat_peptide AF132442_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF132443_SHBs_P-A Product feature CHAIN AF132443_SHBs_P-A of FT:mat_peptide AF132443_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF134134_SHBs_P-A Product feature CHAIN AF134134_SHBs_P-A of FT:mat_peptide AF134134_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF134138_SHBs_P-A Product feature CHAIN AF134138_SHBs_P-A of FT:mat_peptide AF134138_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF134143_SHBs_P-A Product feature CHAIN AF134143_SHBs_P-A of FT:mat_peptide AF134143_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTAGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF134144_SHBs_P-A Product feature CHAIN AF134144_SHBs_P-A of FT:mat_peptide AF134144_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF134145_SHBs_P-A Product feature CHAIN AF134145_SHBs_P-A of FT:mat_peptide AF134145_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPARNNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF134147_SHBs_P-A Product feature CHAIN AF134147_SHBs_P-A of FT:mat_peptide AF134147_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF134148_SHBs_P-A Product feature CHAIN AF134148_SHBs_P-A of FT:mat_peptide AF134148_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF143298_SHBs_P-A Product feature CHAIN AF143298_SHBs_P-A of FT:mat_peptide AF143298_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF208866_SHBs_P-A Product feature CHAIN AF208866_SHBs_P-A of FT:mat_peptide AF208866_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CP595). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLSFLGGSHVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPILPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AF208873_SHBs_P-A Product feature CHAIN AF208873_SHBs_P-A of FT:mat_peptide AF208873_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate pal3660). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLYILLLCLIFLLVLLDYQGMFAVCPLIPGTTTTSTGPWITCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF208875_SHBs_P-A Product feature CHAIN AF208875_SHBs_P-A of FT:mat_peptide AF208875_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate pal4783). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIISGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPKSTTTSTGSCRTCTLPAQGNSMFPSCCCTKPTDGNCTCIPIPVSWAFAK
YLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF209392_SHBs_P-A Product feature CHAIN AF209392_SHBs_P-A of FT:mat_peptide AF209392_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate as9419). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLPVLQAGFFLLTRIHTIPQSLDSWWTSLNFLGGSPVCLGQNSRSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLILGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLTLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSSFIPLLPIFFCLWVYI
>gnl|hbvpro|AF209395_SHBs_P-A Product feature CHAIN AF209395_SHBs_P-A of FT:mat_peptide AF209395_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate fh013). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF209397_SHBs_P-A Product feature CHAIN AF209397_SHBs_P-A of FT:mat_peptide AF209397_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate jv1802). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQSSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF209399_SHBs_P-A Product feature CHAIN AF209399_SHBs_P-A of FT:mat_peptide AF209399_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate mh5274). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF209400_SHBs_P-A Product feature CHAIN AF209400_SHBs_P-A of FT:mat_peptide AF209400_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate on019). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF209404_SHBs_P-A Product feature CHAIN AF209404_SHBs_P-A of FT:mat_peptide AF209404_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate tm7463). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVNPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF209405_SHBs_P-A Product feature CHAIN AF209405_SHBs_P-A of FT:mat_peptide AF209405_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ui004). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297621_SHBs_P-A Product feature CHAIN AF297621_SHBs_P-A of FT:mat_peptide AF297621_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297622_SHBs_P-A Product feature CHAIN AF297622_SHBs_P-A of FT:mat_peptide AF297622_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=226 residues).
IENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWLVGISPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297623_SHBs_P-A Product feature CHAIN AF297623_SHBs_P-A of FT:mat_peptide AF297623_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297624_SHBs_P-A Product feature CHAIN AF297624_SHBs_P-A of FT:mat_peptide AF297624_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF297625_SHBs_P-A Product feature CHAIN AF297625_SHBs_P-A of FT:mat_peptide AF297625_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQYPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF363663_SHBs_P-A Product feature CHAIN AF363663_SHBs_P-A of FT:mat_peptide AF363663_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX4c). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF369532_SHBs_P-A Product feature CHAIN AF369532_SHBs_P-A of FT:mat_peptide AF369532_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX9c). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFCCLWVYI
>gnl|hbvpro|AF369544_SHBs_P-A Product feature CHAIN AF369544_SHBs_P-A of FT:mat_peptide AF369544_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX515). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF536524_SHBs_P-A Product feature CHAIN AF536524_SHBs_P-A of FT:mat_peptide AF536524_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVFI
>gnl|hbvpro|AF537371_SHBs_P-A Product feature CHAIN AF537371_SHBs_P-A of FT:mat_peptide AF537371_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTEPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSTVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF537372_SHBs_P-A Product feature CHAIN AF537372_SHBs_P-A of FT:mat_peptide AF537372_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLRRILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLMPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYSILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ012207_SHBs_P-A Product feature CHAIN AJ012207_SHBs_P-A of FT:mat_peptide AJ012207_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ309369_SHBs_P-A Product feature CHAIN AJ309369_SHBs_P-A of FT:mat_peptide AJ309369_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTGTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ309370_SHBs_P-A Product feature CHAIN AJ309370_SHBs_P-A of FT:mat_peptide AJ309370_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
TIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ309371_SHBs_P-A Product feature CHAIN AJ309371_SHBs_P-A of FT:mat_peptide AJ309371_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ344115_SHBs_P-A Product feature CHAIN AJ344115_SHBs_P-A of FT:mat_peptide AJ344115_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQTTRSTTTSTGSCKTCTIPARGKSMFPSCCCTKPTDGNCTCIPIPSSWAFAS
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AJ627227_SHBs_P-A Product feature CHAIN AJ627227_SHBs_P-A of FT:mat_peptide AJ627227_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21077). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWXWGPDLYSIVRPFXPLLPIFFCLWVYI
>gnl|hbvpro|AJ627228_SHBs_P-A Product feature CHAIN AJ627228_SHBs_P-A of FT:mat_peptide AJ627228_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM180624_SHBs_P-A Product feature CHAIN AM180624_SHBs_P-A of FT:mat_peptide AM180624_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLXVCPLIPGSXTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|AM184125_SHBs_P-A Product feature CHAIN AM184125_SHBs_P-A of FT:mat_peptide AM184125_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM184126_SHBs_P-A Product feature CHAIN AM184126_SHBs_P-A of FT:mat_peptide AM184126_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM282986_SHBs_P-A Product feature CHAIN AM282986_SHBs_P-A of FT:mat_peptide AM282986_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295795_SHBs_P-A Product feature CHAIN AM295795_SHBs_P-A of FT:mat_peptide AM295795_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295796_SHBs_P-A Product feature CHAIN AM295796_SHBs_P-A of FT:mat_peptide AM295796_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295797_SHBs_P-A Product feature CHAIN AM295797_SHBs_P-A of FT:mat_peptide AM295797_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295798_SHBs_P-A Product feature CHAIN AM295798_SHBs_P-A of FT:mat_peptide AM295798_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM295799_SHBs_P-A Product feature CHAIN AM295799_SHBs_P-A of FT:mat_peptide AM295799_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM410963_SHBs_P-A Product feature CHAIN AM410963_SHBs_P-A of FT:mat_peptide AM410963_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AM494718_SHBs_P-A Product feature CHAIN AM494718_SHBs_P-A of FT:mat_peptide AM494718_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY034878_SHBs_P-A Product feature CHAIN AY034878_SHBs_P-A of FT:mat_peptide AY034878_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY128092_SHBs_P-A Product feature CHAIN AY128092_SHBs_P-A of FT:mat_peptide AY128092_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY152726_SHBs_P-A Product feature CHAIN AY152726_SHBs_P-A of FT:mat_peptide AY152726_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLMPGSTTTSTGPCKTCTTPAQGNSTLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY161138_SHBs_P-A Product feature CHAIN AY161138_SHBs_P-A of FT:mat_peptide AY161138_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLVLCLIFLLVLLDYQGMLLVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFA
KYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY161139_SHBs_P-A Product feature CHAIN AY161139_SHBs_P-A of FT:mat_peptide AY161139_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY161142_SHBs_P-A Product feature CHAIN AY161142_SHBs_P-A of FT:mat_peptide AY161142_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY161143_SHBs_P-A Product feature CHAIN AY161143_SHBs_P-A of FT:mat_peptide AY161143_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY161144_SHBs_P-A Product feature CHAIN AY161144_SHBs_P-A of FT:mat_peptide AY161144_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY168427_SHBs_P-A Product feature CHAIN AY168427_SHBs_P-A of FT:mat_peptide AY168427_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ST21). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY230117_SHBs_P-A Product feature CHAIN AY230117_SHBs_P-A of FT:mat_peptide AY230117_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPNLCNIVRPFIPLLSIFCCLWVYI
>gnl|hbvpro|AY230118_SHBs_P-A Product feature CHAIN AY230118_SHBs_P-A of FT:mat_peptide AY230118_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY232836_SHBs_P-A Product feature CHAIN AY232836_SHBs_P-A of FT:mat_peptide AY232836_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLQIFCCLWVFI
>gnl|hbvpro|AY232837_SHBs_P-A Product feature CHAIN AY232837_SHBs_P-A of FT:mat_peptide AY232837_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAHVCLGQNSQSPTSNHSPTSCPPTCPGYHWMCLRRF
IIFLFILLLCLIFLLVLLEYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPNLFSIARPCIPLLPIFLCPWVYI
>gnl|hbvpro|AY232838_SHBs_P-A Product feature CHAIN AY232838_SHBs_P-A of FT:mat_peptide AY232838_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLQIFCCLWVFI
>gnl|hbvpro|AY232839_SHBs_P-A Product feature CHAIN AY232839_SHBs_P-A of FT:mat_peptide AY232839_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVCPFTPLLQIFCCLWVFI
>gnl|hbvpro|AY232840_SHBs_P-A Product feature CHAIN AY232840_SHBs_P-A of FT:mat_peptide AY232840_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFTPLLQIFCCLWVFI
>gnl|hbvpro|AY233274_SHBs_P-A Product feature CHAIN AY233274_SHBs_P-A of FT:mat_peptide AY233274_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233275_SHBs_P-A Product feature CHAIN AY233275_SHBs_P-A of FT:mat_peptide AY233275_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233276_SHBs_P-A Product feature CHAIN AY233276_SHBs_P-A of FT:mat_peptide AY233276_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233278_SHBs_P-A Product feature CHAIN AY233278_SHBs_P-A of FT:mat_peptide AY233278_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233279_SHBs_P-A Product feature CHAIN AY233279_SHBs_P-A of FT:mat_peptide AY233279_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233280_SHBs_P-A Product feature CHAIN AY233280_SHBs_P-A of FT:mat_peptide AY233280_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMRLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233281_SHBs_P-A Product feature CHAIN AY233281_SHBs_P-A of FT:mat_peptide AY233281_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQNNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233282_SHBs_P-A Product feature CHAIN AY233282_SHBs_P-A of FT:mat_peptide AY233282_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
VIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233283_SHBs_P-A Product feature CHAIN AY233283_SHBs_P-A of FT:mat_peptide AY233283_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233284_SHBs_P-A Product feature CHAIN AY233284_SHBs_P-A of FT:mat_peptide AY233284_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233285_SHBs_P-A Product feature CHAIN AY233285_SHBs_P-A of FT:mat_peptide AY233285_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPRKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233286_SHBs_P-A Product feature CHAIN AY233286_SHBs_P-A of FT:mat_peptide AY233286_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTTPTDGNCTCIPIPSSWTFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPAVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233287_SHBs_P-A Product feature CHAIN AY233287_SHBs_P-A of FT:mat_peptide AY233287_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSRPPICPGYRGMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWVSVRFSWLSLLVPFVQWFVGLSPTAWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233288_SHBs_P-A Product feature CHAIN AY233288_SHBs_P-A of FT:mat_peptide AY233288_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233289_SHBs_P-A Product feature CHAIN AY233289_SHBs_P-A of FT:mat_peptide AY233289_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233290_SHBs_P-A Product feature CHAIN AY233290_SHBs_P-A of FT:mat_peptide AY233290_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFPGGPPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY303900_SHBs_P-A Product feature CHAIN AY303900_SHBs_P-A of FT:mat_peptide AY303900_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Q470). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGXPVCLGQNXQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGPCRTCTTXAQGXSMFPSCCCTKPTDGNCTCIPIPSSWAFXK
YLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY311374_SHBs_P-A Product feature CHAIN AY311374_SHBs_P-A of FT:mat_peptide AY311374_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD10111). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY373428_SHBs_P-A Product feature CHAIN AY373428_SHBs_P-A of FT:mat_peptide AY373428_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFYLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY373429_SHBs_P-A Product feature CHAIN AY373429_SHBs_P-A of FT:mat_peptide AY373429_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSGIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY373432_SHBs_P-A Product feature CHAIN AY373432_SHBs_P-A of FT:mat_peptide AY373432_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|AY576429_SHBs_P-A Product feature CHAIN AY576429_SHBs_P-A of FT:mat_peptide AY576429_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FM). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653775_SHBs_P-A Product feature CHAIN AY653775_SHBs_P-A of FT:mat_peptide AY653775_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 308-02). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPHVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNHMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653776_SHBs_P-A Product feature CHAIN AY653776_SHBs_P-A of FT:mat_peptide AY653776_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4451-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRHFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653777_SHBs_P-A Product feature CHAIN AY653777_SHBs_P-A of FT:mat_peptide AY653777_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5424-89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPSKTCTTPAQGNSMSPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653778_SHBs_P-A Product feature CHAIN AY653778_SHBs_P-A of FT:mat_peptide AY653778_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 307-00). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYSIVNPFIPLSPIFLCLWVYI
>gnl|hbvpro|AY653779_SHBs_P-A Product feature CHAIN AY653779_SHBs_P-A of FT:mat_peptide AY653779_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1902-98). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653780_SHBs_P-A Product feature CHAIN AY653780_SHBs_P-A of FT:mat_peptide AY653780_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4410-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653781_SHBs_P-A Product feature CHAIN AY653781_SHBs_P-A of FT:mat_peptide AY653781_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4599-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLMPGSTTTSTGPCKTCTTPAQGNSTLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY653785_SHBs_P-A Product feature CHAIN AY653785_SHBs_P-A of FT:mat_peptide AY653785_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 885-96). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653786_SHBs_P-A Product feature CHAIN AY653786_SHBs_P-A of FT:mat_peptide AY653786_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3809-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQSNSMFHSCCCTKPTDGNCTCIPIPSSGAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653787_SHBs_P-A Product feature CHAIN AY653787_SHBs_P-A of FT:mat_peptide AY653787_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4505-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653788_SHBs_P-A Product feature CHAIN AY653788_SHBs_P-A of FT:mat_peptide AY653788_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4520-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653789_SHBs_P-A Product feature CHAIN AY653789_SHBs_P-A of FT:mat_peptide AY653789_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4507-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653791_SHBs_P-A Product feature CHAIN AY653791_SHBs_P-A of FT:mat_peptide AY653791_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4422-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653793_SHBs_P-A Product feature CHAIN AY653793_SHBs_P-A of FT:mat_peptide AY653793_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2018-00). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653794_SHBs_P-A Product feature CHAIN AY653794_SHBs_P-A of FT:mat_peptide AY653794_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-02). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653796_SHBs_P-A Product feature CHAIN AY653796_SHBs_P-A of FT:mat_peptide AY653796_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4580-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653798_SHBs_P-A Product feature CHAIN AY653798_SHBs_P-A of FT:mat_peptide AY653798_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4436-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTATSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653799_SHBs_P-A Product feature CHAIN AY653799_SHBs_P-A of FT:mat_peptide AY653799_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4502-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653800_SHBs_P-A Product feature CHAIN AY653800_SHBs_P-A of FT:mat_peptide AY653800_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3803-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653801_SHBs_P-A Product feature CHAIN AY653801_SHBs_P-A of FT:mat_peptide AY653801_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3807-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653803_SHBs_P-A Product feature CHAIN AY653803_SHBs_P-A of FT:mat_peptide AY653803_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2017-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY707087_SHBs_P-A Product feature CHAIN AY707087_SHBs_P-A of FT:mat_peptide AY707087_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738139_SHBs_P-A Product feature CHAIN AY738139_SHBs_P-A of FT:mat_peptide AY738139_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITLGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLAVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738140_SHBs_P-A Product feature CHAIN AY738140_SHBs_P-A of FT:mat_peptide AY738140_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQSMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738141_SHBs_P-A Product feature CHAIN AY738141_SHBs_P-A of FT:mat_peptide AY738141_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQNMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738142_SHBs_P-A Product feature CHAIN AY738142_SHBs_P-A of FT:mat_peptide AY738142_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQSMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWELASVRFSWLSLLVPFVQWFVGPSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738143_SHBs_P-A Product feature CHAIN AY738143_SHBs_P-A of FT:mat_peptide AY738143_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITLGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLAVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY738804_SHBs_P-A Product feature CHAIN AY738804_SHBs_P-A of FT:mat_peptide AY738804_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQSFVGLSPIVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738806_SHBs_P-A Product feature CHAIN AY738806_SHBs_P-A of FT:mat_peptide AY738806_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738807_SHBs_P-A Product feature CHAIN AY738807_SHBs_P-A of FT:mat_peptide AY738807_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSSGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738808_SHBs_P-A Product feature CHAIN AY738808_SHBs_P-A of FT:mat_peptide AY738808_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTEPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738809_SHBs_P-A Product feature CHAIN AY738809_SHBs_P-A of FT:mat_peptide AY738809_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738810_SHBs_P-A Product feature CHAIN AY738810_SHBs_P-A of FT:mat_peptide AY738810_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738811_SHBs_P-A Product feature CHAIN AY738811_SHBs_P-A of FT:mat_peptide AY738811_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738812_SHBs_P-A Product feature CHAIN AY738812_SHBs_P-A of FT:mat_peptide AY738812_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738813_SHBs_P-A Product feature CHAIN AY738813_SHBs_P-A of FT:mat_peptide AY738813_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738814_SHBs_P-A Product feature CHAIN AY738814_SHBs_P-A of FT:mat_peptide AY738814_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWSVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738815_SHBs_P-A Product feature CHAIN AY738815_SHBs_P-A of FT:mat_peptide AY738815_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGACKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYGIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738816_SHBs_P-A Product feature CHAIN AY738816_SHBs_P-A of FT:mat_peptide AY738816_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLHVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSQYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738817_SHBs_P-A Product feature CHAIN AY738817_SHBs_P-A of FT:mat_peptide AY738817_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPSFFCLWVII
>gnl|hbvpro|AY738818_SHBs_P-A Product feature CHAIN AY738818_SHBs_P-A of FT:mat_peptide AY738818_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738819_SHBs_P-A Product feature CHAIN AY738819_SHBs_P-A of FT:mat_peptide AY738819_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738820_SHBs_P-A Product feature CHAIN AY738820_SHBs_P-A of FT:mat_peptide AY738820_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVCI
>gnl|hbvpro|AY738821_SHBs_P-A Product feature CHAIN AY738821_SHBs_P-A of FT:mat_peptide AY738821_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738822_SHBs_P-A Product feature CHAIN AY738822_SHBs_P-A of FT:mat_peptide AY738822_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY862867_SHBs_P-A Product feature CHAIN AY862867_SHBs_P-A of FT:mat_peptide AY862867_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY862868_SHBs_P-A Product feature CHAIN AY862868_SHBs_P-A of FT:mat_peptide AY862868_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY902775_SHBs_P-A Product feature CHAIN AY902775_SHBs_P-A of FT:mat_peptide AY902775_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY903452_SHBs_P-A Product feature CHAIN AY903452_SHBs_P-A of FT:mat_peptide AY903452_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934763_SHBs_P-A Product feature CHAIN AY934763_SHBs_P-A of FT:mat_peptide AY934763_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRSCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFGK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934764_SHBs_P-A Product feature CHAIN AY934764_SHBs_P-A of FT:mat_peptide AY934764_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVWLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934765_SHBs_P-A Product feature CHAIN AY934765_SHBs_P-A of FT:mat_peptide AY934765_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934766_SHBs_P-A Product feature CHAIN AY934766_SHBs_P-A of FT:mat_peptide AY934766_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934767_SHBs_P-A Product feature CHAIN AY934767_SHBs_P-A of FT:mat_peptide AY934767_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934768_SHBs_P-A Product feature CHAIN AY934768_SHBs_P-A of FT:mat_peptide AY934768_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMVPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934769_SHBs_P-A Product feature CHAIN AY934769_SHBs_P-A of FT:mat_peptide AY934769_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934770_SHBs_P-A Product feature CHAIN AY934770_SHBs_P-A of FT:mat_peptide AY934770_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934771_SHBs_P-A Product feature CHAIN AY934771_SHBs_P-A of FT:mat_peptide AY934771_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934772_SHBs_P-A Product feature CHAIN AY934772_SHBs_P-A of FT:mat_peptide AY934772_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934773_SHBs_P-A Product feature CHAIN AY934773_SHBs_P-A of FT:mat_peptide AY934773_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=226 residues).
MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
XIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY934774_SHBs_P-A Product feature CHAIN AY934774_SHBs_P-A of FT:mat_peptide AY934774_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ020002_SHBs_P-A Product feature CHAIN DQ020002_SHBs_P-A of FT:mat_peptide DQ020002_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ020003_SHBs_P-A Product feature CHAIN DQ020003_SHBs_P-A of FT:mat_peptide DQ020003_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ131121_SHBs_P-A Product feature CHAIN DQ131121_SHBs_P-A of FT:mat_peptide DQ131121_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLVPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ131125_SHBs_P-A Product feature CHAIN DQ131125_SHBs_P-A of FT:mat_peptide DQ131125_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ236103_SHBs_P-A Product feature CHAIN DQ236103_SHBs_P-A of FT:mat_peptide DQ236103_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX C03). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ236104_SHBs_P-A Product feature CHAIN DQ236104_SHBs_P-A of FT:mat_peptide DQ236104_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX C04). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLLRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ236105_SHBs_P-A Product feature CHAIN DQ236105_SHBs_P-A of FT:mat_peptide DQ236105_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX C05). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFCCLWVYI
>gnl|hbvpro|DQ236107_SHBs_P-A Product feature CHAIN DQ236107_SHBs_P-A of FT:mat_peptide DQ236107_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX C07). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLTPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ236108_SHBs_P-A Product feature CHAIN DQ236108_SHBs_P-A of FT:mat_peptide DQ236108_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX C08). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLTPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ236110_SHBs_P-A Product feature CHAIN DQ236110_SHBs_P-A of FT:mat_peptide DQ236110_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MEX C10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ298161_SHBs_P-A Product feature CHAIN DQ298161_SHBs_P-A of FT:mat_peptide DQ298161_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLSFLGEAPVCPGQNSQSPTSNHSPTCCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ298162_SHBs_P-A Product feature CHAIN DQ298162_SHBs_P-A of FT:mat_peptide DQ298162_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAHVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPNLCNIVRPFIPLLSIFCCLWVYI
>gnl|hbvpro|DQ298163_SHBs_P-A Product feature CHAIN DQ298163_SHBs_P-A of FT:mat_peptide DQ298163_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAHVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFTPLLQIFCCLWVFI
>gnl|hbvpro|DQ298164_SHBs_P-A Product feature CHAIN DQ298164_SHBs_P-A of FT:mat_peptide DQ298164_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLQIFCCLWVFI
>gnl|hbvpro|DQ298165_SHBs_P-A Product feature CHAIN DQ298165_SHBs_P-A of FT:mat_peptide DQ298165_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLGQNSQSPTRNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVCPFTPLLQIFCCLWVFI
>gnl|hbvpro|DQ299401_SHBs_P-A Product feature CHAIN DQ299401_SHBs_P-A of FT:mat_peptide DQ299401_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FS_2045). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|DQ299404_SHBs_P-A Product feature CHAIN DQ299404_SHBs_P-A of FT:mat_peptide DQ299404_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FS_2298). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|DQ315784_SHBs_P-A Product feature CHAIN DQ315784_SHBs_P-A of FT:mat_peptide DQ315784_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ315785_SHBs_P-A Product feature CHAIN DQ315785_SHBs_P-A of FT:mat_peptide DQ315785_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI0386). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ315786_SHBs_P-A Product feature CHAIN DQ315786_SHBs_P-A of FT:mat_peptide DQ315786_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412443_SHBs_P-A Product feature CHAIN DQ412443_SHBs_P-A of FT:mat_peptide DQ412443_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S02000403). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412445_SHBs_P-A Product feature CHAIN DQ412445_SHBs_P-A of FT:mat_peptide DQ412445_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02003095). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412446_SHBs_P-A Product feature CHAIN DQ412446_SHBs_P-A of FT:mat_peptide DQ412446_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02003100). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPTVCLGQNSQXPTSNHSPTSCPPICPGYRWMWLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWXWGPSLCSILSPFTPLLLIFFCLWVYI
>gnl|hbvpro|DQ412447_SHBs_P-A Product feature CHAIN DQ412447_SHBs_P-A of FT:mat_peptide DQ412447_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02004203). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWGFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNIWSPFIPLLXIFFCLWVYI
>gnl|hbvpro|DQ412448_SHBs_P-A Product feature CHAIN DQ412448_SHBs_P-A of FT:mat_peptide DQ412448_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02005644). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFTPLLLIFFCLWVYI
>gnl|hbvpro|DQ412449_SHBs_P-A Product feature CHAIN DQ412449_SHBs_P-A of FT:mat_peptide DQ412449_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02006852). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPLTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWASAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412450_SHBs_P-A Product feature CHAIN DQ412450_SHBs_P-A of FT:mat_peptide DQ412450_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02009122). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412451_SHBs_P-A Product feature CHAIN DQ412451_SHBs_P-A of FT:mat_peptide DQ412451_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S02011119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSHFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412452_SHBs_P-A Product feature CHAIN DQ412452_SHBs_P-A of FT:mat_peptide DQ412452_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02012949). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412453_SHBs_P-A Product feature CHAIN DQ412453_SHBs_P-A of FT:mat_peptide DQ412453_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S02012952). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMIPSCCCTKPTDGNCTCIPIPSSWASAK
YLWEWASVRFSWLSLLVPFAQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412454_SHBs_P-A Product feature CHAIN DQ412454_SHBs_P-A of FT:mat_peptide DQ412454_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S02015691). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412455_SHBs_P-A Product feature CHAIN DQ412455_SHBs_P-A of FT:mat_peptide DQ412455_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S02016682). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRF
IIFLFXLLLCLIFLLVLQDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQNNSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412456_SHBs_P-A Product feature CHAIN DQ412456_SHBs_P-A of FT:mat_peptide DQ412456_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02022151). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412457_SHBs_P-A Product feature CHAIN DQ412457_SHBs_P-A of FT:mat_peptide DQ412457_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02023958). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLXVLLDYQGMLPVCPLIPGSTTTSRGPCKTCTTPAPGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412458_SHBs_P-A Product feature CHAIN DQ412458_SHBs_P-A of FT:mat_peptide DQ412458_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02023967). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412459_SHBs_P-A Product feature CHAIN DQ412459_SHBs_P-A of FT:mat_peptide DQ412459_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03001127). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412460_SHBs_P-A Product feature CHAIN DQ412460_SHBs_P-A of FT:mat_peptide DQ412460_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03007895). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412461_SHBs_P-A Product feature CHAIN DQ412461_SHBs_P-A of FT:mat_peptide DQ412461_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03008349). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412462_SHBs_P-A Product feature CHAIN DQ412462_SHBs_P-A of FT:mat_peptide DQ412462_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03016604). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412464_SHBs_P-A Product feature CHAIN DQ412464_SHBs_P-A of FT:mat_peptide DQ412464_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03017686). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGITVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|DQ412465_SHBs_P-A Product feature CHAIN DQ412465_SHBs_P-A of FT:mat_peptide DQ412465_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03018053). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412466_SHBs_P-A Product feature CHAIN DQ412466_SHBs_P-A of FT:mat_peptide DQ412466_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03019532). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412467_SHBs_P-A Product feature CHAIN DQ412467_SHBs_P-A of FT:mat_peptide DQ412467_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03021334). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPTCPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWFWGPSLFNILKPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412468_SHBs_P-A Product feature CHAIN DQ412468_SHBs_P-A of FT:mat_peptide DQ412468_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S03023665). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLXFLGGSPVCLGQNSQXPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412469_SHBs_P-A Product feature CHAIN DQ412469_SHBs_P-A of FT:mat_peptide DQ412469_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03024022). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSXLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412470_SHBs_P-A Product feature CHAIN DQ412470_SHBs_P-A of FT:mat_peptide DQ412470_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04000911). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412471_SHBs_P-A Product feature CHAIN DQ412471_SHBs_P-A of FT:mat_peptide DQ412471_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04001322). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412472_SHBs_P-A Product feature CHAIN DQ412472_SHBs_P-A of FT:mat_peptide DQ412472_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04001718). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412473_SHBs_P-A Product feature CHAIN DQ412473_SHBs_P-A of FT:mat_peptide DQ412473_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04006022). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQNNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412474_SHBs_P-A Product feature CHAIN DQ412474_SHBs_P-A of FT:mat_peptide DQ412474_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04008719). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412475_SHBs_P-A Product feature CHAIN DQ412475_SHBs_P-A of FT:mat_peptide DQ412475_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04013164). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412476_SHBs_P-A Product feature CHAIN DQ412476_SHBs_P-A of FT:mat_peptide DQ412476_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04013889). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412477_SHBs_P-A Product feature CHAIN DQ412477_SHBs_P-A of FT:mat_peptide DQ412477_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04019789). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412478_SHBs_P-A Product feature CHAIN DQ412478_SHBs_P-A of FT:mat_peptide DQ412478_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04020448). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDPPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412479_SHBs_P-A Product feature CHAIN DQ412479_SHBs_P-A of FT:mat_peptide DQ412479_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04020969). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412480_SHBs_P-A Product feature CHAIN DQ412480_SHBs_P-A of FT:mat_peptide DQ412480_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04023100). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412481_SHBs_P-A Product feature CHAIN DQ412481_SHBs_P-A of FT:mat_peptide DQ412481_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04024774). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412482_SHBs_P-A Product feature CHAIN DQ412482_SHBs_P-A of FT:mat_peptide DQ412482_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S04025434). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412483_SHBs_P-A Product feature CHAIN DQ412483_SHBs_P-A of FT:mat_peptide DQ412483_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05000567). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTXWLSXIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412484_SHBs_P-A Product feature CHAIN DQ412484_SHBs_P-A of FT:mat_peptide DQ412484_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05001608). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412485_SHBs_P-A Product feature CHAIN DQ412485_SHBs_P-A of FT:mat_peptide DQ412485_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05009484). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412486_SHBs_P-A Product feature CHAIN DQ412486_SHBs_P-A of FT:mat_peptide DQ412486_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05009485). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXXIWMMWYWGPSLYXILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|DQ412487_SHBs_P-A Product feature CHAIN DQ412487_SHBs_P-A of FT:mat_peptide DQ412487_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05010412). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412488_SHBs_P-A Product feature CHAIN DQ412488_SHBs_P-A of FT:mat_peptide DQ412488_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05014132). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLGLNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412489_SHBs_P-A Product feature CHAIN DQ412489_SHBs_P-A of FT:mat_peptide DQ412489_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05015377). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412490_SHBs_P-A Product feature CHAIN DQ412490_SHBs_P-A of FT:mat_peptide DQ412490_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05015562). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412491_SHBs_P-A Product feature CHAIN DQ412491_SHBs_P-A of FT:mat_peptide DQ412491_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05016894). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412492_SHBs_P-A Product feature CHAIN DQ412492_SHBs_P-A of FT:mat_peptide DQ412492_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05021370). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412493_SHBs_P-A Product feature CHAIN DQ412493_SHBs_P-A of FT:mat_peptide DQ412493_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s06001115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412494_SHBs_P-A Product feature CHAIN DQ412494_SHBs_P-A of FT:mat_peptide DQ412494_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03006072). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412495_SHBs_P-A Product feature CHAIN DQ412495_SHBs_P-A of FT:mat_peptide DQ412495_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate e04005714). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFXGXSPVCHGQNSXSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412496_SHBs_P-A Product feature CHAIN DQ412496_SHBs_P-A of FT:mat_peptide DQ412496_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate e05001211). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFTPLLPIFFCLWVYI
>gnl|hbvpro|DQ412497_SHBs_P-A Product feature CHAIN DQ412497_SHBs_P-A of FT:mat_peptide DQ412497_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02003101). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYXIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412498_SHBs_P-A Product feature CHAIN DQ412498_SHBs_P-A of FT:mat_peptide DQ412498_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02005645). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412499_SHBs_P-A Product feature CHAIN DQ412499_SHBs_P-A of FT:mat_peptide DQ412499_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02006857). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412500_SHBs_P-A Product feature CHAIN DQ412500_SHBs_P-A of FT:mat_peptide DQ412500_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02015690). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412501_SHBs_P-A Product feature CHAIN DQ412501_SHBs_P-A of FT:mat_peptide DQ412501_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S02019167). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|DQ412502_SHBs_P-A Product feature CHAIN DQ412502_SHBs_P-A of FT:mat_peptide DQ412502_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s02023960). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412503_SHBs_P-A Product feature CHAIN DQ412503_SHBs_P-A of FT:mat_peptide DQ412503_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S03001913). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412505_SHBs_P-A Product feature CHAIN DQ412505_SHBs_P-A of FT:mat_peptide DQ412505_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03007896). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412506_SHBs_P-A Product feature CHAIN DQ412506_SHBs_P-A of FT:mat_peptide DQ412506_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03017841). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412507_SHBs_P-A Product feature CHAIN DQ412507_SHBs_P-A of FT:mat_peptide DQ412507_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03024644). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412508_SHBs_P-A Product feature CHAIN DQ412508_SHBs_P-A of FT:mat_peptide DQ412508_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03024905). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNXQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412509_SHBs_P-A Product feature CHAIN DQ412509_SHBs_P-A of FT:mat_peptide DQ412509_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s03025319). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412510_SHBs_P-A Product feature CHAIN DQ412510_SHBs_P-A of FT:mat_peptide DQ412510_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04000576). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412511_SHBs_P-A Product feature CHAIN DQ412511_SHBs_P-A of FT:mat_peptide DQ412511_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04001424). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412512_SHBs_P-A Product feature CHAIN DQ412512_SHBs_P-A of FT:mat_peptide DQ412512_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04003303). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412513_SHBs_P-A Product feature CHAIN DQ412513_SHBs_P-A of FT:mat_peptide DQ412513_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04003408). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412514_SHBs_P-A Product feature CHAIN DQ412514_SHBs_P-A of FT:mat_peptide DQ412514_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04005839). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412515_SHBs_P-A Product feature CHAIN DQ412515_SHBs_P-A of FT:mat_peptide DQ412515_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04006948). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412516_SHBs_P-A Product feature CHAIN DQ412516_SHBs_P-A of FT:mat_peptide DQ412516_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04008408). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNXQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412517_SHBs_P-A Product feature CHAIN DQ412517_SHBs_P-A of FT:mat_peptide DQ412517_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04009363). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412518_SHBs_P-A Product feature CHAIN DQ412518_SHBs_P-A of FT:mat_peptide DQ412518_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04010494). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412519_SHBs_P-A Product feature CHAIN DQ412519_SHBs_P-A of FT:mat_peptide DQ412519_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04013441). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCHGQNSLSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412520_SHBs_P-A Product feature CHAIN DQ412520_SHBs_P-A of FT:mat_peptide DQ412520_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04013574). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTXPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412521_SHBs_P-A Product feature CHAIN DQ412521_SHBs_P-A of FT:mat_peptide DQ412521_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04013890). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412522_SHBs_P-A Product feature CHAIN DQ412522_SHBs_P-A of FT:mat_peptide DQ412522_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04015284). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMISXWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412523_SHBs_P-A Product feature CHAIN DQ412523_SHBs_P-A of FT:mat_peptide DQ412523_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04015417). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412524_SHBs_P-A Product feature CHAIN DQ412524_SHBs_P-A of FT:mat_peptide DQ412524_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04015800). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412525_SHBs_P-A Product feature CHAIN DQ412525_SHBs_P-A of FT:mat_peptide DQ412525_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04017583). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412526_SHBs_P-A Product feature CHAIN DQ412526_SHBs_P-A of FT:mat_peptide DQ412526_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04018169). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412528_SHBs_P-A Product feature CHAIN DQ412528_SHBs_P-A of FT:mat_peptide DQ412528_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04020125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412529_SHBs_P-A Product feature CHAIN DQ412529_SHBs_P-A of FT:mat_peptide DQ412529_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04021181). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTXNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQXNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412530_SHBs_P-A Product feature CHAIN DQ412530_SHBs_P-A of FT:mat_peptide DQ412530_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04021494). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412531_SHBs_P-A Product feature CHAIN DQ412531_SHBs_P-A of FT:mat_peptide DQ412531_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s04023099). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412532_SHBs_P-A Product feature CHAIN DQ412532_SHBs_P-A of FT:mat_peptide DQ412532_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05000388). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLXPIFFXLWVYI
>gnl|hbvpro|DQ412533_SHBs_P-A Product feature CHAIN DQ412533_SHBs_P-A of FT:mat_peptide DQ412533_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05001110). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412534_SHBs_P-A Product feature CHAIN DQ412534_SHBs_P-A of FT:mat_peptide DQ412534_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05003005). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412535_SHBs_P-A Product feature CHAIN DQ412535_SHBs_P-A of FT:mat_peptide DQ412535_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05003007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412537_SHBs_P-A Product feature CHAIN DQ412537_SHBs_P-A of FT:mat_peptide DQ412537_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05006576). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFSLVLLDYQGMLPVCPLMPGSTTTSTGPCKTCTTPAQGNSTLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412538_SHBs_P-A Product feature CHAIN DQ412538_SHBs_P-A of FT:mat_peptide DQ412538_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05006873). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCXGQNSQCPXSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412539_SHBs_P-A Product feature CHAIN DQ412539_SHBs_P-A of FT:mat_peptide DQ412539_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05014484). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412540_SHBs_P-A Product feature CHAIN DQ412540_SHBs_P-A of FT:mat_peptide DQ412540_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05014763). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412541_SHBs_P-A Product feature CHAIN DQ412541_SHBs_P-A of FT:mat_peptide DQ412541_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05015138). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412543_SHBs_P-A Product feature CHAIN DQ412543_SHBs_P-A of FT:mat_peptide DQ412543_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05015565). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412544_SHBs_P-A Product feature CHAIN DQ412544_SHBs_P-A of FT:mat_peptide DQ412544_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05016895). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412545_SHBs_P-A Product feature CHAIN DQ412545_SHBs_P-A of FT:mat_peptide DQ412545_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S05016897). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412546_SHBs_P-A Product feature CHAIN DQ412546_SHBs_P-A of FT:mat_peptide DQ412546_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05017882). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412547_SHBs_P-A Product feature CHAIN DQ412547_SHBs_P-A of FT:mat_peptide DQ412547_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05017883). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412548_SHBs_P-A Product feature CHAIN DQ412548_SHBs_P-A of FT:mat_peptide DQ412548_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05017885). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412549_SHBs_P-A Product feature CHAIN DQ412549_SHBs_P-A of FT:mat_peptide DQ412549_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05018055). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412550_SHBs_P-A Product feature CHAIN DQ412550_SHBs_P-A of FT:mat_peptide DQ412550_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05018794). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412551_SHBs_P-A Product feature CHAIN DQ412551_SHBs_P-A of FT:mat_peptide DQ412551_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05021811). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGEPPVCXGQNXQSXTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYXIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412552_SHBs_P-A Product feature CHAIN DQ412552_SHBs_P-A of FT:mat_peptide DQ412552_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05022192). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412553_SHBs_P-A Product feature CHAIN DQ412553_SHBs_P-A of FT:mat_peptide DQ412553_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05022193). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412554_SHBs_P-A Product feature CHAIN DQ412554_SHBs_P-A of FT:mat_peptide DQ412554_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05024566). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412555_SHBs_P-A Product feature CHAIN DQ412555_SHBs_P-A of FT:mat_peptide DQ412555_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s05024568). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412556_SHBs_P-A Product feature CHAIN DQ412556_SHBs_P-A of FT:mat_peptide DQ412556_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s06001510). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412557_SHBs_P-A Product feature CHAIN DQ412557_SHBs_P-A of FT:mat_peptide DQ412557_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate s06001513). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ459086_SHBs_P-A Product feature CHAIN DQ459086_SHBs_P-A of FT:mat_peptide DQ459086_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient ID7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKLTDRNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ788725_SHBs_P-A Product feature CHAIN DQ788725_SHBs_P-A of FT:mat_peptide DQ788725_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCPIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995813_SHBs_P-A Product feature CHAIN DQ995813_SHBs_P-A of FT:mat_peptide DQ995813_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Pts5_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNXQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIXLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFLPLLPIFFFLWVYI
>gnl|hbvpro|DQ995822_SHBs_P-A Product feature CHAIN DQ995822_SHBs_P-A of FT:mat_peptide DQ995822_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Pts14_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFIGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995827_SHBs_P-A Product feature CHAIN DQ995827_SHBs_P-A of FT:mat_peptide DQ995827_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Pts19_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFLCLWVYI
>gnl|hbvpro|DQ995829_SHBs_P-A Product feature CHAIN DQ995829_SHBs_P-A of FT:mat_peptide DQ995829_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Pts21_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995834_SHBs_P-A Product feature CHAIN DQ995834_SHBs_P-A of FT:mat_peptide DQ995834_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Pts26_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCNTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMIWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF103278_SHBs_P-A Product feature CHAIN EF103278_SHBs_P-A of FT:mat_peptide EF103278_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILQLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRLSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSHFIPLLPIFFCLWVYI
>gnl|hbvpro|EF208113_SHBs_P-A Product feature CHAIN EF208113_SHBs_P-A of FT:mat_peptide EF208113_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSTVSPFILLLPIFFCLWVYI
>gnl|hbvpro|EF547828_SHBs_P-A Product feature CHAIN EF547828_SHBs_P-A of FT:mat_peptide EF547828_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD151-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547829_SHBs_P-A Product feature CHAIN EF547829_SHBs_P-A of FT:mat_peptide EF547829_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD219-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTRPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547830_SHBs_P-A Product feature CHAIN EF547830_SHBs_P-A of FT:mat_peptide EF547830_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD95-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTRPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547831_SHBs_P-A Product feature CHAIN EF547831_SHBs_P-A of FT:mat_peptide EF547831_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD05-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547832_SHBs_P-A Product feature CHAIN EF547832_SHBs_P-A of FT:mat_peptide EF547832_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD260-6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLILGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547833_SHBs_P-A Product feature CHAIN EF547833_SHBs_P-A of FT:mat_peptide EF547833_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD153-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547834_SHBs_P-A Product feature CHAIN EF547834_SHBs_P-A of FT:mat_peptide EF547834_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD165-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547835_SHBs_P-A Product feature CHAIN EF547835_SHBs_P-A of FT:mat_peptide EF547835_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD266-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFIPLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547836_SHBs_P-A Product feature CHAIN EF547836_SHBs_P-A of FT:mat_peptide EF547836_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD56-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547837_SHBs_P-A Product feature CHAIN EF547837_SHBs_P-A of FT:mat_peptide EF547837_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD250-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547838_SHBs_P-A Product feature CHAIN EF547838_SHBs_P-A of FT:mat_peptide EF547838_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD264-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547839_SHBs_P-A Product feature CHAIN EF547839_SHBs_P-A of FT:mat_peptide EF547839_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD07-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547840_SHBs_P-A Product feature CHAIN EF547840_SHBs_P-A of FT:mat_peptide EF547840_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD120-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547841_SHBs_P-A Product feature CHAIN EF547841_SHBs_P-A of FT:mat_peptide EF547841_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD142-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547842_SHBs_P-A Product feature CHAIN EF547842_SHBs_P-A of FT:mat_peptide EF547842_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD167-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547843_SHBs_P-A Product feature CHAIN EF547843_SHBs_P-A of FT:mat_peptide EF547843_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD188-8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547844_SHBs_P-A Product feature CHAIN EF547844_SHBs_P-A of FT:mat_peptide EF547844_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD191-0). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547845_SHBs_P-A Product feature CHAIN EF547845_SHBs_P-A of FT:mat_peptide EF547845_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD64-6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547846_SHBs_P-A Product feature CHAIN EF547846_SHBs_P-A of FT:mat_peptide EF547846_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD72-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547847_SHBs_P-A Product feature CHAIN EF547847_SHBs_P-A of FT:mat_peptide EF547847_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD126-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547848_SHBs_P-A Product feature CHAIN EF547848_SHBs_P-A of FT:mat_peptide EF547848_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD97-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|EF547849_SHBs_P-A Product feature CHAIN EF547849_SHBs_P-A of FT:mat_peptide EF547849_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD273-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQSMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547850_SHBs_P-A Product feature CHAIN EF547850_SHBs_P-A of FT:mat_peptide EF547850_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD141-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLVPIFFCLWVYI
>gnl|hbvpro|EF547851_SHBs_P-A Product feature CHAIN EF547851_SHBs_P-A of FT:mat_peptide EF547851_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD154-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547852_SHBs_P-A Product feature CHAIN EF547852_SHBs_P-A of FT:mat_peptide EF547852_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD155-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLEPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547853_SHBs_P-A Product feature CHAIN EF547853_SHBs_P-A of FT:mat_peptide EF547853_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD58-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547854_SHBs_P-A Product feature CHAIN EF547854_SHBs_P-A of FT:mat_peptide EF547854_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD160-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MERLTSGFLGPLLVLQAGSLLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF547855_SHBs_P-A Product feature CHAIN EF547855_SHBs_P-A of FT:mat_peptide EF547855_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD63-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLKPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLSPIFFCLWVYI
>gnl|hbvpro|EF547856_SHBs_P-A Product feature CHAIN EF547856_SHBs_P-A of FT:mat_peptide EF547856_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FD168-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEDITSGFLGPLLVLQAGYWELTRILTIPQSLFSGWTSLNFLGGSPVCLGQNSQSPPSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690515_SHBs_P-A Product feature CHAIN EF690515_SHBs_P-A of FT:mat_peptide EF690515_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 190-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|EF690516_SHBs_P-A Product feature CHAIN EF690516_SHBs_P-A of FT:mat_peptide EF690516_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 051-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690517_SHBs_P-A Product feature CHAIN EF690517_SHBs_P-A of FT:mat_peptide EF690517_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 170-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690518_SHBs_P-A Product feature CHAIN EF690518_SHBs_P-A of FT:mat_peptide EF690518_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 284-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPILFCLWVYI
>gnl|hbvpro|EF690519_SHBs_P-A Product feature CHAIN EF690519_SHBs_P-A of FT:mat_peptide EF690519_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 177-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSTIWMMWYWGPSLYNILSPFIPLLPILFCLWVYI
>gnl|hbvpro|EF690520_SHBs_P-A Product feature CHAIN EF690520_SHBs_P-A of FT:mat_peptide EF690520_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 048-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLILLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690521_SHBs_P-A Product feature CHAIN EF690521_SHBs_P-A of FT:mat_peptide EF690521_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 043-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEPITSVFLGPLFVTQAGFFLSTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690522_SHBs_P-A Product feature CHAIN EF690522_SHBs_P-A of FT:mat_peptide EF690522_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 277-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIIFCLWVYI
>gnl|hbvpro|EF690523_SHBs_P-A Product feature CHAIN EF690523_SHBs_P-A of FT:mat_peptide EF690523_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 312-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIILCLWVYI
>gnl|hbvpro|EF690524_SHBs_P-A Product feature CHAIN EF690524_SHBs_P-A of FT:mat_peptide EF690524_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 358-S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690525_SHBs_P-A Product feature CHAIN EF690525_SHBs_P-A of FT:mat_peptide EF690525_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 161-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSVFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLCILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690526_SHBs_P-A Product feature CHAIN EF690526_SHBs_P-A of FT:mat_peptide EF690526_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 171-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690527_SHBs_P-A Product feature CHAIN EF690527_SHBs_P-A of FT:mat_peptide EF690527_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 255-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690528_SHBs_P-A Product feature CHAIN EF690528_SHBs_P-A of FT:mat_peptide EF690528_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 186-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690529_SHBs_P-A Product feature CHAIN EF690529_SHBs_P-A of FT:mat_peptide EF690529_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 280-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSHVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYRILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690530_SHBs_P-A Product feature CHAIN EF690530_SHBs_P-A of FT:mat_peptide EF690530_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 343-S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690531_SHBs_P-A Product feature CHAIN EF690531_SHBs_P-A of FT:mat_peptide EF690531_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 351-S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIIFCLWVYI
>gnl|hbvpro|EF690532_SHBs_P-A Product feature CHAIN EF690532_SHBs_P-A of FT:mat_peptide EF690532_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 250-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPILFCLWVYI
>gnl|hbvpro|EF690533_SHBs_P-A Product feature CHAIN EF690533_SHBs_P-A of FT:mat_peptide EF690533_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 249-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIILCLWVYI
>gnl|hbvpro|EF690534_SHBs_P-A Product feature CHAIN EF690534_SHBs_P-A of FT:mat_peptide EF690534_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 146-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPILLCLWVYI
>gnl|hbvpro|EF690535_SHBs_P-A Product feature CHAIN EF690535_SHBs_P-A of FT:mat_peptide EF690535_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 159-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCRGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690536_SHBs_P-A Product feature CHAIN EF690536_SHBs_P-A of FT:mat_peptide EF690536_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 378-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPILFCLWVSI
>gnl|hbvpro|EU054331_SHBs_C-A Product feature CHAIN EU054331_SHBs_C-A of FT:mat_peptide EU054331_SHBs_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU086721_SHBs_P-A Product feature CHAIN EU086721_SHBs_P-A of FT:mat_peptide EU086721_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU159676_SHBs_P-A Product feature CHAIN EU159676_SHBs_P-A of FT:mat_peptide EU159676_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Irish-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU185786_SHBs_P-A Product feature CHAIN EU185786_SHBs_P-A of FT:mat_peptide EU185786_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU11). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGPLDYQGILPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCXXPTDXXCTCXXXPSSWAXAK
YLWEWGSARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYXGPSLYSIVSXFIPLLPIFFCLWVYI
>gnl|hbvpro|EU185787_SHBs_P-A Product feature CHAIN EU185787_SHBs_P-A of FT:mat_peptide EU185787_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPXNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGILPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGXCTCXXIPSSWAXAK
YLWEWGSARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLXSIVSXFIPLLPIFFCLWVYI
>gnl|hbvpro|EU185788_SHBs_P-A Product feature CHAIN EU185788_SHBs_P-A of FT:mat_peptide EU185788_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU19). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGILPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGXCTCXXIPSSWAXAK
YLWEWGSARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSXFIPLLPIFFCLWVYI
>gnl|hbvpro|EU185789_SHBs_P-A Product feature CHAIN EU185789_SHBs_P-A of FT:mat_peptide EU185789_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENIXSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGILPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGXCTCXXXPSSWAXAK
YLWEWGSARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSXFIPLLPIFFCLWVYI
>gnl|hbvpro|EU366129_SHBs_P-A Product feature CHAIN EU366129_SHBs_P-A of FT:mat_peptide EU366129_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPNLLNTLKPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU410082_SHBs_P-A Product feature CHAIN EU410082_SHBs_P-A of FT:mat_peptide EU410082_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU414102_SHBs_P-A Product feature CHAIN EU414102_SHBs_P-A of FT:mat_peptide EU414102_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU414103_SHBs_P-A Product feature CHAIN EU414103_SHBs_P-A of FT:mat_peptide EU414103_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU414104_SHBs_P-A Product feature CHAIN EU414104_SHBs_P-A of FT:mat_peptide EU414104_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPXICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIXXPFIPLLXIFFCLWVYI
>gnl|hbvpro|EU414132_SHBs_P-A Product feature CHAIN EU414132_SHBs_P-A of FT:mat_peptide EU414132_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU414133_SHBs_P-A Product feature CHAIN EU414133_SHBs_P-A of FT:mat_peptide EU414133_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594383_SHBs_P-A Product feature CHAIN EU594383_SHBs_P-A of FT:mat_peptide EU594383_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594384_SHBs_P-A Product feature CHAIN EU594384_SHBs_P-A of FT:mat_peptide EU594384_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594385_SHBs_P-A Product feature CHAIN EU594385_SHBs_P-A of FT:mat_peptide EU594385_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594386_SHBs_P-A Product feature CHAIN EU594386_SHBs_P-A of FT:mat_peptide EU594386_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVFLDYQGMLPVCPIIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594387_SHBs_P-A Product feature CHAIN EU594387_SHBs_P-A of FT:mat_peptide EU594387_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594388_SHBs_P-A Product feature CHAIN EU594388_SHBs_P-A of FT:mat_peptide EU594388_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594389_SHBs_P-A Product feature CHAIN EU594389_SHBs_P-A of FT:mat_peptide EU594389_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594390_SHBs_P-A Product feature CHAIN EU594390_SHBs_P-A of FT:mat_peptide EU594390_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594391_SHBs_P-A Product feature CHAIN EU594391_SHBs_P-A of FT:mat_peptide EU594391_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594392_SHBs_P-A Product feature CHAIN EU594392_SHBs_P-A of FT:mat_peptide EU594392_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594393_SHBs_P-A Product feature CHAIN EU594393_SHBs_P-A of FT:mat_peptide EU594393_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594394_SHBs_P-A Product feature CHAIN EU594394_SHBs_P-A of FT:mat_peptide EU594394_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU594395_SHBs_P-A Product feature CHAIN EU594395_SHBs_P-A of FT:mat_peptide EU594395_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU747320_SHBs_P-A Product feature CHAIN EU747320_SHBs_P-A of FT:mat_peptide EU747320_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V51). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQILDSWWNSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859898_SHBs_P-A Product feature CHAIN EU859898_SHBs_P-A of FT:mat_peptide EU859898_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859899_SHBs_P-A Product feature CHAIN EU859899_SHBs_P-A of FT:mat_peptide EU859899_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859900_SHBs_P-A Product feature CHAIN EU859900_SHBs_P-A of FT:mat_peptide EU859900_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859901_SHBs_P-A Product feature CHAIN EU859901_SHBs_P-A of FT:mat_peptide EU859901_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859902_SHBs_P-A Product feature CHAIN EU859902_SHBs_P-A of FT:mat_peptide EU859902_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859903_SHBs_P-A Product feature CHAIN EU859903_SHBs_P-A of FT:mat_peptide EU859903_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859904_SHBs_P-A Product feature CHAIN EU859904_SHBs_P-A of FT:mat_peptide EU859904_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859905_SHBs_P-A Product feature CHAIN EU859905_SHBs_P-A of FT:mat_peptide EU859905_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859906_SHBs_P-A Product feature CHAIN EU859906_SHBs_P-A of FT:mat_peptide EU859906_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859907_SHBs_P-A Product feature CHAIN EU859907_SHBs_P-A of FT:mat_peptide EU859907_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859908_SHBs_P-A Product feature CHAIN EU859908_SHBs_P-A of FT:mat_peptide EU859908_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859909_SHBs_P-A Product feature CHAIN EU859909_SHBs_P-A of FT:mat_peptide EU859909_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859910_SHBs_P-A Product feature CHAIN EU859910_SHBs_P-A of FT:mat_peptide EU859910_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859911_SHBs_P-A Product feature CHAIN EU859911_SHBs_P-A of FT:mat_peptide EU859911_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859912_SHBs_P-A Product feature CHAIN EU859912_SHBs_P-A of FT:mat_peptide EU859912_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859913_SHBs_P-A Product feature CHAIN EU859913_SHBs_P-A of FT:mat_peptide EU859913_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859914_SHBs_P-A Product feature CHAIN EU859914_SHBs_P-A of FT:mat_peptide EU859914_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859915_SHBs_P-A Product feature CHAIN EU859915_SHBs_P-A of FT:mat_peptide EU859915_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859916_SHBs_P-A Product feature CHAIN EU859916_SHBs_P-A of FT:mat_peptide EU859916_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859917_SHBs_P-A Product feature CHAIN EU859917_SHBs_P-A of FT:mat_peptide EU859917_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859918_SHBs_P-A Product feature CHAIN EU859918_SHBs_P-A of FT:mat_peptide EU859918_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859919_SHBs_P-A Product feature CHAIN EU859919_SHBs_P-A of FT:mat_peptide EU859919_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859920_SHBs_P-A Product feature CHAIN EU859920_SHBs_P-A of FT:mat_peptide EU859920_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859921_SHBs_P-A Product feature CHAIN EU859921_SHBs_P-A of FT:mat_peptide EU859921_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTFNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859922_SHBs_P-A Product feature CHAIN EU859922_SHBs_P-A of FT:mat_peptide EU859922_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859923_SHBs_P-A Product feature CHAIN EU859923_SHBs_P-A of FT:mat_peptide EU859923_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859924_SHBs_P-A Product feature CHAIN EU859924_SHBs_P-A of FT:mat_peptide EU859924_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859925_SHBs_P-A Product feature CHAIN EU859925_SHBs_P-A of FT:mat_peptide EU859925_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859926_SHBs_P-A Product feature CHAIN EU859926_SHBs_P-A of FT:mat_peptide EU859926_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859927_SHBs_P-A Product feature CHAIN EU859927_SHBs_P-A of FT:mat_peptide EU859927_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859928_SHBs_P-A Product feature CHAIN EU859928_SHBs_P-A of FT:mat_peptide EU859928_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859929_SHBs_P-A Product feature CHAIN EU859929_SHBs_P-A of FT:mat_peptide EU859929_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859930_SHBs_P-A Product feature CHAIN EU859930_SHBs_P-A of FT:mat_peptide EU859930_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859931_SHBs_P-A Product feature CHAIN EU859931_SHBs_P-A of FT:mat_peptide EU859931_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859932_SHBs_P-A Product feature CHAIN EU859932_SHBs_P-A of FT:mat_peptide EU859932_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859933_SHBs_P-A Product feature CHAIN EU859933_SHBs_P-A of FT:mat_peptide EU859933_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859934_SHBs_P-A Product feature CHAIN EU859934_SHBs_P-A of FT:mat_peptide EU859934_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDANCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859935_SHBs_P-A Product feature CHAIN EU859935_SHBs_P-A of FT:mat_peptide EU859935_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859936_SHBs_P-A Product feature CHAIN EU859936_SHBs_P-A of FT:mat_peptide EU859936_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859937_SHBs_P-A Product feature CHAIN EU859937_SHBs_P-A of FT:mat_peptide EU859937_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859938_SHBs_P-A Product feature CHAIN EU859938_SHBs_P-A of FT:mat_peptide EU859938_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C133). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859939_SHBs_P-A Product feature CHAIN EU859939_SHBs_P-A of FT:mat_peptide EU859939_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859940_SHBs_P-A Product feature CHAIN EU859940_SHBs_P-A of FT:mat_peptide EU859940_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859941_SHBs_P-A Product feature CHAIN EU859941_SHBs_P-A of FT:mat_peptide EU859941_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859942_SHBs_P-A Product feature CHAIN EU859942_SHBs_P-A of FT:mat_peptide EU859942_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859943_SHBs_P-A Product feature CHAIN EU859943_SHBs_P-A of FT:mat_peptide EU859943_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859944_SHBs_P-A Product feature CHAIN EU859944_SHBs_P-A of FT:mat_peptide EU859944_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859945_SHBs_P-A Product feature CHAIN EU859945_SHBs_P-A of FT:mat_peptide EU859945_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859946_SHBs_P-A Product feature CHAIN EU859946_SHBs_P-A of FT:mat_peptide EU859946_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859947_SHBs_P-A Product feature CHAIN EU859947_SHBs_P-A of FT:mat_peptide EU859947_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859948_SHBs_P-A Product feature CHAIN EU859948_SHBs_P-A of FT:mat_peptide EU859948_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859949_SHBs_P-A Product feature CHAIN EU859949_SHBs_P-A of FT:mat_peptide EU859949_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859950_SHBs_P-A Product feature CHAIN EU859950_SHBs_P-A of FT:mat_peptide EU859950_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGSPVCLGQDSQSPTSNHSPTSCPRICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859951_SHBs_P-A Product feature CHAIN EU859951_SHBs_P-A of FT:mat_peptide EU859951_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859952_SHBs_P-A Product feature CHAIN EU859952_SHBs_P-A of FT:mat_peptide EU859952_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859953_SHBs_P-A Product feature CHAIN EU859953_SHBs_P-A of FT:mat_peptide EU859953_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFSLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859954_SHBs_P-A Product feature CHAIN EU859954_SHBs_P-A of FT:mat_peptide EU859954_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859955_SHBs_P-A Product feature CHAIN EU859955_SHBs_P-A of FT:mat_peptide EU859955_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU859956_SHBs_P-A Product feature CHAIN EU859956_SHBs_P-A of FT:mat_peptide EU859956_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349222_SHBs_P-A Product feature CHAIN FJ349222_SHBs_P-A of FT:mat_peptide FJ349222_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349224_SHBs_P-A Product feature CHAIN FJ349224_SHBs_P-A of FT:mat_peptide FJ349224_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ349296_SHBs_P-A Product feature CHAIN FJ349296_SHBs_P-A of FT:mat_peptide FJ349296_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ665815_SHBs_P-A Product feature CHAIN FJ665815_SHBs_P-A of FT:mat_peptide FJ665815_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HD-06). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IILLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ665816_SHBs_P-A Product feature CHAIN FJ665816_SHBs_P-A of FT:mat_peptide FJ665816_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HD-41). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPNCHGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692554_SHBs_P-A Product feature CHAIN FJ692554_SHBs_P-A of FT:mat_peptide FJ692554_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKSCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FJ692555_SHBs_P-A Product feature CHAIN FJ692555_SHBs_P-A of FT:mat_peptide FJ692555_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24074). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSGFPGPLHVLQAGFSLLTRILTIPQSLDSWWTSLNFLEGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTXTSTGPCRTCTTPAQGNSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692557_SHBs_P-A Product feature CHAIN FJ692557_SHBs_P-A of FT:mat_peptide FJ692557_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692558_SHBs_P-A Product feature CHAIN FJ692558_SHBs_P-A of FT:mat_peptide FJ692558_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLXIFFXLWVYI
>gnl|hbvpro|FJ692559_SHBs_P-A Product feature CHAIN FJ692559_SHBs_P-A of FT:mat_peptide FJ692559_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692561_SHBs_P-A Product feature CHAIN FJ692561_SHBs_P-A of FT:mat_peptide FJ692561_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPHVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692562_SHBs_P-A Product feature CHAIN FJ692562_SHBs_P-A of FT:mat_peptide FJ692562_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692563_SHBs_P-A Product feature CHAIN FJ692563_SHBs_P-A of FT:mat_peptide FJ692563_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFXCLWVYI
>gnl|hbvpro|FJ692564_SHBs_P-A Product feature CHAIN FJ692564_SHBs_P-A of FT:mat_peptide FJ692564_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692565_SHBs_P-A Product feature CHAIN FJ692565_SHBs_P-A of FT:mat_peptide FJ692565_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVXI
>gnl|hbvpro|FJ692566_SHBs_P-A Product feature CHAIN FJ692566_SHBs_P-A of FT:mat_peptide FJ692566_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692567_SHBs_P-A Product feature CHAIN FJ692567_SHBs_P-A of FT:mat_peptide FJ692567_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692571_SHBs_P-A Product feature CHAIN FJ692571_SHBs_P-A of FT:mat_peptide FJ692571_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692572_SHBs_P-A Product feature CHAIN FJ692572_SHBs_P-A of FT:mat_peptide FJ692572_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50013). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSXXPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692573_SHBs_P-A Product feature CHAIN FJ692573_SHBs_P-A of FT:mat_peptide FJ692573_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50014). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|FJ692574_SHBs_P-A Product feature CHAIN FJ692574_SHBs_P-A of FT:mat_peptide FJ692574_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692575_SHBs_P-A Product feature CHAIN FJ692575_SHBs_P-A of FT:mat_peptide FJ692575_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSAIWMMWYWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692576_SHBs_P-A Product feature CHAIN FJ692576_SHBs_P-A of FT:mat_peptide FJ692576_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPKLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|FJ692577_SHBs_P-A Product feature CHAIN FJ692577_SHBs_P-A of FT:mat_peptide FJ692577_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLXNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692578_SHBs_P-A Product feature CHAIN FJ692578_SHBs_P-A of FT:mat_peptide FJ692578_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692579_SHBs_P-A Product feature CHAIN FJ692579_SHBs_P-A of FT:mat_peptide FJ692579_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692580_SHBs_P-A Product feature CHAIN FJ692580_SHBs_P-A of FT:mat_peptide FJ692580_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692581_SHBs_P-A Product feature CHAIN FJ692581_SHBs_P-A of FT:mat_peptide FJ692581_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692582_SHBs_P-A Product feature CHAIN FJ692582_SHBs_P-A of FT:mat_peptide FJ692582_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692583_SHBs_P-A Product feature CHAIN FJ692583_SHBs_P-A of FT:mat_peptide FJ692583_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692584_SHBs_P-A Product feature CHAIN FJ692584_SHBs_P-A of FT:mat_peptide FJ692584_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692585_SHBs_P-A Product feature CHAIN FJ692585_SHBs_P-A of FT:mat_peptide FJ692585_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692586_SHBs_P-A Product feature CHAIN FJ692586_SHBs_P-A of FT:mat_peptide FJ692586_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCQRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|FJ692588_SHBs_P-A Product feature CHAIN FJ692588_SHBs_P-A of FT:mat_peptide FJ692588_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692590_SHBs_P-A Product feature CHAIN FJ692590_SHBs_P-A of FT:mat_peptide FJ692590_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692591_SHBs_P-A Product feature CHAIN FJ692591_SHBs_P-A of FT:mat_peptide FJ692591_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692592_SHBs_P-A Product feature CHAIN FJ692592_SHBs_P-A of FT:mat_peptide FJ692592_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692595_SHBs_P-A Product feature CHAIN FJ692595_SHBs_P-A of FT:mat_peptide FJ692595_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692596_SHBs_P-A Product feature CHAIN FJ692596_SHBs_P-A of FT:mat_peptide FJ692596_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692597_SHBs_P-A Product feature CHAIN FJ692597_SHBs_P-A of FT:mat_peptide FJ692597_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692598_SHBs_P-A Product feature CHAIN FJ692598_SHBs_P-A of FT:mat_peptide FJ692598_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692599_SHBs_P-A Product feature CHAIN FJ692599_SHBs_P-A of FT:mat_peptide FJ692599_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692600_SHBs_P-A Product feature CHAIN FJ692600_SHBs_P-A of FT:mat_peptide FJ692600_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFXK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692601_SHBs_P-A Product feature CHAIN FJ692601_SHBs_P-A of FT:mat_peptide FJ692601_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692602_SHBs_P-A Product feature CHAIN FJ692602_SHBs_P-A of FT:mat_peptide FJ692602_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692603_SHBs_P-A Product feature CHAIN FJ692603_SHBs_P-A of FT:mat_peptide FJ692603_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692604_SHBs_P-A Product feature CHAIN FJ692604_SHBs_P-A of FT:mat_peptide FJ692604_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692605_SHBs_P-A Product feature CHAIN FJ692605_SHBs_P-A of FT:mat_peptide FJ692605_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGXSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692606_SHBs_P-A Product feature CHAIN FJ692606_SHBs_P-A of FT:mat_peptide FJ692606_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFXXPPLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTXSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692607_SHBs_P-A Product feature CHAIN FJ692607_SHBs_P-A of FT:mat_peptide FJ692607_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRX
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692608_SHBs_P-A Product feature CHAIN FJ692608_SHBs_P-A of FT:mat_peptide FJ692608_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692609_SHBs_P-A Product feature CHAIN FJ692609_SHBs_P-A of FT:mat_peptide FJ692609_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50098). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692610_SHBs_P-A Product feature CHAIN FJ692610_SHBs_P-A of FT:mat_peptide FJ692610_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50104). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692611_SHBs_P-A Product feature CHAIN FJ692611_SHBs_P-A of FT:mat_peptide FJ692611_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ692612_SHBs_P-A Product feature CHAIN FJ692612_SHBs_P-A of FT:mat_peptide FJ692612_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|FJ692613_SHBs_P-A Product feature CHAIN FJ692613_SHBs_P-A of FT:mat_peptide FJ692613_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSILPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNIVRPFMPLLPIFFCLWAYI
>gnl|hbvpro|FJ709470_SHBs_P-A Product feature CHAIN FJ709470_SHBs_P-A of FT:mat_peptide FJ709470_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHI14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ709471_SHBs_P-A Product feature CHAIN FJ709471_SHBs_P-A of FT:mat_peptide FJ709471_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHI15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGQSLYSIVSPFIPLLPIFFYLWVYI
>gnl|hbvpro|FJ709472_SHBs_P-A Product feature CHAIN FJ709472_SHBs_P-A of FT:mat_peptide FJ709472_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHI16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFSLVLLDYQGILPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ904411_SHBs_P-A Product feature CHAIN FJ904411_SHBs_P-A of FT:mat_peptide FJ904411_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A55). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTFNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPGLYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904434_SHBs_P-A Product feature CHAIN FJ904434_SHBs_P-A of FT:mat_peptide FJ904434_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FM199974_SHBs_P-A Product feature CHAIN FM199974_SHBs_P-A of FT:mat_peptide FM199974_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199975_SHBs_P-A Product feature CHAIN FM199975_SHBs_P-A of FT:mat_peptide FM199975_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199976_SHBs_P-A Product feature CHAIN FM199976_SHBs_P-A of FT:mat_peptide FM199976_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199977_SHBs_P-A Product feature CHAIN FM199977_SHBs_P-A of FT:mat_peptide FM199977_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVXI
>gnl|hbvpro|FM199978_SHBs_P-A Product feature CHAIN FM199978_SHBs_P-A of FT:mat_peptide FM199978_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199979_SHBs_P-A Product feature CHAIN FM199979_SHBs_P-A of FT:mat_peptide FM199979_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199980_SHBs_P-A Product feature CHAIN FM199980_SHBs_P-A of FT:mat_peptide FM199980_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGXSMFPSCCCTKXTAGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM199981_SHBs_P-A Product feature CHAIN FM199981_SHBs_P-A of FT:mat_peptide FM199981_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGXLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200180_SHBs_P-A Product feature CHAIN FM200180_SHBs_P-A of FT:mat_peptide FM200180_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSLTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTAGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFILLLPIFFCLWVYI
>gnl|hbvpro|FM200181_SHBs_P-A Product feature CHAIN FM200181_SHBs_P-A of FT:mat_peptide FM200181_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPXVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200182_SHBs_P-A Product feature CHAIN FM200182_SHBs_P-A of FT:mat_peptide FM200182_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200183_SHBs_P-A Product feature CHAIN FM200183_SHBs_P-A of FT:mat_peptide FM200183_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQSSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPASTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200185_SHBs_P-A Product feature CHAIN FM200185_SHBs_P-A of FT:mat_peptide FM200185_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDRNCTCIPIPSSWAFGK
YLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200186_SHBs_P-A Product feature CHAIN FM200186_SHBs_P-A of FT:mat_peptide FM200186_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIQGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200187_SHBs_P-A Product feature CHAIN FM200187_SHBs_P-A of FT:mat_peptide FM200187_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200188_SHBs_P-A Product feature CHAIN FM200188_SHBs_P-A of FT:mat_peptide FM200188_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHLPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200189_SHBs_P-A Product feature CHAIN FM200189_SHBs_P-A of FT:mat_peptide FM200189_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGILPVCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTAGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200193_SHBs_P-A Product feature CHAIN FM200193_SHBs_P-A of FT:mat_peptide FM200193_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPASTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200195_SHBs_P-A Product feature CHAIN FM200195_SHBs_P-A of FT:mat_peptide FM200195_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPPIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200198_SHBs_P-A Product feature CHAIN FM200198_SHBs_P-A of FT:mat_peptide FM200198_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200199_SHBs_P-A Product feature CHAIN FM200199_SHBs_P-A of FT:mat_peptide FM200199_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHLPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200201_SHBs_P-A Product feature CHAIN FM200201_SHBs_P-A of FT:mat_peptide FM200201_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200202_SHBs_P-A Product feature CHAIN FM200202_SHBs_P-A of FT:mat_peptide FM200202_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPASTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFXPLLPIFFCLWXYI
>gnl|hbvpro|FM200203_SHBs_P-A Product feature CHAIN FM200203_SHBs_P-A of FT:mat_peptide FM200203_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200204_SHBs_P-A Product feature CHAIN FM200204_SHBs_P-A of FT:mat_peptide FM200204_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPPIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200207_SHBs_P-A Product feature CHAIN FM200207_SHBs_P-A of FT:mat_peptide FM200207_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FM200214_SHBs_P-A Product feature CHAIN FM200214_SHBs_P-A of FT:mat_peptide FM200214_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKLTAGNCTCIPIPSSWAFAK
YLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200215_SHBs_P-A Product feature CHAIN FM200215_SHBs_P-A of FT:mat_peptide FM200215_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|FM200216_SHBs_P-A Product feature CHAIN FM200216_SHBs_P-A of FT:mat_peptide FM200216_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGCFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHLPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN295503_SHBs_P-A Product feature CHAIN FN295503_SHBs_P-A of FT:mat_peptide FN295503_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKACTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295508_SHBs_P-A Product feature CHAIN FN295508_SHBs_P-A of FT:mat_peptide FN295508_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMXPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295511_SHBs_P-A Product feature CHAIN FN295511_SHBs_P-A of FT:mat_peptide FN295511_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMIPSCCXTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295518_SHBs_P-A Product feature CHAIN FN295518_SHBs_P-A of FT:mat_peptide FN295518_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKSTAGNCTCIPIPSSWAFAK
YLWEWGSARFSWLSSLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFCCLWVYI
>gnl|hbvpro|FN295528_SHBs_P-A Product feature CHAIN FN295528_SHBs_P-A of FT:mat_peptide FN295528_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M38). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSXLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295530_SHBs_P-A Product feature CHAIN FN295530_SHBs_P-A of FT:mat_peptide FN295530_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295531_SHBs_P-A Product feature CHAIN FN295531_SHBs_P-A of FT:mat_peptide FN295531_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RA3_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295532_SHBs_P-A Product feature CHAIN FN295532_SHBs_P-A of FT:mat_peptide FN295532_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RA4_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295533_SHBs_P-A Product feature CHAIN FN295533_SHBs_P-A of FT:mat_peptide FN295533_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RA5_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN295534_SHBs_P-A Product feature CHAIN FN295534_SHBs_P-A of FT:mat_peptide FN295534_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RA6_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545825_SHBs_P-A Product feature CHAIN FN545825_SHBs_P-A of FT:mat_peptide FN545825_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN545826_SHBs_P-A Product feature CHAIN FN545826_SHBs_P-A of FT:mat_peptide FN545826_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|FN545828_SHBs_P-A Product feature CHAIN FN545828_SHBs_P-A of FT:mat_peptide FN545828_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILTPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545829_SHBs_P-A Product feature CHAIN FN545829_SHBs_P-A of FT:mat_peptide FN545829_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545830_SHBs_P-A Product feature CHAIN FN545830_SHBs_P-A of FT:mat_peptide FN545830_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGXLGXLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545831_SHBs_P-A Product feature CHAIN FN545831_SHBs_P-A of FT:mat_peptide FN545831_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN545832_SHBs_P-A Product feature CHAIN FN545832_SHBs_P-A of FT:mat_peptide FN545832_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXHVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545833_SHBs_P-A Product feature CHAIN FN545833_SHBs_P-A of FT:mat_peptide FN545833_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN545834_SHBs_P-A Product feature CHAIN FN545834_SHBs_P-A of FT:mat_peptide FN545834_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAX
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSXLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN545835_SHBs_P-A Product feature CHAIN FN545835_SHBs_P-A of FT:mat_peptide FN545835_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545836_SHBs_P-A Product feature CHAIN FN545836_SHBs_P-A of FT:mat_peptide FN545836_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLXDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN545837_SHBs_P-A Product feature CHAIN FN545837_SHBs_P-A of FT:mat_peptide FN545837_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGXCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWXVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545838_SHBs_P-A Product feature CHAIN FN545838_SHBs_P-A of FT:mat_peptide FN545838_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPPIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWXYI
>gnl|hbvpro|FN545839_SHBs_P-A Product feature CHAIN FN545839_SHBs_P-A of FT:mat_peptide FN545839_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSXLSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN545840_SHBs_P-A Product feature CHAIN FN545840_SHBs_P-A of FT:mat_peptide FN545840_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLNPFLLLLPIFFCLWAYI
>gnl|hbvpro|FN547157_SHBs_P-A Product feature CHAIN FN547157_SHBs_P-A of FT:mat_peptide FN547157_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FN547166_SHBs_P-A Product feature CHAIN FN547166_SHBs_P-A of FT:mat_peptide FN547166_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSMGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547216_SHBs_P-A Product feature CHAIN FN547216_SHBs_P-A of FT:mat_peptide FN547216_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547228_SHBs_P-A Product feature CHAIN FN547228_SHBs_P-A of FT:mat_peptide FN547228_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547235_SHBs_P-A Product feature CHAIN FN547235_SHBs_P-A of FT:mat_peptide FN547235_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547238_SHBs_P-A Product feature CHAIN FN547238_SHBs_P-A of FT:mat_peptide FN547238_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547244_SHBs_P-A Product feature CHAIN FN547244_SHBs_P-A of FT:mat_peptide FN547244_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547249_SHBs_P-A Product feature CHAIN FN547249_SHBs_P-A of FT:mat_peptide FN547249_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDCRGMLPVCPLIPRSTTTSTGPCRTCTIPVQGKSMFPSCCCTKPTEGNYTCIPIPLSWAFAN
YLWEWASVRFSWLSLLAPSVRWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN547273_SHBs_P-A Product feature CHAIN FN547273_SHBs_P-A of FT:mat_peptide FN547273_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGQSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547291_SHBs_P-A Product feature CHAIN FN547291_SHBs_P-A of FT:mat_peptide FN547291_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547305_SHBs_P-A Product feature CHAIN FN547305_SHBs_P-A of FT:mat_peptide FN547305_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547306_SHBs_P-A Product feature CHAIN FN547306_SHBs_P-A of FT:mat_peptide FN547306_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCRGQNSQSPTSNHSPISCPLICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGSCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN547308_SHBs_P-A Product feature CHAIN FN547308_SHBs_P-A of FT:mat_peptide FN547308_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547309_SHBs_P-A Product feature CHAIN FN547309_SHBs_P-A of FT:mat_peptide FN547309_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547312_SHBs_P-A Product feature CHAIN FN547312_SHBs_P-A of FT:mat_peptide FN547312_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547314_SHBs_P-A Product feature CHAIN FN547314_SHBs_P-A of FT:mat_peptide FN547314_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547315_SHBs_P-A Product feature CHAIN FN547315_SHBs_P-A of FT:mat_peptide FN547315_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547320_SHBs_P-A Product feature CHAIN FN547320_SHBs_P-A of FT:mat_peptide FN547320_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547321_SHBs_P-A Product feature CHAIN FN547321_SHBs_P-A of FT:mat_peptide FN547321_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547322_SHBs_P-A Product feature CHAIN FN547322_SHBs_P-A of FT:mat_peptide FN547322_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547324_SHBs_P-A Product feature CHAIN FN547324_SHBs_P-A of FT:mat_peptide FN547324_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSELLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSLTSKHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN547325_SHBs_P-A Product feature CHAIN FN547325_SHBs_P-A of FT:mat_peptide FN547325_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547326_SHBs_P-A Product feature CHAIN FN547326_SHBs_P-A of FT:mat_peptide FN547326_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547327_SHBs_P-A Product feature CHAIN FN547327_SHBs_P-A of FT:mat_peptide FN547327_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547328_SHBs_P-A Product feature CHAIN FN547328_SHBs_P-A of FT:mat_peptide FN547328_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547329_SHBs_P-A Product feature CHAIN FN547329_SHBs_P-A of FT:mat_peptide FN547329_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547330_SHBs_P-A Product feature CHAIN FN547330_SHBs_P-A of FT:mat_peptide FN547330_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547331_SHBs_P-A Product feature CHAIN FN547331_SHBs_P-A of FT:mat_peptide FN547331_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547334_SHBs_P-A Product feature CHAIN FN547334_SHBs_P-A of FT:mat_peptide FN547334_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSLVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN547335_SHBs_P-A Product feature CHAIN FN547335_SHBs_P-A of FT:mat_peptide FN547335_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547336_SHBs_P-A Product feature CHAIN FN547336_SHBs_P-A of FT:mat_peptide FN547336_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|FN547338_SHBs_P-A Product feature CHAIN FN547338_SHBs_P-A of FT:mat_peptide FN547338_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPPIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547340_SHBs_P-A Product feature CHAIN FN547340_SHBs_P-A of FT:mat_peptide FN547340_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|FN547341_SHBs_P-A Product feature CHAIN FN547341_SHBs_P-A of FT:mat_peptide FN547341_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547342_SHBs_P-A Product feature CHAIN FN547342_SHBs_P-A of FT:mat_peptide FN547342_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547343_SHBs_P-A Product feature CHAIN FN547343_SHBs_P-A of FT:mat_peptide FN547343_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLXIFFCLWVYI
>gnl|hbvpro|FN547344_SHBs_P-A Product feature CHAIN FN547344_SHBs_P-A of FT:mat_peptide FN547344_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLXNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FN547346_SHBs_P-A Product feature CHAIN FN547346_SHBs_P-A of FT:mat_peptide FN547346_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPPIPGSTTTSTGPCRTCTTPAQGNFMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547348_SHBs_P-A Product feature CHAIN FN547348_SHBs_P-A of FT:mat_peptide FN547348_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHLPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFSCLWAYI
>gnl|hbvpro|FN547349_SHBs_P-A Product feature CHAIN FN547349_SHBs_P-A of FT:mat_peptide FN547349_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPASTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547352_SHBs_P-A Product feature CHAIN FN547352_SHBs_P-A of FT:mat_peptide FN547352_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHLPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTRPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|FN547355_SHBs_P-A Product feature CHAIN FN547355_SHBs_P-A of FT:mat_peptide FN547355_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLLIFFCLWAYI
>gnl|hbvpro|FN547360_SHBs_P-A Product feature CHAIN FN547360_SHBs_P-A of FT:mat_peptide FN547360_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSAIWMMWYWGPSLYNILSPFIPLLXIFFCLWAYI
>gnl|hbvpro|FN547363_SHBs_P-A Product feature CHAIN FN547363_SHBs_P-A of FT:mat_peptide FN547363_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVPPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FN547364_SHBs_P-A Product feature CHAIN FN547364_SHBs_P-A of FT:mat_peptide FN547364_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FR821988_SHBs_P-A Product feature CHAIN FR821988_SHBs_P-A of FT:mat_peptide FR821988_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|FR821989_SHBs_P-A Product feature CHAIN FR821989_SHBs_P-A of FT:mat_peptide FR821989_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDHQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|FR821990_SHBs_P-A Product feature CHAIN FR821990_SHBs_P-A of FT:mat_peptide FR821990_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCYTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|FR821991_SHBs_P-A Product feature CHAIN FR821991_SHBs_P-A of FT:mat_peptide FR821991_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|FR821992_SHBs_P-A Product feature CHAIN FR821992_SHBs_P-A of FT:mat_peptide FR821992_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQSNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYD
>gnl|hbvpro|FR821993_SHBs_P-A Product feature CHAIN FR821993_SHBs_P-A of FT:mat_peptide FR821993_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCLPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|FR821994_SHBs_P-A Product feature CHAIN FR821994_SHBs_P-A of FT:mat_peptide FR821994_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSHTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|GQ161813_SHBs_P-A Product feature CHAIN GQ161813_SHBs_P-A of FT:mat_peptide GQ161813_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ184323_SHBs_P-A Product feature CHAIN GQ184323_SHBs_P-A of FT:mat_peptide GQ184323_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTFFHCLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ184324_SHBs_P-A Product feature CHAIN GQ184324_SHBs_P-A of FT:mat_peptide GQ184324_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFFLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ222207_SHBs_P-A Product feature CHAIN GQ222207_SHBs_P-A of FT:mat_peptide GQ222207_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1123). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325764_SHBs_P-A Product feature CHAIN GQ325764_SHBs_P-A of FT:mat_peptide GQ325764_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1329-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325765_SHBs_P-A Product feature CHAIN GQ325765_SHBs_P-A of FT:mat_peptide GQ325765_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1329-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325766_SHBs_P-A Product feature CHAIN GQ325766_SHBs_P-A of FT:mat_peptide GQ325766_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16375-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLXXILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFXLVLLDYXGILPVCPXIPGSTTTSTGPCXTCTTPAQGXSMFPSCCCTKPTDGNCTCIPIPXSWAFAK
YLWXXAXVRFSWLSSLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325767_SHBs_P-A Product feature CHAIN GQ325767_SHBs_P-A of FT:mat_peptide GQ325767_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16375-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLXKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGILPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAK
YLWDLXLVRFSWLSSLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325768_SHBs_P-A Product feature CHAIN GQ325768_SHBs_P-A of FT:mat_peptide GQ325768_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16375-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLXKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGILPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAK
YLWDLXLVRFSWLSSLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325775_SHBs_P-A Product feature CHAIN GQ325775_SHBs_P-A of FT:mat_peptide GQ325775_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 7774-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCXTPAQGNSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325776_SHBs_P-A Product feature CHAIN GQ325776_SHBs_P-A of FT:mat_peptide GQ325776_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 7774-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPSLYSIVSPFIPLLPIFXCLWVYI
>gnl|hbvpro|GQ325786_SHBs_P-A Product feature CHAIN GQ325786_SHBs_P-A of FT:mat_peptide GQ325786_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ325792_SHBs_P-A Product feature CHAIN GQ325792_SHBs_P-A of FT:mat_peptide GQ325792_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GB1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFGK
YLWEWASVRFSWLXLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ331046_SHBs_P-A Product feature CHAIN GQ331046_SHBs_P-A of FT:mat_peptide GQ331046_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ331047_SHBs_P-A Product feature CHAIN GQ331047_SHBs_P-A of FT:mat_peptide GQ331047_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ414522_SHBs_P-A Product feature CHAIN GQ414522_SHBs_P-A of FT:mat_peptide GQ414522_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477461_SHBs_P-A Product feature CHAIN GQ477461_SHBs_P-A of FT:mat_peptide GQ477461_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477462_SHBs_P-A Product feature CHAIN GQ477462_SHBs_P-A of FT:mat_peptide GQ477462_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWFWGPSLYNIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477463_SHBs_P-A Product feature CHAIN GQ477463_SHBs_P-A of FT:mat_peptide GQ477463_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477464_SHBs_P-A Product feature CHAIN GQ477464_SHBs_P-A of FT:mat_peptide GQ477464_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477465_SHBs_P-A Product feature CHAIN GQ477465_SHBs_P-A of FT:mat_peptide GQ477465_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGHSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477466_SHBs_P-A Product feature CHAIN GQ477466_SHBs_P-A of FT:mat_peptide GQ477466_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477467_SHBs_P-A Product feature CHAIN GQ477467_SHBs_P-A of FT:mat_peptide GQ477467_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477468_SHBs_P-A Product feature CHAIN GQ477468_SHBs_P-A of FT:mat_peptide GQ477468_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQSNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477469_SHBs_P-A Product feature CHAIN GQ477469_SHBs_P-A of FT:mat_peptide GQ477469_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGIPVCHGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477472_SHBs_P-A Product feature CHAIN GQ477472_SHBs_P-A of FT:mat_peptide GQ477472_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477473_SHBs_P-A Product feature CHAIN GQ477473_SHBs_P-A of FT:mat_peptide GQ477473_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGVPPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLCSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477475_SHBs_P-A Product feature CHAIN GQ477475_SHBs_P-A of FT:mat_peptide GQ477475_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLCNIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477477_SHBs_P-A Product feature CHAIN GQ477477_SHBs_P-A of FT:mat_peptide GQ477477_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=226 residues).
RENITSGFLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLPCLIFLLVLLDYQGILPVCPLIPGATTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477478_SHBs_P-A Product feature CHAIN GQ477478_SHBs_P-A of FT:mat_peptide GQ477478_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTIPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477479_SHBs_P-A Product feature CHAIN GQ477479_SHBs_P-A of FT:mat_peptide GQ477479_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477480_SHBs_P-A Product feature CHAIN GQ477480_SHBs_P-A of FT:mat_peptide GQ477480_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477482_SHBs_P-A Product feature CHAIN GQ477482_SHBs_P-A of FT:mat_peptide GQ477482_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477484_SHBs_P-A Product feature CHAIN GQ477484_SHBs_P-A of FT:mat_peptide GQ477484_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477486_SHBs_P-A Product feature CHAIN GQ477486_SHBs_P-A of FT:mat_peptide GQ477486_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477487_SHBs_P-A Product feature CHAIN GQ477487_SHBs_P-A of FT:mat_peptide GQ477487_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477488_SHBs_P-A Product feature CHAIN GQ477488_SHBs_P-A of FT:mat_peptide GQ477488_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQSSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477490_SHBs_P-A Product feature CHAIN GQ477490_SHBs_P-A of FT:mat_peptide GQ477490_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGVLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYSTVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477491_SHBs_P-A Product feature CHAIN GQ477491_SHBs_P-A of FT:mat_peptide GQ477491_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477493_SHBs_P-A Product feature CHAIN GQ477493_SHBs_P-A of FT:mat_peptide GQ477493_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLEPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSHVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSLFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477494_SHBs_P-A Product feature CHAIN GQ477494_SHBs_P-A of FT:mat_peptide GQ477494_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P80). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMILYWGPSLYNIVSPFIPLLPIFFCLWVFI
>gnl|hbvpro|GQ477495_SHBs_P-A Product feature CHAIN GQ477495_SHBs_P-A of FT:mat_peptide GQ477495_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQNSSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477496_SHBs_P-A Product feature CHAIN GQ477496_SHBs_P-A of FT:mat_peptide GQ477496_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477497_SHBs_P-A Product feature CHAIN GQ477497_SHBs_P-A of FT:mat_peptide GQ477497_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVRPFIPLLPIFLCLWVYI
>gnl|hbvpro|GQ477498_SHBs_P-A Product feature CHAIN GQ477498_SHBs_P-A of FT:mat_peptide GQ477498_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477500_SHBs_P-A Product feature CHAIN GQ477500_SHBs_P-A of FT:mat_peptide GQ477500_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGILRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477501_SHBs_P-A Product feature CHAIN GQ477501_SHBs_P-A of FT:mat_peptide GQ477501_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477502_SHBs_P-A Product feature CHAIN GQ477502_SHBs_P-A of FT:mat_peptide GQ477502_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLSFLGETPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPHLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477503_SHBs_P-A Product feature CHAIN GQ477503_SHBs_P-A of FT:mat_peptide GQ477503_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ477504_SHBs_P-A Product feature CHAIN GQ477504_SHBs_P-A of FT:mat_peptide GQ477504_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVRHFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486062_SHBs_P-A Product feature CHAIN GQ486062_SHBs_P-A of FT:mat_peptide GQ486062_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486063_SHBs_P-A Product feature CHAIN GQ486063_SHBs_P-A of FT:mat_peptide GQ486063_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS28). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGXCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486076_SHBs_P-A Product feature CHAIN GQ486076_SHBs_P-A of FT:mat_peptide GQ486076_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS41). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486077_SHBs_P-A Product feature CHAIN GQ486077_SHBs_P-A of FT:mat_peptide GQ486077_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS42). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGXAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486092_SHBs_P-A Product feature CHAIN GQ486092_SHBs_P-A of FT:mat_peptide GQ486092_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS57). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIXYWGPSLYNILSPFIPLLXIFFCLWVYI
>gnl|hbvpro|GQ486101_SHBs_P-A Product feature CHAIN GQ486101_SHBs_P-A of FT:mat_peptide GQ486101_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS66). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486103_SHBs_P-A Product feature CHAIN GQ486103_SHBs_P-A of FT:mat_peptide GQ486103_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS68). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFXGLSPTXWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486104_SHBs_P-A Product feature CHAIN GQ486104_SHBs_P-A of FT:mat_peptide GQ486104_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS69). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXAIWMMWYWGPNLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486119_SHBs_P-A Product feature CHAIN GQ486119_SHBs_P-A of FT:mat_peptide GQ486119_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS84). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486120_SHBs_P-A Product feature CHAIN GQ486120_SHBs_P-A of FT:mat_peptide GQ486120_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS85). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYXWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWXWASVRFSWLSXLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486130_SHBs_P-A Product feature CHAIN GQ486130_SHBs_P-A of FT:mat_peptide GQ486130_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS95). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQXNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWXLAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486139_SHBs_P-A Product feature CHAIN GQ486139_SHBs_P-A of FT:mat_peptide GQ486139_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS104). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGPCXTCXTPAQGNSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486143_SHBs_P-A Product feature CHAIN GQ486143_SHBs_P-A of FT:mat_peptide GQ486143_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS108). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486148_SHBs_P-A Product feature CHAIN GQ486148_SHBs_P-A of FT:mat_peptide GQ486148_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS113). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGXSPTVWLLAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486156_SHBs_P-A Product feature CHAIN GQ486156_SHBs_P-A of FT:mat_peptide GQ486156_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS121). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQXNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLXNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486165_SHBs_P-A Product feature CHAIN GQ486165_SHBs_P-A of FT:mat_peptide GQ486165_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS130). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQXPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGXSPTVWLSAIWMMWYWGPXLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486182_SHBs_P-A Product feature CHAIN GQ486182_SHBs_P-A of FT:mat_peptide GQ486182_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS147). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWYWGPNLYXIXRPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486192_SHBs_P-A Product feature CHAIN GQ486192_SHBs_P-A of FT:mat_peptide GQ486192_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS157). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSXVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXXWXLAIWMMWYWGXXXYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486194_SHBs_P-A Product feature CHAIN GQ486194_SHBs_P-A of FT:mat_peptide GQ486194_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS159). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486197_SHBs_P-A Product feature CHAIN GQ486197_SHBs_P-A of FT:mat_peptide GQ486197_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS162). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486198_SHBs_P-A Product feature CHAIN GQ486198_SHBs_P-A of FT:mat_peptide GQ486198_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS163). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTXAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486203_SHBs_P-A Product feature CHAIN GQ486203_SHBs_P-A of FT:mat_peptide GQ486203_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS168). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486205_SHBs_P-A Product feature CHAIN GQ486205_SHBs_P-A of FT:mat_peptide GQ486205_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS170). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTXWLSXIWMMWYWGPXLYSIVRPFXPLXPIFFCLWVYI
>gnl|hbvpro|GQ486209_SHBs_P-A Product feature CHAIN GQ486209_SHBs_P-A of FT:mat_peptide GQ486209_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS174). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMILYWGPXLYXIVSPFIPLLPIFFCLWVXI
>gnl|hbvpro|GQ486213_SHBs_P-A Product feature CHAIN GQ486213_SHBs_P-A of FT:mat_peptide GQ486213_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS178). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTPAQXNSXXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWXSVRFSWLSLLVPFVQWFVGLSPTVWLXAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486225_SHBs_P-A Product feature CHAIN GQ486225_SHBs_P-A of FT:mat_peptide GQ486225_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS190). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLXSIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486232_SHBs_P-A Product feature CHAIN GQ486232_SHBs_P-A of FT:mat_peptide GQ486232_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS197). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWXSVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYXIXXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486249_SHBs_P-A Product feature CHAIN GQ486249_SHBs_P-A of FT:mat_peptide GQ486249_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS214). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGXLLVLQAGFFLLTRILTIPQSLDSWWTSLSXLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXXIWMMWYWGPSLYXIXSPFIPLLXIFFCLWVYI
>gnl|hbvpro|GQ486253_SHBs_P-A Product feature CHAIN GQ486253_SHBs_P-A of FT:mat_peptide GQ486253_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS218). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMXPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPXLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486271_SHBs_P-A Product feature CHAIN GQ486271_SHBs_P-A of FT:mat_peptide GQ486271_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS236). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLXVYI
>gnl|hbvpro|GQ486287_SHBs_P-A Product feature CHAIN GQ486287_SHBs_P-A of FT:mat_peptide GQ486287_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS252). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQXPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486306_SHBs_P-A Product feature CHAIN GQ486306_SHBs_P-A of FT:mat_peptide GQ486306_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS271). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGAPGCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTXWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486309_SHBs_P-A Product feature CHAIN GQ486309_SHBs_P-A of FT:mat_peptide GQ486309_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS274). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXXVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGPCXTCXTPAQGNSMXPSCCCTKPXDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMILYWGPSLYXIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486312_SHBs_P-A Product feature CHAIN GQ486312_SHBs_P-A of FT:mat_peptide GQ486312_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS277). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486317_SHBs_P-A Product feature CHAIN GQ486317_SHBs_P-A of FT:mat_peptide GQ486317_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS282). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDXNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486360_SHBs_P-A Product feature CHAIN GQ486360_SHBs_P-A of FT:mat_peptide GQ486360_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS325). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486368_SHBs_P-A Product feature CHAIN GQ486368_SHBs_P-A of FT:mat_peptide GQ486368_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS333). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTXNHSPTSCPPICPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNTLTPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486369_SHBs_P-A Product feature CHAIN GQ486369_SHBs_P-A of FT:mat_peptide GQ486369_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS334). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQXXSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIXMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486389_SHBs_P-A Product feature CHAIN GQ486389_SHBs_P-A of FT:mat_peptide GQ486389_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS354). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPXQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYNTVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486391_SHBs_P-A Product feature CHAIN GQ486391_SHBs_P-A of FT:mat_peptide GQ486391_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS356). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGSTVCPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGXCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486408_SHBs_P-A Product feature CHAIN GQ486408_SHBs_P-A of FT:mat_peptide GQ486408_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS373). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486409_SHBs_P-A Product feature CHAIN GQ486409_SHBs_P-A of FT:mat_peptide GQ486409_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS374). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486410_SHBs_P-A Product feature CHAIN GQ486410_SHBs_P-A of FT:mat_peptide GQ486410_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS375). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486415_SHBs_P-A Product feature CHAIN GQ486415_SHBs_P-A of FT:mat_peptide GQ486415_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS380). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCXTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXXMMWYWGPSLYSIVXPFIPLLPIFLCLWVYI
>gnl|hbvpro|GQ486416_SHBs_P-A Product feature CHAIN GQ486416_SHBs_P-A of FT:mat_peptide GQ486416_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS381). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486417_SHBs_P-A Product feature CHAIN GQ486417_SHBs_P-A of FT:mat_peptide GQ486417_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS382). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486419_SHBs_P-A Product feature CHAIN GQ486419_SHBs_P-A of FT:mat_peptide GQ486419_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS384). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486421_SHBs_P-A Product feature CHAIN GQ486421_SHBs_P-A of FT:mat_peptide GQ486421_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS386). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCXTPAQGNSMFXSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486424_SHBs_P-A Product feature CHAIN GQ486424_SHBs_P-A of FT:mat_peptide GQ486424_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS389). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGXCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486425_SHBs_P-A Product feature CHAIN GQ486425_SHBs_P-A of FT:mat_peptide GQ486425_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS390). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLXYQGMLPVCPLIPGSTTTSTGPCKTCTXPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486426_SHBs_P-A Product feature CHAIN GQ486426_SHBs_P-A of FT:mat_peptide GQ486426_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS391). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486427_SHBs_P-A Product feature CHAIN GQ486427_SHBs_P-A of FT:mat_peptide GQ486427_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS392). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCXTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486437_SHBs_P-A Product feature CHAIN GQ486437_SHBs_P-A of FT:mat_peptide GQ486437_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS402). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGXCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFGK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486438_SHBs_P-A Product feature CHAIN GQ486438_SHBs_P-A of FT:mat_peptide GQ486438_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS403). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486439_SHBs_P-A Product feature CHAIN GQ486439_SHBs_P-A of FT:mat_peptide GQ486439_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS404). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486441_SHBs_P-A Product feature CHAIN GQ486441_SHBs_P-A of FT:mat_peptide GQ486441_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS406). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSAIWMXXYWGPXLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486445_SHBs_P-A Product feature CHAIN GQ486445_SHBs_P-A of FT:mat_peptide GQ486445_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS410). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486454_SHBs_P-A Product feature CHAIN GQ486454_SHBs_P-A of FT:mat_peptide GQ486454_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS419). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486456_SHBs_P-A Product feature CHAIN GQ486456_SHBs_P-A of FT:mat_peptide GQ486456_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS421). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFXCLWVYI
>gnl|hbvpro|GQ486461_SHBs_P-A Product feature CHAIN GQ486461_SHBs_P-A of FT:mat_peptide GQ486461_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS426). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486469_SHBs_P-A Product feature CHAIN GQ486469_SHBs_P-A of FT:mat_peptide GQ486469_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS434). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486474_SHBs_P-A Product feature CHAIN GQ486474_SHBs_P-A of FT:mat_peptide GQ486474_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS439). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSKTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486478_SHBs_P-A Product feature CHAIN GQ486478_SHBs_P-A of FT:mat_peptide GQ486478_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS443). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486479_SHBs_P-A Product feature CHAIN GQ486479_SHBs_P-A of FT:mat_peptide GQ486479_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS444). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486482_SHBs_P-A Product feature CHAIN GQ486482_SHBs_P-A of FT:mat_peptide GQ486482_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS447). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486490_SHBs_P-A Product feature CHAIN GQ486490_SHBs_P-A of FT:mat_peptide GQ486490_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS455). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486510_SHBs_P-A Product feature CHAIN GQ486510_SHBs_P-A of FT:mat_peptide GQ486510_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS475). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486514_SHBs_P-A Product feature CHAIN GQ486514_SHBs_P-A of FT:mat_peptide GQ486514_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS479). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFLCLWVYI
>gnl|hbvpro|GQ486529_SHBs_P-A Product feature CHAIN GQ486529_SHBs_P-A of FT:mat_peptide GQ486529_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS494). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTXPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPXLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486531_SHBs_P-A Product feature CHAIN GQ486531_SHBs_P-A of FT:mat_peptide GQ486531_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS496). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486532_SHBs_P-A Product feature CHAIN GQ486532_SHBs_P-A of FT:mat_peptide GQ486532_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS497). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTXPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPXLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486535_SHBs_P-A Product feature CHAIN GQ486535_SHBs_P-A of FT:mat_peptide GQ486535_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS500). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSXGXCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486544_SHBs_P-A Product feature CHAIN GQ486544_SHBs_P-A of FT:mat_peptide GQ486544_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS509). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486549_SHBs_P-A Product feature CHAIN GQ486549_SHBs_P-A of FT:mat_peptide GQ486549_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS514). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGXCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486550_SHBs_P-A Product feature CHAIN GQ486550_SHBs_P-A of FT:mat_peptide GQ486550_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS515). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486556_SHBs_P-A Product feature CHAIN GQ486556_SHBs_P-A of FT:mat_peptide GQ486556_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS521). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCXTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMXWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486557_SHBs_P-A Product feature CHAIN GQ486557_SHBs_P-A of FT:mat_peptide GQ486557_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS522). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMXWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486560_SHBs_P-A Product feature CHAIN GQ486560_SHBs_P-A of FT:mat_peptide GQ486560_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS525). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQXGFXLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNXSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTXTXPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXAIWMXXYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486563_SHBs_P-A Product feature CHAIN GQ486563_SHBs_P-A of FT:mat_peptide GQ486563_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS528). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGXCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQXFVGXSPXVWLSAIWMMWYWGPXLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486564_SHBs_P-A Product feature CHAIN GQ486564_SHBs_P-A of FT:mat_peptide GQ486564_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS529). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486567_SHBs_P-A Product feature CHAIN GQ486567_SHBs_P-A of FT:mat_peptide GQ486567_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS532). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCXPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTXPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486568_SHBs_P-A Product feature CHAIN GQ486568_SHBs_P-A of FT:mat_peptide GQ486568_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS533). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486571_SHBs_P-A Product feature CHAIN GQ486571_SHBs_P-A of FT:mat_peptide GQ486571_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS536). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486580_SHBs_P-A Product feature CHAIN GQ486580_SHBs_P-A of FT:mat_peptide GQ486580_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS545). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486583_SHBs_P-A Product feature CHAIN GQ486583_SHBs_P-A of FT:mat_peptide GQ486583_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS548). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENXTSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486587_SHBs_P-A Product feature CHAIN GQ486587_SHBs_P-A of FT:mat_peptide GQ486587_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS552). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486597_SHBs_P-A Product feature CHAIN GQ486597_SHBs_P-A of FT:mat_peptide GQ486597_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS562). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486598_SHBs_P-A Product feature CHAIN GQ486598_SHBs_P-A of FT:mat_peptide GQ486598_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS563). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGPCKTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486599_SHBs_P-A Product feature CHAIN GQ486599_SHBs_P-A of FT:mat_peptide GQ486599_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS564). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486601_SHBs_P-A Product feature CHAIN GQ486601_SHBs_P-A of FT:mat_peptide GQ486601_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS566). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486603_SHBs_P-A Product feature CHAIN GQ486603_SHBs_P-A of FT:mat_peptide GQ486603_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS568). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486611_SHBs_P-A Product feature CHAIN GQ486611_SHBs_P-A of FT:mat_peptide GQ486611_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS576). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQXMLPVCPXIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486615_SHBs_P-A Product feature CHAIN GQ486615_SHBs_P-A of FT:mat_peptide GQ486615_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS580). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486616_SHBs_P-A Product feature CHAIN GQ486616_SHBs_P-A of FT:mat_peptide GQ486616_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS581). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486631_SHBs_P-A Product feature CHAIN GQ486631_SHBs_P-A of FT:mat_peptide GQ486631_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS596). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486642_SHBs_P-A Product feature CHAIN GQ486642_SHBs_P-A of FT:mat_peptide GQ486642_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS607). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFXGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486646_SHBs_P-A Product feature CHAIN GQ486646_SHBs_P-A of FT:mat_peptide GQ486646_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS611). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPXICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486663_SHBs_P-A Product feature CHAIN GQ486663_SHBs_P-A of FT:mat_peptide GQ486663_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS628). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486668_SHBs_P-A Product feature CHAIN GQ486668_SHBs_P-A of FT:mat_peptide GQ486668_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS633). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486669_SHBs_P-A Product feature CHAIN GQ486669_SHBs_P-A of FT:mat_peptide GQ486669_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS634). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486677_SHBs_P-A Product feature CHAIN GQ486677_SHBs_P-A of FT:mat_peptide GQ486677_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS642). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSXTTSTGPCKTCTTPAQGNSMFPSCCCTKPXDXNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486683_SHBs_P-A Product feature CHAIN GQ486683_SHBs_P-A of FT:mat_peptide GQ486683_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS648). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYXIVSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|GQ486686_SHBs_P-A Product feature CHAIN GQ486686_SHBs_P-A of FT:mat_peptide GQ486686_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS651). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDXNCTCIPIPSSWAFGK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486691_SHBs_P-A Product feature CHAIN GQ486691_SHBs_P-A of FT:mat_peptide GQ486691_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS656). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQXPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486693_SHBs_P-A Product feature CHAIN GQ486693_SHBs_P-A of FT:mat_peptide GQ486693_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS658). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486694_SHBs_P-A Product feature CHAIN GQ486694_SHBs_P-A of FT:mat_peptide GQ486694_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS659). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPGCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGXSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486697_SHBs_P-A Product feature CHAIN GQ486697_SHBs_P-A of FT:mat_peptide GQ486697_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS662). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486710_SHBs_P-A Product feature CHAIN GQ486710_SHBs_P-A of FT:mat_peptide GQ486710_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS675). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486712_SHBs_P-A Product feature CHAIN GQ486712_SHBs_P-A of FT:mat_peptide GQ486712_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS677). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486714_SHBs_P-A Product feature CHAIN GQ486714_SHBs_P-A of FT:mat_peptide GQ486714_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS679). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486718_SHBs_P-A Product feature CHAIN GQ486718_SHBs_P-A of FT:mat_peptide GQ486718_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS683). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486721_SHBs_P-A Product feature CHAIN GQ486721_SHBs_P-A of FT:mat_peptide GQ486721_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS686). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXXVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486725_SHBs_P-A Product feature CHAIN GQ486725_SHBs_P-A of FT:mat_peptide GQ486725_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS690). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486727_SHBs_P-A Product feature CHAIN GQ486727_SHBs_P-A of FT:mat_peptide GQ486727_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486741_SHBs_P-A Product feature CHAIN GQ486741_SHBs_P-A of FT:mat_peptide GQ486741_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS706). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486747_SHBs_P-A Product feature CHAIN GQ486747_SHBs_P-A of FT:mat_peptide GQ486747_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS712). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVFI
>gnl|hbvpro|GQ486751_SHBs_P-A Product feature CHAIN GQ486751_SHBs_P-A of FT:mat_peptide GQ486751_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS716). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486754_SHBs_P-A Product feature CHAIN GQ486754_SHBs_P-A of FT:mat_peptide GQ486754_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS719). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486770_SHBs_P-A Product feature CHAIN GQ486770_SHBs_P-A of FT:mat_peptide GQ486770_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS735). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGXPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYXGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSAIWMMWYWGPXLYXILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486772_SHBs_P-A Product feature CHAIN GQ486772_SHBs_P-A of FT:mat_peptide GQ486772_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS737). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486775_SHBs_P-A Product feature CHAIN GQ486775_SHBs_P-A of FT:mat_peptide GQ486775_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS740). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXWSPFIPLLXIFFCLWXYI
>gnl|hbvpro|GQ486776_SHBs_P-A Product feature CHAIN GQ486776_SHBs_P-A of FT:mat_peptide GQ486776_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS741). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486782_SHBs_P-A Product feature CHAIN GQ486782_SHBs_P-A of FT:mat_peptide GQ486782_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS747). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIXGSTTTSTGPCKXCXTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486807_SHBs_P-A Product feature CHAIN GQ486807_SHBs_P-A of FT:mat_peptide GQ486807_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS772). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLXEXASVRFSXLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486813_SHBs_P-A Product feature CHAIN GQ486813_SHBs_P-A of FT:mat_peptide GQ486813_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS778). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSAILMILYWGPSLYXIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486828_SHBs_P-A Product feature CHAIN GQ486828_SHBs_P-A of FT:mat_peptide GQ486828_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS793). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLXPIFFCLWVYI
>gnl|hbvpro|GQ486829_SHBs_P-A Product feature CHAIN GQ486829_SHBs_P-A of FT:mat_peptide GQ486829_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS794). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486834_SHBs_P-A Product feature CHAIN GQ486834_SHBs_P-A of FT:mat_peptide GQ486834_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS799). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486836_SHBs_P-A Product feature CHAIN GQ486836_SHBs_P-A of FT:mat_peptide GQ486836_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS801). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486838_SHBs_P-A Product feature CHAIN GQ486838_SHBs_P-A of FT:mat_peptide GQ486838_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS803). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTXNHSPTSCPPICPGYRWMCLRRF
IIXLFILLXCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQNNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWFWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486840_SHBs_P-A Product feature CHAIN GQ486840_SHBs_P-A of FT:mat_peptide GQ486840_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS805). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENXTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASXRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486853_SHBs_P-A Product feature CHAIN GQ486853_SHBs_P-A of FT:mat_peptide GQ486853_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS818). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQXXSTFPSCCCTKPTXGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWYWGPSLYSIVRPFIPLXPIFFCLWVYI
>gnl|hbvpro|GQ486856_SHBs_P-A Product feature CHAIN GQ486856_SHBs_P-A of FT:mat_peptide GQ486856_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS821). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486857_SHBs_P-A Product feature CHAIN GQ486857_SHBs_P-A of FT:mat_peptide GQ486857_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS822). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWLTSLSFLGESPVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563545_SHBs_P-A Product feature CHAIN GU563545_SHBs_P-A of FT:mat_peptide GU563545_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563546_SHBs_P-A Product feature CHAIN GU563546_SHBs_P-A of FT:mat_peptide GU563546_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563547_SHBs_P-A Product feature CHAIN GU563547_SHBs_P-A of FT:mat_peptide GU563547_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563548_SHBs_P-A Product feature CHAIN GU563548_SHBs_P-A of FT:mat_peptide GU563548_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563550_SHBs_P-A Product feature CHAIN GU563550_SHBs_P-A of FT:mat_peptide GU563550_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563551_SHBs_P-A Product feature CHAIN GU563551_SHBs_P-A of FT:mat_peptide GU563551_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-124). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563553_SHBs_P-A Product feature CHAIN GU563553_SHBs_P-A of FT:mat_peptide GU563553_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563554_SHBs_P-A Product feature CHAIN GU563554_SHBs_P-A of FT:mat_peptide GU563554_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563555_SHBs_P-A Product feature CHAIN GU563555_SHBs_P-A of FT:mat_peptide GU563555_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563557_SHBs_P-A Product feature CHAIN GU563557_SHBs_P-A of FT:mat_peptide GU563557_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563558_SHBs_P-A Product feature CHAIN GU563558_SHBs_P-A of FT:mat_peptide GU563558_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU563562_SHBs_P-A Product feature CHAIN GU563562_SHBs_P-A of FT:mat_peptide GU563562_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU798964_SHBs_P-A Product feature CHAIN GU798964_SHBs_P-A of FT:mat_peptide GU798964_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_479). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU798976_SHBs_P-A Product feature CHAIN GU798976_SHBs_P-A of FT:mat_peptide GU798976_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_1186). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU798978_SHBs_P-A Product feature CHAIN GU798978_SHBs_P-A of FT:mat_peptide GU798978_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_1196). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU798993_SHBs_P-A Product feature CHAIN GU798993_SHBs_P-A of FT:mat_peptide GU798993_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_1756). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU798998_SHBs_P-A Product feature CHAIN GU798998_SHBs_P-A of FT:mat_peptide GU798998_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_2006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWCVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799004_SHBs_P-A Product feature CHAIN GU799004_SHBs_P-A of FT:mat_peptide GU799004_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_1426). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799009_SHBs_P-A Product feature CHAIN GU799009_SHBs_P-A of FT:mat_peptide GU799009_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_1071). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799020_SHBs_P-A Product feature CHAIN GU799020_SHBs_P-A of FT:mat_peptide GU799020_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H_247). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799025_SHBs_P-A Product feature CHAIN GU799025_SHBs_P-A of FT:mat_peptide GU799025_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H_1000). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQSNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799030_SHBs_P-A Product feature CHAIN GU799030_SHBs_P-A of FT:mat_peptide GU799030_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H_1319). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799039_SHBs_P-A Product feature CHAIN GU799039_SHBs_P-A of FT:mat_peptide GU799039_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_265). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAXXNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFXCLWVYI
>gnl|hbvpro|GU799040_SHBs_P-A Product feature CHAIN GU799040_SHBs_P-A of FT:mat_peptide GU799040_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H_616). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799047_SHBs_P-A Product feature CHAIN GU799047_SHBs_P-A of FT:mat_peptide GU799047_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H_746). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799052_SHBs_P-A Product feature CHAIN GU799052_SHBs_P-A of FT:mat_peptide GU799052_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H_782). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPISCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE576988_SHBs_P-A Product feature CHAIN HE576988_SHBs_P-A of FT:mat_peptide HE576988_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTEGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE576989_SHBs_P-A Product feature CHAIN HE576989_SHBs_P-A of FT:mat_peptide HE576989_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTEGNCTCIPIPLSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE652704_SHBs_P-A Product feature CHAIN HE652704_SHBs_P-A of FT:mat_peptide HE652704_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLDQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652705_SHBs_P-A Product feature CHAIN HE652705_SHBs_P-A of FT:mat_peptide HE652705_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLILGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652707_SHBs_P-A Product feature CHAIN HE652707_SHBs_P-A of FT:mat_peptide HE652707_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSSPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCACIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652708_SHBs_P-A Product feature CHAIN HE652708_SHBs_P-A of FT:mat_peptide HE652708_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLSVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652709_SHBs_P-A Product feature CHAIN HE652709_SHBs_P-A of FT:mat_peptide HE652709_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652710_SHBs_P-A Product feature CHAIN HE652710_SHBs_P-A of FT:mat_peptide HE652710_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652711_SHBs_P-A Product feature CHAIN HE652711_SHBs_P-A of FT:mat_peptide HE652711_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDHQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSRCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652712_SHBs_P-A Product feature CHAIN HE652712_SHBs_P-A of FT:mat_peptide HE652712_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652713_SHBs_P-A Product feature CHAIN HE652713_SHBs_P-A of FT:mat_peptide HE652713_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652715_SHBs_P-A Product feature CHAIN HE652715_SHBs_P-A of FT:mat_peptide HE652715_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652716_SHBs_P-A Product feature CHAIN HE652716_SHBs_P-A of FT:mat_peptide HE652716_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRACTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE652718_SHBs_P-A Product feature CHAIN HE652718_SHBs_P-A of FT:mat_peptide HE652718_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYN
>gnl|hbvpro|HE981728_SHBs_P-A Product feature CHAIN HE981728_SHBs_P-A of FT:mat_peptide HE981728_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CU002). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWXWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|HE981729_SHBs_P-A Product feature CHAIN HE981729_SHBs_P-A of FT:mat_peptide HE981729_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CU055). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM011485_SHBs_P-A Product feature CHAIN HM011485_SHBs_P-A of FT:mat_peptide HM011485_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSAIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101113_SHBs_P-A Product feature CHAIN HM101113_SHBs_P-A of FT:mat_peptide HM101113_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101114_SHBs_P-A Product feature CHAIN HM101114_SHBs_P-A of FT:mat_peptide HM101114_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101115_SHBs_P-A Product feature CHAIN HM101115_SHBs_P-A of FT:mat_peptide HM101115_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101116_SHBs_P-A Product feature CHAIN HM101116_SHBs_P-A of FT:mat_peptide HM101116_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 38_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101117_SHBs_P-A Product feature CHAIN HM101117_SHBs_P-A of FT:mat_peptide HM101117_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101118_SHBs_P-A Product feature CHAIN HM101118_SHBs_P-A of FT:mat_peptide HM101118_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 42_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101119_SHBs_P-A Product feature CHAIN HM101119_SHBs_P-A of FT:mat_peptide HM101119_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101120_SHBs_P-A Product feature CHAIN HM101120_SHBs_P-A of FT:mat_peptide HM101120_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 33_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101121_SHBs_P-A Product feature CHAIN HM101121_SHBs_P-A of FT:mat_peptide HM101121_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 19_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101122_SHBs_P-A Product feature CHAIN HM101122_SHBs_P-A of FT:mat_peptide HM101122_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 15_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101123_SHBs_P-A Product feature CHAIN HM101123_SHBs_P-A of FT:mat_peptide HM101123_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM101124_SHBs_P-A Product feature CHAIN HM101124_SHBs_P-A of FT:mat_peptide HM101124_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 01_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM195115_SHBs_P-A Product feature CHAIN HM195115_SHBs_P-A of FT:mat_peptide HM195115_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDA_495-Luanda-A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=223 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLW
>gnl|hbvpro|HM363612_SHBs_P-A Product feature CHAIN HM363612_SHBs_P-A of FT:mat_peptide HM363612_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM363613_SHBs_P-A Product feature CHAIN HM363613_SHBs_P-A of FT:mat_peptide HM363613_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|HM467774_SHBs_P-A Product feature CHAIN HM467774_SHBs_P-A of FT:mat_peptide HM467774_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1111_Colombia). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFRGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM535200_SHBs_P-A Product feature CHAIN HM535200_SHBs_P-A of FT:mat_peptide HM535200_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM535205_SHBs_P-A Product feature CHAIN HM535205_SHBs_P-A of FT:mat_peptide HM535205_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM772994_SHBs_P-A Product feature CHAIN HM772994_SHBs_P-A of FT:mat_peptide HM772994_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 36Q). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM772995_SHBs_P-A Product feature CHAIN HM772995_SHBs_P-A of FT:mat_peptide HM772995_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 62Q). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM772996_SHBs_P-A Product feature CHAIN HM772996_SHBs_P-A of FT:mat_peptide HM772996_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65Q). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM772997_SHBs_P-A Product feature CHAIN HM772997_SHBs_P-A of FT:mat_peptide HM772997_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 70Q). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ185229_SHBs_P-A Product feature CHAIN HQ185229_SHBs_P-A of FT:mat_peptide HQ185229_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5569). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWPSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ840709_SHBs_P-A Product feature CHAIN HQ840709_SHBs_P-A of FT:mat_peptide HQ840709_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SA1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|J02205_SHBs_P-A Product feature CHAIN J02205_SHBs_P-A of FT:mat_peptide J02205_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF298903_SHBs_P-A Product feature CHAIN JF298903_SHBs_P-A of FT:mat_peptide JF298903_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV_8141). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439720_SHBs_P-A Product feature CHAIN JF439720_SHBs_P-A of FT:mat_peptide JF439720_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL437). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCRCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439721_SHBs_P-A Product feature CHAIN JF439721_SHBs_P-A of FT:mat_peptide JF439721_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439722_SHBs_P-A Product feature CHAIN JF439722_SHBs_P-A of FT:mat_peptide JF439722_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439723_SHBs_P-A Product feature CHAIN JF439723_SHBs_P-A of FT:mat_peptide JF439723_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTAPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439724_SHBs_P-A Product feature CHAIN JF439724_SHBs_P-A of FT:mat_peptide JF439724_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439726_SHBs_P-A Product feature CHAIN JF439726_SHBs_P-A of FT:mat_peptide JF439726_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL452). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439729_SHBs_P-A Product feature CHAIN JF439729_SHBs_P-A of FT:mat_peptide JF439729_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439730_SHBs_P-A Product feature CHAIN JF439730_SHBs_P-A of FT:mat_peptide JF439730_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439731_SHBs_P-A Product feature CHAIN JF439731_SHBs_P-A of FT:mat_peptide JF439731_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL458). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439732_SHBs_P-A Product feature CHAIN JF439732_SHBs_P-A of FT:mat_peptide JF439732_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
TENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILPLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSWAFAK
YLWEWAPVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439733_SHBs_P-A Product feature CHAIN JF439733_SHBs_P-A of FT:mat_peptide JF439733_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
TENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILPLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSWAFAK
YLWEWAPVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439734_SHBs_P-A Product feature CHAIN JF439734_SHBs_P-A of FT:mat_peptide JF439734_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL461). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439735_SHBs_P-A Product feature CHAIN JF439735_SHBs_P-A of FT:mat_peptide JF439735_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439736_SHBs_P-A Product feature CHAIN JF439736_SHBs_P-A of FT:mat_peptide JF439736_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439737_SHBs_P-A Product feature CHAIN JF439737_SHBs_P-A of FT:mat_peptide JF439737_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439738_SHBs_P-A Product feature CHAIN JF439738_SHBs_P-A of FT:mat_peptide JF439738_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439739_SHBs_P-A Product feature CHAIN JF439739_SHBs_P-A of FT:mat_peptide JF439739_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL467). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439742_SHBs_P-A Product feature CHAIN JF439742_SHBs_P-A of FT:mat_peptide JF439742_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439743_SHBs_P-A Product feature CHAIN JF439743_SHBs_P-A of FT:mat_peptide JF439743_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFSCLWVYI
>gnl|hbvpro|JF439744_SHBs_P-A Product feature CHAIN JF439744_SHBs_P-A of FT:mat_peptide JF439744_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL473). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQFPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439745_SHBs_P-A Product feature CHAIN JF439745_SHBs_P-A of FT:mat_peptide JF439745_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL474). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439746_SHBs_P-A Product feature CHAIN JF439746_SHBs_P-A of FT:mat_peptide JF439746_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439747_SHBs_P-A Product feature CHAIN JF439747_SHBs_P-A of FT:mat_peptide JF439747_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439748_SHBs_P-A Product feature CHAIN JF439748_SHBs_P-A of FT:mat_peptide JF439748_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCGTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439751_SHBs_P-A Product feature CHAIN JF439751_SHBs_P-A of FT:mat_peptide JF439751_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439752_SHBs_P-A Product feature CHAIN JF439752_SHBs_P-A of FT:mat_peptide JF439752_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439753_SHBs_P-A Product feature CHAIN JF439753_SHBs_P-A of FT:mat_peptide JF439753_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439754_SHBs_P-A Product feature CHAIN JF439754_SHBs_P-A of FT:mat_peptide JF439754_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439755_SHBs_P-A Product feature CHAIN JF439755_SHBs_P-A of FT:mat_peptide JF439755_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439756_SHBs_P-A Product feature CHAIN JF439756_SHBs_P-A of FT:mat_peptide JF439756_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439757_SHBs_P-A Product feature CHAIN JF439757_SHBs_P-A of FT:mat_peptide JF439757_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439758_SHBs_P-A Product feature CHAIN JF439758_SHBs_P-A of FT:mat_peptide JF439758_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439759_SHBs_P-A Product feature CHAIN JF439759_SHBs_P-A of FT:mat_peptide JF439759_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439760_SHBs_P-A Product feature CHAIN JF439760_SHBs_P-A of FT:mat_peptide JF439760_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439761_SHBs_P-A Product feature CHAIN JF439761_SHBs_P-A of FT:mat_peptide JF439761_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439762_SHBs_P-A Product feature CHAIN JF439762_SHBs_P-A of FT:mat_peptide JF439762_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439763_SHBs_P-A Product feature CHAIN JF439763_SHBs_P-A of FT:mat_peptide JF439763_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439764_SHBs_P-A Product feature CHAIN JF439764_SHBs_P-A of FT:mat_peptide JF439764_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439765_SHBs_P-A Product feature CHAIN JF439765_SHBs_P-A of FT:mat_peptide JF439765_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439766_SHBs_P-A Product feature CHAIN JF439766_SHBs_P-A of FT:mat_peptide JF439766_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439767_SHBs_P-A Product feature CHAIN JF439767_SHBs_P-A of FT:mat_peptide JF439767_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439768_SHBs_P-A Product feature CHAIN JF439768_SHBs_P-A of FT:mat_peptide JF439768_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439769_SHBs_P-A Product feature CHAIN JF439769_SHBs_P-A of FT:mat_peptide JF439769_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439770_SHBs_P-A Product feature CHAIN JF439770_SHBs_P-A of FT:mat_peptide JF439770_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439771_SHBs_P-A Product feature CHAIN JF439771_SHBs_P-A of FT:mat_peptide JF439771_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439772_SHBs_P-A Product feature CHAIN JF439772_SHBs_P-A of FT:mat_peptide JF439772_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439773_SHBs_P-A Product feature CHAIN JF439773_SHBs_P-A of FT:mat_peptide JF439773_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439774_SHBs_P-A Product feature CHAIN JF439774_SHBs_P-A of FT:mat_peptide JF439774_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439775_SHBs_P-A Product feature CHAIN JF439775_SHBs_P-A of FT:mat_peptide JF439775_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C9). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439777_SHBs_P-A Product feature CHAIN JF439777_SHBs_P-A of FT:mat_peptide JF439777_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439778_SHBs_P-A Product feature CHAIN JF439778_SHBs_P-A of FT:mat_peptide JF439778_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439820_SHBs_P-A Product feature CHAIN JF439820_SHBs_P-A of FT:mat_peptide JF439820_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWISLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439821_SHBs_P-A Product feature CHAIN JF439821_SHBs_P-A of FT:mat_peptide JF439821_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPPSGAFAK
YLWEWASVRFYWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439822_SHBs_P-A Product feature CHAIN JF439822_SHBs_P-A of FT:mat_peptide JF439822_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439824_SHBs_P-A Product feature CHAIN JF439824_SHBs_P-A of FT:mat_peptide JF439824_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMSPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439825_SHBs_P-A Product feature CHAIN JF439825_SHBs_P-A of FT:mat_peptide JF439825_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439828_SHBs_P-A Product feature CHAIN JF439828_SHBs_P-A of FT:mat_peptide JF439828_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSPSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439829_SHBs_P-A Product feature CHAIN JF439829_SHBs_P-A of FT:mat_peptide JF439829_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439831_SHBs_P-A Product feature CHAIN JF439831_SHBs_P-A of FT:mat_peptide JF439831_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439832_SHBs_P-A Product feature CHAIN JF439832_SHBs_P-A of FT:mat_peptide JF439832_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439833_SHBs_P-A Product feature CHAIN JF439833_SHBs_P-A of FT:mat_peptide JF439833_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439834_SHBs_P-A Product feature CHAIN JF439834_SHBs_P-A of FT:mat_peptide JF439834_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99A4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSVVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439835_SHBs_P-A Product feature CHAIN JF439835_SHBs_P-A of FT:mat_peptide JF439835_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439836_SHBs_P-A Product feature CHAIN JF439836_SHBs_P-A of FT:mat_peptide JF439836_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGQCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439837_SHBs_P-A Product feature CHAIN JF439837_SHBs_P-A of FT:mat_peptide JF439837_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439838_SHBs_P-A Product feature CHAIN JF439838_SHBs_P-A of FT:mat_peptide JF439838_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439839_SHBs_P-A Product feature CHAIN JF439839_SHBs_P-A of FT:mat_peptide JF439839_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439840_SHBs_P-A Product feature CHAIN JF439840_SHBs_P-A of FT:mat_peptide JF439840_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGQCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439841_SHBs_P-A Product feature CHAIN JF439841_SHBs_P-A of FT:mat_peptide JF439841_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFTK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439842_SHBs_P-A Product feature CHAIN JF439842_SHBs_P-A of FT:mat_peptide JF439842_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGTCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVHFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439843_SHBs_P-A Product feature CHAIN JF439843_SHBs_P-A of FT:mat_peptide JF439843_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSCWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439844_SHBs_P-A Product feature CHAIN JF439844_SHBs_P-A of FT:mat_peptide JF439844_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439845_SHBs_P-A Product feature CHAIN JF439845_SHBs_P-A of FT:mat_peptide JF439845_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439846_SHBs_P-A Product feature CHAIN JF439846_SHBs_P-A of FT:mat_peptide JF439846_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSIFPSCCCTKPTDGNCTCIPIPSSWALAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439847_SHBs_P-A Product feature CHAIN JF439847_SHBs_P-A of FT:mat_peptide JF439847_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPLIPLLPIFFCLWVYI
>gnl|hbvpro|JF439848_SHBs_P-A Product feature CHAIN JF439848_SHBs_P-A of FT:mat_peptide JF439848_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439849_SHBs_P-A Product feature CHAIN JF439849_SHBs_P-A of FT:mat_peptide JF439849_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439850_SHBs_P-A Product feature CHAIN JF439850_SHBs_P-A of FT:mat_peptide JF439850_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVYLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGQCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439851_SHBs_P-A Product feature CHAIN JF439851_SHBs_P-A of FT:mat_peptide JF439851_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439852_SHBs_P-A Product feature CHAIN JF439852_SHBs_P-A of FT:mat_peptide JF439852_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
TIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439853_SHBs_P-A Product feature CHAIN JF439853_SHBs_P-A of FT:mat_peptide JF439853_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439854_SHBs_P-A Product feature CHAIN JF439854_SHBs_P-A of FT:mat_peptide JF439854_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439855_SHBs_P-A Product feature CHAIN JF439855_SHBs_P-A of FT:mat_peptide JF439855_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGQCKTCTTTAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439856_SHBs_P-A Product feature CHAIN JF439856_SHBs_P-A of FT:mat_peptide JF439856_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439857_SHBs_P-A Product feature CHAIN JF439857_SHBs_P-A of FT:mat_peptide JF439857_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSPWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439858_SHBs_P-A Product feature CHAIN JF439858_SHBs_P-A of FT:mat_peptide JF439858_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439859_SHBs_P-A Product feature CHAIN JF439859_SHBs_P-A of FT:mat_peptide JF439859_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439860_SHBs_P-A Product feature CHAIN JF439860_SHBs_P-A of FT:mat_peptide JF439860_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439861_SHBs_P-A Product feature CHAIN JF439861_SHBs_P-A of FT:mat_peptide JF439861_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439862_SHBs_P-A Product feature CHAIN JF439862_SHBs_P-A of FT:mat_peptide JF439862_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05B7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPIRPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439864_SHBs_P-A Product feature CHAIN JF439864_SHBs_P-A of FT:mat_peptide JF439864_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439865_SHBs_P-A Product feature CHAIN JF439865_SHBs_P-A of FT:mat_peptide JF439865_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSYCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439866_SHBs_P-A Product feature CHAIN JF439866_SHBs_P-A of FT:mat_peptide JF439866_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05F7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLSILLLCLIFLLVLLDYRGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439867_SHBs_P-A Product feature CHAIN JF439867_SHBs_P-A of FT:mat_peptide JF439867_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05G8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MANITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439868_SHBs_P-A Product feature CHAIN JF439868_SHBs_P-A of FT:mat_peptide JF439868_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSAMWMILYWGPSLYSIVSPFIPLSPIFFCLWVYI
>gnl|hbvpro|JF439869_SHBs_P-A Product feature CHAIN JF439869_SHBs_P-A of FT:mat_peptide JF439869_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439870_SHBs_P-A Product feature CHAIN JF439870_SHBs_P-A of FT:mat_peptide JF439870_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKTTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439871_SHBs_P-A Product feature CHAIN JF439871_SHBs_P-A of FT:mat_peptide JF439871_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439872_SHBs_P-A Product feature CHAIN JF439872_SHBs_P-A of FT:mat_peptide JF439872_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKTTAANCTCIPIPSSWAFAK
YLWEWASARFYWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439873_SHBs_P-A Product feature CHAIN JF439873_SHBs_P-A of FT:mat_peptide JF439873_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439874_SHBs_P-A Product feature CHAIN JF439874_SHBs_P-A of FT:mat_peptide JF439874_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439875_SHBs_P-A Product feature CHAIN JF439875_SHBs_P-A of FT:mat_peptide JF439875_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439876_SHBs_P-A Product feature CHAIN JF439876_SHBs_P-A of FT:mat_peptide JF439876_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439877_SHBs_P-A Product feature CHAIN JF439877_SHBs_P-A of FT:mat_peptide JF439877_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMMPSCCCTKTTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439878_SHBs_P-A Product feature CHAIN JF439878_SHBs_P-A of FT:mat_peptide JF439878_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMMPSCCCTKTTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439879_SHBs_P-A Product feature CHAIN JF439879_SHBs_P-A of FT:mat_peptide JF439879_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439880_SHBs_P-A Product feature CHAIN JF439880_SHBs_P-A of FT:mat_peptide JF439880_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439881_SHBs_P-A Product feature CHAIN JF439881_SHBs_P-A of FT:mat_peptide JF439881_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439882_SHBs_P-A Product feature CHAIN JF439882_SHBs_P-A of FT:mat_peptide JF439882_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439883_SHBs_P-A Product feature CHAIN JF439883_SHBs_P-A of FT:mat_peptide JF439883_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMIPSCCCTKPTAANCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF439896_SHBs_P-A Product feature CHAIN JF439896_SHBs_P-A of FT:mat_peptide JF439896_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439897_SHBs_P-A Product feature CHAIN JF439897_SHBs_P-A of FT:mat_peptide JF439897_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439898_SHBs_P-A Product feature CHAIN JF439898_SHBs_P-A of FT:mat_peptide JF439898_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439899_SHBs_P-A Product feature CHAIN JF439899_SHBs_P-A of FT:mat_peptide JF439899_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439900_SHBs_P-A Product feature CHAIN JF439900_SHBs_P-A of FT:mat_peptide JF439900_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
TIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439901_SHBs_P-A Product feature CHAIN JF439901_SHBs_P-A of FT:mat_peptide JF439901_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439902_SHBs_P-A Product feature CHAIN JF439902_SHBs_P-A of FT:mat_peptide JF439902_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439903_SHBs_P-A Product feature CHAIN JF439903_SHBs_P-A of FT:mat_peptide JF439903_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439904_SHBs_P-A Product feature CHAIN JF439904_SHBs_P-A of FT:mat_peptide JF439904_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439905_SHBs_P-A Product feature CHAIN JF439905_SHBs_P-A of FT:mat_peptide JF439905_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLHNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439906_SHBs_P-A Product feature CHAIN JF439906_SHBs_P-A of FT:mat_peptide JF439906_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFTK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439907_SHBs_P-A Product feature CHAIN JF439907_SHBs_P-A of FT:mat_peptide JF439907_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439908_SHBs_P-A Product feature CHAIN JF439908_SHBs_P-A of FT:mat_peptide JF439908_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439909_SHBs_P-A Product feature CHAIN JF439909_SHBs_P-A of FT:mat_peptide JF439909_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLCNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439910_SHBs_P-A Product feature CHAIN JF439910_SHBs_P-A of FT:mat_peptide JF439910_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFFLWVYI
>gnl|hbvpro|JF439911_SHBs_P-A Product feature CHAIN JF439911_SHBs_P-A of FT:mat_peptide JF439911_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439912_SHBs_P-A Product feature CHAIN JF439912_SHBs_P-A of FT:mat_peptide JF439912_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLFSIVRPFTPLLPIFFCLWVYI
>gnl|hbvpro|JF439913_SHBs_P-A Product feature CHAIN JF439913_SHBs_P-A of FT:mat_peptide JF439913_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439914_SHBs_P-A Product feature CHAIN JF439914_SHBs_P-A of FT:mat_peptide JF439914_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPILSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439915_SHBs_P-A Product feature CHAIN JF439915_SHBs_P-A of FT:mat_peptide JF439915_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439916_SHBs_P-A Product feature CHAIN JF439916_SHBs_P-A of FT:mat_peptide JF439916_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439917_SHBs_P-A Product feature CHAIN JF439917_SHBs_P-A of FT:mat_peptide JF439917_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPLIPLLPIFFCLWVYI
>gnl|hbvpro|JF439918_SHBs_P-A Product feature CHAIN JF439918_SHBs_P-A of FT:mat_peptide JF439918_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439919_SHBs_P-A Product feature CHAIN JF439919_SHBs_P-A of FT:mat_peptide JF439919_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439920_SHBs_P-A Product feature CHAIN JF439920_SHBs_P-A of FT:mat_peptide JF439920_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLILLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439921_SHBs_P-A Product feature CHAIN JF439921_SHBs_P-A of FT:mat_peptide JF439921_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439922_SHBs_P-A Product feature CHAIN JF439922_SHBs_P-A of FT:mat_peptide JF439922_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439923_SHBs_P-A Product feature CHAIN JF439923_SHBs_P-A of FT:mat_peptide JF439923_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVRLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439924_SHBs_P-A Product feature CHAIN JF439924_SHBs_P-A of FT:mat_peptide JF439924_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439925_SHBs_P-A Product feature CHAIN JF439925_SHBs_P-A of FT:mat_peptide JF439925_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRLSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439927_SHBs_P-A Product feature CHAIN JF439927_SHBs_P-A of FT:mat_peptide JF439927_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439928_SHBs_P-A Product feature CHAIN JF439928_SHBs_P-A of FT:mat_peptide JF439928_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439929_SHBs_P-A Product feature CHAIN JF439929_SHBs_P-A of FT:mat_peptide JF439929_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439930_SHBs_P-A Product feature CHAIN JF439930_SHBs_P-A of FT:mat_peptide JF439930_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439931_SHBs_P-A Product feature CHAIN JF439931_SHBs_P-A of FT:mat_peptide JF439931_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGVLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLILLDYQGMSPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439932_SHBs_P-A Product feature CHAIN JF439932_SHBs_P-A of FT:mat_peptide JF439932_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439933_SHBs_P-A Product feature CHAIN JF439933_SHBs_P-A of FT:mat_peptide JF439933_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439934_SHBs_P-A Product feature CHAIN JF439934_SHBs_P-A of FT:mat_peptide JF439934_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439935_SHBs_P-A Product feature CHAIN JF439935_SHBs_P-A of FT:mat_peptide JF439935_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGVLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLPCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439936_SHBs_P-A Product feature CHAIN JF439936_SHBs_P-A of FT:mat_peptide JF439936_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439937_SHBs_P-A Product feature CHAIN JF439937_SHBs_P-A of FT:mat_peptide JF439937_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439938_SHBs_P-A Product feature CHAIN JF439938_SHBs_P-A of FT:mat_peptide JF439938_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTYIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439939_SHBs_P-A Product feature CHAIN JF439939_SHBs_P-A of FT:mat_peptide JF439939_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVRPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439940_SHBs_P-A Product feature CHAIN JF439940_SHBs_P-A of FT:mat_peptide JF439940_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439941_SHBs_P-A Product feature CHAIN JF439941_SHBs_P-A of FT:mat_peptide JF439941_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439942_SHBs_P-A Product feature CHAIN JF439942_SHBs_P-A of FT:mat_peptide JF439942_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439943_SHBs_P-A Product feature CHAIN JF439943_SHBs_P-A of FT:mat_peptide JF439943_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439944_SHBs_P-A Product feature CHAIN JF439944_SHBs_P-A of FT:mat_peptide JF439944_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439945_SHBs_P-A Product feature CHAIN JF439945_SHBs_P-A of FT:mat_peptide JF439945_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439946_SHBs_P-A Product feature CHAIN JF439946_SHBs_P-A of FT:mat_peptide JF439946_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439947_SHBs_P-A Product feature CHAIN JF439947_SHBs_P-A of FT:mat_peptide JF439947_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMVWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439948_SHBs_P-A Product feature CHAIN JF439948_SHBs_P-A of FT:mat_peptide JF439948_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439949_SHBs_P-A Product feature CHAIN JF439949_SHBs_P-A of FT:mat_peptide JF439949_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWTMWYWGPSLYSIVRPFISLLPIFFCLWVYI
>gnl|hbvpro|JF439950_SHBs_P-A Product feature CHAIN JF439950_SHBs_P-A of FT:mat_peptide JF439950_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439951_SHBs_P-A Product feature CHAIN JF439951_SHBs_P-A of FT:mat_peptide JF439951_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSAGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439952_SHBs_P-A Product feature CHAIN JF439952_SHBs_P-A of FT:mat_peptide JF439952_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IMFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPADGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMRMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439953_SHBs_P-A Product feature CHAIN JF439953_SHBs_P-A of FT:mat_peptide JF439953_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439954_SHBs_P-A Product feature CHAIN JF439954_SHBs_P-A of FT:mat_peptide JF439954_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439955_SHBs_P-A Product feature CHAIN JF439955_SHBs_P-A of FT:mat_peptide JF439955_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439956_SHBs_P-A Product feature CHAIN JF439956_SHBs_P-A of FT:mat_peptide JF439956_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLVFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439957_SHBs_P-A Product feature CHAIN JF439957_SHBs_P-A of FT:mat_peptide JF439957_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439958_SHBs_P-A Product feature CHAIN JF439958_SHBs_P-A of FT:mat_peptide JF439958_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCRCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439959_SHBs_P-A Product feature CHAIN JF439959_SHBs_P-A of FT:mat_peptide JF439959_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439960_SHBs_P-A Product feature CHAIN JF439960_SHBs_P-A of FT:mat_peptide JF439960_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439961_SHBs_P-A Product feature CHAIN JF439961_SHBs_P-A of FT:mat_peptide JF439961_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSRAFTK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439962_SHBs_P-A Product feature CHAIN JF439962_SHBs_P-A of FT:mat_peptide JF439962_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439963_SHBs_P-A Product feature CHAIN JF439963_SHBs_P-A of FT:mat_peptide JF439963_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439964_SHBs_P-A Product feature CHAIN JF439964_SHBs_P-A of FT:mat_peptide JF439964_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439965_SHBs_P-A Product feature CHAIN JF439965_SHBs_P-A of FT:mat_peptide JF439965_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVHI
>gnl|hbvpro|JF439966_SHBs_P-A Product feature CHAIN JF439966_SHBs_P-A of FT:mat_peptide JF439966_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c8). Partial genome (Contains: HBe, HBc, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439967_SHBs_P-A Product feature CHAIN JF439967_SHBs_P-A of FT:mat_peptide JF439967_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439968_SHBs_P-A Product feature CHAIN JF439968_SHBs_P-A of FT:mat_peptide JF439968_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPSIPLLPIFFCLWVYI
>gnl|hbvpro|JF439969_SHBs_P-A Product feature CHAIN JF439969_SHBs_P-A of FT:mat_peptide JF439969_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439970_SHBs_P-A Product feature CHAIN JF439970_SHBs_P-A of FT:mat_peptide JF439970_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFEGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439971_SHBs_P-A Product feature CHAIN JF439971_SHBs_P-A of FT:mat_peptide JF439971_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439972_SHBs_P-A Product feature CHAIN JF439972_SHBs_P-A of FT:mat_peptide JF439972_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPSYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPNFFCLWVYI
>gnl|hbvpro|JF439973_SHBs_P-A Product feature CHAIN JF439973_SHBs_P-A of FT:mat_peptide JF439973_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439974_SHBs_P-A Product feature CHAIN JF439974_SHBs_P-A of FT:mat_peptide JF439974_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439975_SHBs_P-A Product feature CHAIN JF439975_SHBs_P-A of FT:mat_peptide JF439975_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVPLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439976_SHBs_P-A Product feature CHAIN JF439976_SHBs_P-A of FT:mat_peptide JF439976_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
TIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439977_SHBs_P-A Product feature CHAIN JF439977_SHBs_P-A of FT:mat_peptide JF439977_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSPYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439978_SHBs_P-A Product feature CHAIN JF439978_SHBs_P-A of FT:mat_peptide JF439978_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439979_SHBs_P-A Product feature CHAIN JF439979_SHBs_P-A of FT:mat_peptide JF439979_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPPIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTGGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439980_SHBs_P-A Product feature CHAIN JF439980_SHBs_P-A of FT:mat_peptide JF439980_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439981_SHBs_P-A Product feature CHAIN JF439981_SHBs_P-A of FT:mat_peptide JF439981_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKACTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439982_SHBs_P-A Product feature CHAIN JF439982_SHBs_P-A of FT:mat_peptide JF439982_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439983_SHBs_P-A Product feature CHAIN JF439983_SHBs_P-A of FT:mat_peptide JF439983_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439984_SHBs_P-A Product feature CHAIN JF439984_SHBs_P-A of FT:mat_peptide JF439984_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWGTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439985_SHBs_P-A Product feature CHAIN JF439985_SHBs_P-A of FT:mat_peptide JF439985_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439986_SHBs_P-A Product feature CHAIN JF439986_SHBs_P-A of FT:mat_peptide JF439986_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439987_SHBs_P-A Product feature CHAIN JF439987_SHBs_P-A of FT:mat_peptide JF439987_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTRPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439988_SHBs_P-A Product feature CHAIN JF439988_SHBs_P-A of FT:mat_peptide JF439988_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439989_SHBs_P-A Product feature CHAIN JF439989_SHBs_P-A of FT:mat_peptide JF439989_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLPPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439990_SHBs_P-A Product feature CHAIN JF439990_SHBs_P-A of FT:mat_peptide JF439990_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLPGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPRIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439991_SHBs_P-A Product feature CHAIN JF439991_SHBs_P-A of FT:mat_peptide JF439991_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVCFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439992_SHBs_P-A Product feature CHAIN JF439992_SHBs_P-A of FT:mat_peptide JF439992_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF439993_SHBs_P-A Product feature CHAIN JF439993_SHBs_P-A of FT:mat_peptide JF439993_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF440016_SHBs_P-A Product feature CHAIN JF440016_SHBs_P-A of FT:mat_peptide JF440016_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B11). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF440018_SHBs_P-A Product feature CHAIN JF440018_SHBs_P-A of FT:mat_peptide JF440018_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF440020_SHBs_P-A Product feature CHAIN JF440020_SHBs_P-A of FT:mat_peptide JF440020_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN107758_SHBs_P-A Product feature CHAIN JN107758_SHBs_P-A of FT:mat_peptide JN107758_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ind 1992). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCSLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JN132119_SHBs_P-A Product feature CHAIN JN132119_SHBs_P-A of FT:mat_peptide JN132119_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NCVI-3906). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182318_SHBs_P-A Product feature CHAIN JN182318_SHBs_P-A of FT:mat_peptide JN182318_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182319_SHBs_P-A Product feature CHAIN JN182319_SHBs_P-A of FT:mat_peptide JN182319_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182320_SHBs_P-A Product feature CHAIN JN182320_SHBs_P-A of FT:mat_peptide JN182320_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNPMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182321_SHBs_P-A Product feature CHAIN JN182321_SHBs_P-A of FT:mat_peptide JN182321_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182322_SHBs_P-A Product feature CHAIN JN182322_SHBs_P-A of FT:mat_peptide JN182322_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182323_SHBs_P-A Product feature CHAIN JN182323_SHBs_P-A of FT:mat_peptide JN182323_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182324_SHBs_P-A Product feature CHAIN JN182324_SHBs_P-A of FT:mat_peptide JN182324_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNAMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182325_SHBs_P-A Product feature CHAIN JN182325_SHBs_P-A of FT:mat_peptide JN182325_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182326_SHBs_P-A Product feature CHAIN JN182326_SHBs_P-A of FT:mat_peptide JN182326_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182327_SHBs_P-A Product feature CHAIN JN182327_SHBs_P-A of FT:mat_peptide JN182327_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182328_SHBs_P-A Product feature CHAIN JN182328_SHBs_P-A of FT:mat_peptide JN182328_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGKLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182329_SHBs_P-A Product feature CHAIN JN182329_SHBs_P-A of FT:mat_peptide JN182329_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182330_SHBs_P-A Product feature CHAIN JN182330_SHBs_P-A of FT:mat_peptide JN182330_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTAPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182331_SHBs_P-A Product feature CHAIN JN182331_SHBs_P-A of FT:mat_peptide JN182331_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCIKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182332_SHBs_P-A Product feature CHAIN JN182332_SHBs_P-A of FT:mat_peptide JN182332_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYRGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182333_SHBs_P-A Product feature CHAIN JN182333_SHBs_P-A of FT:mat_peptide JN182333_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYRGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN182334_SHBs_P-A Product feature CHAIN JN182334_SHBs_P-A of FT:mat_peptide JN182334_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVPLDYQGKLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN226069_SHBs_P-A Product feature CHAIN JN226069_SHBs_P-A of FT:mat_peptide JN226069_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PTV795_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPXSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN226084_SHBs_P-A Product feature CHAIN JN226084_SHBs_P-A of FT:mat_peptide JN226084_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PTV840_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN226093_SHBs_P-A Product feature CHAIN JN226093_SHBs_P-A of FT:mat_peptide JN226093_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PTV771_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604128_SHBs_P-A Product feature CHAIN JN604128_SHBs_P-A of FT:mat_peptide JN604128_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-4481-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSAIWMMWYWGPRLCNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604136_SHBs_P-A Product feature CHAIN JN604136_SHBs_P-A of FT:mat_peptide JN604136_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-5824-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604145_SHBs_P-A Product feature CHAIN JN604145_SHBs_P-A of FT:mat_peptide JN604145_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-2097-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604150_SHBs_P-A Product feature CHAIN JN604150_SHBs_P-A of FT:mat_peptide JN604150_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-5814-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFPGVXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVFI
>gnl|hbvpro|JN604155_SHBs_P-A Product feature CHAIN JN604155_SHBs_P-A of FT:mat_peptide JN604155_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 480-0815-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWXWGPRLLNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604156_SHBs_P-A Product feature CHAIN JN604156_SHBs_P-A of FT:mat_peptide JN604156_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-5439-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNXLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604158_SHBs_P-A Product feature CHAIN JN604158_SHBs_P-A of FT:mat_peptide JN604158_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-9282-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604159_SHBs_P-A Product feature CHAIN JN604159_SHBs_P-A of FT:mat_peptide JN604159_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-0176-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604160_SHBs_P-A Product feature CHAIN JN604160_SHBs_P-A of FT:mat_peptide JN604160_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-1175-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604162_SHBs_P-A Product feature CHAIN JN604162_SHBs_P-A of FT:mat_peptide JN604162_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-3509-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604163_SHBs_P-A Product feature CHAIN JN604163_SHBs_P-A of FT:mat_peptide JN604163_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-4838-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCFGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604164_SHBs_P-A Product feature CHAIN JN604164_SHBs_P-A of FT:mat_peptide JN604164_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-7898-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604165_SHBs_P-A Product feature CHAIN JN604165_SHBs_P-A of FT:mat_peptide JN604165_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-8501-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGPXVCLGQNSQSPTSNHSPTSCPPXCPGYRXMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPXLCXIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604167_SHBs_P-A Product feature CHAIN JN604167_SHBs_P-A of FT:mat_peptide JN604167_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9638-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604169_SHBs_P-A Product feature CHAIN JN604169_SHBs_P-A of FT:mat_peptide JN604169_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9866-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604171_SHBs_P-A Product feature CHAIN JN604171_SHBs_P-A of FT:mat_peptide JN604171_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-0079-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604172_SHBs_P-A Product feature CHAIN JN604172_SHBs_P-A of FT:mat_peptide JN604172_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-0232-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLXAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604173_SHBs_P-A Product feature CHAIN JN604173_SHBs_P-A of FT:mat_peptide JN604173_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-0370-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604178_SHBs_P-A Product feature CHAIN JN604178_SHBs_P-A of FT:mat_peptide JN604178_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-5662-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604179_SHBs_P-A Product feature CHAIN JN604179_SHBs_P-A of FT:mat_peptide JN604179_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-6727-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604180_SHBs_P-A Product feature CHAIN JN604180_SHBs_P-A of FT:mat_peptide JN604180_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-6919-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604181_SHBs_P-A Product feature CHAIN JN604181_SHBs_P-A of FT:mat_peptide JN604181_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7570-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLMPGSTTTSTGPCKTCTTPAQGNSTLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604183_SHBs_P-A Product feature CHAIN JN604183_SHBs_P-A of FT:mat_peptide JN604183_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7954-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604184_SHBs_P-A Product feature CHAIN JN604184_SHBs_P-A of FT:mat_peptide JN604184_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-8107-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604185_SHBs_P-A Product feature CHAIN JN604185_SHBs_P-A of FT:mat_peptide JN604185_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9112-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604186_SHBs_P-A Product feature CHAIN JN604186_SHBs_P-A of FT:mat_peptide JN604186_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-0588-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSHVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSKTXSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFGK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604188_SHBs_P-A Product feature CHAIN JN604188_SHBs_P-A of FT:mat_peptide JN604188_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-2496-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFAGLSPTVWLSAIWMMWYWGPSLYSIVXPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604190_SHBs_P-A Product feature CHAIN JN604190_SHBs_P-A of FT:mat_peptide JN604190_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-3516-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESLVCLGQNSQFPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPGLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604191_SHBs_P-A Product feature CHAIN JN604191_SHBs_P-A of FT:mat_peptide JN604191_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-4278-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604193_SHBs_P-A Product feature CHAIN JN604193_SHBs_P-A of FT:mat_peptide JN604193_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-8520-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGESPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPGLHHILSPCTPLLPIFFCLWVYI
>gnl|hbvpro|JN604194_SHBs_P-A Product feature CHAIN JN604194_SHBs_P-A of FT:mat_peptide JN604194_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-9228-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604195_SHBs_P-A Product feature CHAIN JN604195_SHBs_P-A of FT:mat_peptide JN604195_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 480-0743-0). Partial genome (Contains: HBe, HBc, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLPVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSTTTSTGPCKTCTTPAQNNSMFPSCCCTKPTBGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JN604197_SHBs_P-A Product feature CHAIN JN604197_SHBs_P-A of FT:mat_peptide JN604197_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-9048-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYRIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604200_SHBs_P-A Product feature CHAIN JN604200_SHBs_P-A of FT:mat_peptide JN604200_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-8111-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604204_SHBs_P-A Product feature CHAIN JN604204_SHBs_P-A of FT:mat_peptide JN604204_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9847-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604214_SHBs_P-A Product feature CHAIN JN604214_SHBs_P-A of FT:mat_peptide JN604214_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-0581-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSXDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604216_SHBs_P-A Product feature CHAIN JN604216_SHBs_P-A of FT:mat_peptide JN604216_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-1244-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604217_SHBs_P-A Product feature CHAIN JN604217_SHBs_P-A of FT:mat_peptide JN604217_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2075-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604220_SHBs_P-A Product feature CHAIN JN604220_SHBs_P-A of FT:mat_peptide JN604220_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-3827-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPECLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMVPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPRLCSIVSPFIPLLLIFFCLWVYI
>gnl|hbvpro|JN604227_SHBs_P-A Product feature CHAIN JN604227_SHBs_P-A of FT:mat_peptide JN604227_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-8192-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSXFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSAIWMMWYWGPSLYSIVRPFIPLXPIFFCLWVYI
>gnl|hbvpro|JN604228_SHBs_P-A Product feature CHAIN JN604228_SHBs_P-A of FT:mat_peptide JN604228_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9065-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604230_SHBs_P-A Product feature CHAIN JN604230_SHBs_P-A of FT:mat_peptide JN604230_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9296-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLXLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604236_SHBs_P-A Product feature CHAIN JN604236_SHBs_P-A of FT:mat_peptide JN604236_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-2347-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSXVSPFIXLLPIFFCLWVYI
>gnl|hbvpro|JN604237_SHBs_P-A Product feature CHAIN JN604237_SHBs_P-A of FT:mat_peptide JN604237_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-4279-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604240_SHBs_P-A Product feature CHAIN JN604240_SHBs_P-A of FT:mat_peptide JN604240_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-8326-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604241_SHBs_P-A Product feature CHAIN JN604241_SHBs_P-A of FT:mat_peptide JN604241_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-8404-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=228 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSTTTTTSAGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAF
AKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|JN604242_SHBs_P-A Product feature CHAIN JN604242_SHBs_P-A of FT:mat_peptide JN604242_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9283-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604247_SHBs_P-A Product feature CHAIN JN604247_SHBs_P-A of FT:mat_peptide JN604247_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-1752-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604249_SHBs_P-A Product feature CHAIN JN604249_SHBs_P-A of FT:mat_peptide JN604249_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-2196-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPECXGQNSQCPTSNHSPTSCPPTCPGYXWMCLRXF
IIFLFILLXCLIFXLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMXFWGPSLYSIVRPFIPLXPIFXCLWVYI
>gnl|hbvpro|JN604251_SHBs_P-A Product feature CHAIN JN604251_SHBs_P-A of FT:mat_peptide JN604251_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-2814-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWPLAIWMMWFWGPSLRNTLSPFIQLLPIFFCLWVYI
>gnl|hbvpro|JN604252_SHBs_P-A Product feature CHAIN JN604252_SHBs_P-A of FT:mat_peptide JN604252_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-5037-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604255_SHBs_P-A Product feature CHAIN JN604255_SHBs_P-A of FT:mat_peptide JN604255_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-7206-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604257_SHBs_P-A Product feature CHAIN JN604257_SHBs_P-A of FT:mat_peptide JN604257_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-7365-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604260_SHBs_P-A Product feature CHAIN JN604260_SHBs_P-A of FT:mat_peptide JN604260_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2324-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604261_SHBs_P-A Product feature CHAIN JN604261_SHBs_P-A of FT:mat_peptide JN604261_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2798-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604262_SHBs_P-A Product feature CHAIN JN604262_SHBs_P-A of FT:mat_peptide JN604262_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-5384-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604266_SHBs_P-A Product feature CHAIN JN604266_SHBs_P-A of FT:mat_peptide JN604266_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-6438-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSRSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604268_SHBs_P-A Product feature CHAIN JN604268_SHBs_P-A of FT:mat_peptide JN604268_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-6705-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604269_SHBs_P-A Product feature CHAIN JN604269_SHBs_P-A of FT:mat_peptide JN604269_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-6804-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMXPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPXLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604270_SHBs_P-A Product feature CHAIN JN604270_SHBs_P-A of FT:mat_peptide JN604270_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 476-6948-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSXTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604273_SHBs_P-A Product feature CHAIN JN604273_SHBs_P-A of FT:mat_peptide JN604273_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-0248-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604274_SHBs_P-A Product feature CHAIN JN604274_SHBs_P-A of FT:mat_peptide JN604274_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-0692-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604276_SHBs_P-A Product feature CHAIN JN604276_SHBs_P-A of FT:mat_peptide JN604276_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2270-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604277_SHBs_P-A Product feature CHAIN JN604277_SHBs_P-A of FT:mat_peptide JN604277_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-2543-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604279_SHBs_P-A Product feature CHAIN JN604279_SHBs_P-A of FT:mat_peptide JN604279_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-3206-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604282_SHBs_P-A Product feature CHAIN JN604282_SHBs_P-A of FT:mat_peptide JN604282_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-7112-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604283_SHBs_P-A Product feature CHAIN JN604283_SHBs_P-A of FT:mat_peptide JN604283_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-7136-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604285_SHBs_P-A Product feature CHAIN JN604285_SHBs_P-A of FT:mat_peptide JN604285_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 477-9002-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGSLAGFXLLTRILTIPQSLDSWWTSLSFLGGSPVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVXLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVRPXTPLXPIFFCLWVYI
>gnl|hbvpro|JN604288_SHBs_P-A Product feature CHAIN JN604288_SHBs_P-A of FT:mat_peptide JN604288_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-0727-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604290_SHBs_P-A Product feature CHAIN JN604290_SHBs_P-A of FT:mat_peptide JN604290_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-2581-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFHFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGPSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLSIFFCLWVYI
>gnl|hbvpro|JN604291_SHBs_P-A Product feature CHAIN JN604291_SHBs_P-A of FT:mat_peptide JN604291_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-2956-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604292_SHBs_P-A Product feature CHAIN JN604292_SHBs_P-A of FT:mat_peptide JN604292_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-3070-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604293_SHBs_P-A Product feature CHAIN JN604293_SHBs_P-A of FT:mat_peptide JN604293_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-3721-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604294_SHBs_P-A Product feature CHAIN JN604294_SHBs_P-A of FT:mat_peptide JN604294_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-4030-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604297_SHBs_P-A Product feature CHAIN JN604297_SHBs_P-A of FT:mat_peptide JN604297_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-5893-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604298_SHBs_P-A Product feature CHAIN JN604298_SHBs_P-A of FT:mat_peptide JN604298_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7366-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPHVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPARGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604299_SHBs_P-A Product feature CHAIN JN604299_SHBs_P-A of FT:mat_peptide JN604299_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7384-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604300_SHBs_P-A Product feature CHAIN JN604300_SHBs_P-A of FT:mat_peptide JN604300_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-7825-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604302_SHBs_P-A Product feature CHAIN JN604302_SHBs_P-A of FT:mat_peptide JN604302_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-8782-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSAIWMMWYWGPSLRTIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604303_SHBs_P-A Product feature CHAIN JN604303_SHBs_P-A of FT:mat_peptide JN604303_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9523-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604304_SHBs_P-A Product feature CHAIN JN604304_SHBs_P-A of FT:mat_peptide JN604304_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 478-9526-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604305_SHBs_P-A Product feature CHAIN JN604305_SHBs_P-A of FT:mat_peptide JN604305_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-0870-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSRSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSTXKPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604306_SHBs_P-A Product feature CHAIN JN604306_SHBs_P-A of FT:mat_peptide JN604306_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-3894-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604307_SHBs_P-A Product feature CHAIN JN604307_SHBs_P-A of FT:mat_peptide JN604307_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-4233-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604308_SHBs_P-A Product feature CHAIN JN604308_SHBs_P-A of FT:mat_peptide JN604308_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-4794-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLCILLLCLICLLALLDYRGMLPVCPLIPASTTTSTGPCKTCTTPAQGNSMFXSCCCTKPTDGNCTCTPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPXLXSIVSPFIPLLXIFFCLWVYI
>gnl|hbvpro|JN604309_SHBs_P-A Product feature CHAIN JN604309_SHBs_P-A of FT:mat_peptide JN604309_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-5013-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGSFLLTRILTIPQSLDLWWTSLNFPGGVPVCLGQNSQSPTSNHSPTSCPPTCPGYPWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604315_SHBs_P-A Product feature CHAIN JN604315_SHBs_P-A of FT:mat_peptide JN604315_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 479-9174-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604317_SHBs_P-A Product feature CHAIN JN604317_SHBs_P-A of FT:mat_peptide JN604317_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 480-0314-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604319_SHBs_P-A Product feature CHAIN JN604319_SHBs_P-A of FT:mat_peptide JN604319_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 480-1418-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983831_SHBs_P-A Product feature CHAIN JN983831_SHBs_P-A of FT:mat_peptide JN983831_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8001). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983832_SHBs_P-A Product feature CHAIN JN983832_SHBs_P-A of FT:mat_peptide JN983832_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8002). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLICLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983833_SHBs_P-A Product feature CHAIN JN983833_SHBs_P-A of FT:mat_peptide JN983833_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8004). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983834_SHBs_P-A Product feature CHAIN JN983834_SHBs_P-A of FT:mat_peptide JN983834_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8010). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQNNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983835_SHBs_P-A Product feature CHAIN JN983835_SHBs_P-A of FT:mat_peptide JN983835_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8017). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGAAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983836_SHBs_P-A Product feature CHAIN JN983836_SHBs_P-A of FT:mat_peptide JN983836_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8018). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983837_SHBs_P-A Product feature CHAIN JN983837_SHBs_P-A of FT:mat_peptide JN983837_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8019). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983838_SHBs_P-A Product feature CHAIN JN983838_SHBs_P-A of FT:mat_peptide JN983838_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8020). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983839_SHBs_P-A Product feature CHAIN JN983839_SHBs_P-A of FT:mat_peptide JN983839_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8021). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNIWSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983840_SHBs_P-A Product feature CHAIN JN983840_SHBs_P-A of FT:mat_peptide JN983840_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8023). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983841_SHBs_P-A Product feature CHAIN JN983841_SHBs_P-A of FT:mat_peptide JN983841_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8024). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983842_SHBs_P-A Product feature CHAIN JN983842_SHBs_P-A of FT:mat_peptide JN983842_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8025). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983844_SHBs_P-A Product feature CHAIN JN983844_SHBs_P-A of FT:mat_peptide JN983844_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8027). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983845_SHBs_P-A Product feature CHAIN JN983845_SHBs_P-A of FT:mat_peptide JN983845_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8028). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983846_SHBs_P-A Product feature CHAIN JN983846_SHBs_P-A of FT:mat_peptide JN983846_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8029). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983847_SHBs_P-A Product feature CHAIN JN983847_SHBs_P-A of FT:mat_peptide JN983847_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8031). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCHPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983848_SHBs_P-A Product feature CHAIN JN983848_SHBs_P-A of FT:mat_peptide JN983848_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8036). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCIGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983850_SHBs_P-A Product feature CHAIN JN983850_SHBs_P-A of FT:mat_peptide JN983850_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8040). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWSWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983851_SHBs_P-A Product feature CHAIN JN983851_SHBs_P-A of FT:mat_peptide JN983851_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8043). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983852_SHBs_P-A Product feature CHAIN JN983852_SHBs_P-A of FT:mat_peptide JN983852_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8044). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983854_SHBs_P-A Product feature CHAIN JN983854_SHBs_P-A of FT:mat_peptide JN983854_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8046). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983855_SHBs_P-A Product feature CHAIN JN983855_SHBs_P-A of FT:mat_peptide JN983855_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8047). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQCPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWYWGPSLYNIWSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983856_SHBs_P-A Product feature CHAIN JN983856_SHBs_P-A of FT:mat_peptide JN983856_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8049). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983857_SHBs_P-A Product feature CHAIN JN983857_SHBs_P-A of FT:mat_peptide JN983857_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8051). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983858_SHBs_P-A Product feature CHAIN JN983858_SHBs_P-A of FT:mat_peptide JN983858_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8054). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983859_SHBs_P-A Product feature CHAIN JN983859_SHBs_P-A of FT:mat_peptide JN983859_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8055). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPECRGQNSQCPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983860_SHBs_P-A Product feature CHAIN JN983860_SHBs_P-A of FT:mat_peptide JN983860_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8056). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983861_SHBs_P-A Product feature CHAIN JN983861_SHBs_P-A of FT:mat_peptide JN983861_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8057). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLEPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPRVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSKTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983862_SHBs_P-A Product feature CHAIN JN983862_SHBs_P-A of FT:mat_peptide JN983862_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8058). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983863_SHBs_P-A Product feature CHAIN JN983863_SHBs_P-A of FT:mat_peptide JN983863_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8060). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLCNILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|JN983864_SHBs_P-A Product feature CHAIN JN983864_SHBs_P-A of FT:mat_peptide JN983864_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8061). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983865_SHBs_P-A Product feature CHAIN JN983865_SHBs_P-A of FT:mat_peptide JN983865_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8062). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983866_SHBs_P-A Product feature CHAIN JN983866_SHBs_P-A of FT:mat_peptide JN983866_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8063). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983867_SHBs_P-A Product feature CHAIN JN983867_SHBs_P-A of FT:mat_peptide JN983867_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8065). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRIRIIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983868_SHBs_P-A Product feature CHAIN JN983868_SHBs_P-A of FT:mat_peptide JN983868_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8067). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLICLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSATWMMWFWGPNLCNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983869_SHBs_P-A Product feature CHAIN JN983869_SHBs_P-A of FT:mat_peptide JN983869_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8068). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983870_SHBs_P-A Product feature CHAIN JN983870_SHBs_P-A of FT:mat_peptide JN983870_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8070). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983871_SHBs_P-A Product feature CHAIN JN983871_SHBs_P-A of FT:mat_peptide JN983871_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8071). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983872_SHBs_P-A Product feature CHAIN JN983872_SHBs_P-A of FT:mat_peptide JN983872_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8072). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983873_SHBs_P-A Product feature CHAIN JN983873_SHBs_P-A of FT:mat_peptide JN983873_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8073). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
XENITSGFLRPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983874_SHBs_P-A Product feature CHAIN JN983874_SHBs_P-A of FT:mat_peptide JN983874_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8076). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983875_SHBs_P-A Product feature CHAIN JN983875_SHBs_P-A of FT:mat_peptide JN983875_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8077). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983876_SHBs_P-A Product feature CHAIN JN983876_SHBs_P-A of FT:mat_peptide JN983876_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8078). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983877_SHBs_P-A Product feature CHAIN JN983877_SHBs_P-A of FT:mat_peptide JN983877_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8081). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983878_SHBs_P-A Product feature CHAIN JN983878_SHBs_P-A of FT:mat_peptide JN983878_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8082). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983880_SHBs_P-A Product feature CHAIN JN983880_SHBs_P-A of FT:mat_peptide JN983880_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8086). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYSTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983881_SHBs_P-A Product feature CHAIN JN983881_SHBs_P-A of FT:mat_peptide JN983881_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8091). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IISLFILQLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983882_SHBs_P-A Product feature CHAIN JN983882_SHBs_P-A of FT:mat_peptide JN983882_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8092). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983883_SHBs_P-A Product feature CHAIN JN983883_SHBs_P-A of FT:mat_peptide JN983883_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8094). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983884_SHBs_P-A Product feature CHAIN JN983884_SHBs_P-A of FT:mat_peptide JN983884_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8095). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983885_SHBs_P-A Product feature CHAIN JN983885_SHBs_P-A of FT:mat_peptide JN983885_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8097). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCCGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983887_SHBs_P-A Product feature CHAIN JN983887_SHBs_P-A of FT:mat_peptide JN983887_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8101). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983888_SHBs_P-A Product feature CHAIN JN983888_SHBs_P-A of FT:mat_peptide JN983888_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMFLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983889_SHBs_P-A Product feature CHAIN JN983889_SHBs_P-A of FT:mat_peptide JN983889_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8106). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQAMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLHNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983890_SHBs_P-A Product feature CHAIN JN983890_SHBs_P-A of FT:mat_peptide JN983890_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8107). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983892_SHBs_P-A Product feature CHAIN JN983892_SHBs_P-A of FT:mat_peptide JN983892_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983893_SHBs_P-A Product feature CHAIN JN983893_SHBs_P-A of FT:mat_peptide JN983893_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8110). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983894_SHBs_P-A Product feature CHAIN JN983894_SHBs_P-A of FT:mat_peptide JN983894_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8112). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|JN983895_SHBs_P-A Product feature CHAIN JN983895_SHBs_P-A of FT:mat_peptide JN983895_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8113). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983896_SHBs_P-A Product feature CHAIN JN983896_SHBs_P-A of FT:mat_peptide JN983896_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983897_SHBs_P-A Product feature CHAIN JN983897_SHBs_P-A of FT:mat_peptide JN983897_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8116). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983898_SHBs_P-A Product feature CHAIN JN983898_SHBs_P-A of FT:mat_peptide JN983898_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8121). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983899_SHBs_P-A Product feature CHAIN JN983899_SHBs_P-A of FT:mat_peptide JN983899_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8124). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983900_SHBs_P-A Product feature CHAIN JN983900_SHBs_P-A of FT:mat_peptide JN983900_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8126). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JN983901_SHBs_P-A Product feature CHAIN JN983901_SHBs_P-A of FT:mat_peptide JN983901_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8130). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGESPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCNILSPFAPLLPIFLCLWVYI
>gnl|hbvpro|JN983902_SHBs_P-A Product feature CHAIN JN983902_SHBs_P-A of FT:mat_peptide JN983902_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983903_SHBs_P-A Product feature CHAIN JN983903_SHBs_P-A of FT:mat_peptide JN983903_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8132). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSKFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMLPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983904_SHBs_P-A Product feature CHAIN JN983904_SHBs_P-A of FT:mat_peptide JN983904_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8133). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983905_SHBs_P-A Product feature CHAIN JN983905_SHBs_P-A of FT:mat_peptide JN983905_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8135). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983907_SHBs_P-A Product feature CHAIN JN983907_SHBs_P-A of FT:mat_peptide JN983907_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8140). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN983909_SHBs_P-A Product feature CHAIN JN983909_SHBs_P-A of FT:mat_peptide JN983909_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8150). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ023660_SHBs_P-A Product feature CHAIN JQ023660_SHBs_P-A of FT:mat_peptide JQ023660_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGPPGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ023661_SHBs_P-A Product feature CHAIN JQ023661_SHBs_P-A of FT:mat_peptide JQ023661_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGAPGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLTPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ023662_SHBs_P-A Product feature CHAIN JQ023662_SHBs_P-A of FT:mat_peptide JQ023662_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1164). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGPPGCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLXLLDYQGMLPVCPLIPGSTTTSTGPLQTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ023663_SHBs_P-A Product feature CHAIN JQ023663_SHBs_P-A of FT:mat_peptide JQ023663_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1159). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514280_SHBs_P-A Product feature CHAIN JQ514280_SHBs_P-A of FT:mat_peptide JQ514280_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H1075). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNGTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514281_SHBs_P-A Product feature CHAIN JQ514281_SHBs_P-A of FT:mat_peptide JQ514281_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H1536). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGXSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514282_SHBs_P-A Product feature CHAIN JQ514282_SHBs_P-A of FT:mat_peptide JQ514282_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H921). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTXGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514283_SHBs_P-A Product feature CHAIN JQ514283_SHBs_P-A of FT:mat_peptide JQ514283_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1485). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNGTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514284_SHBs_P-A Product feature CHAIN JQ514284_SHBs_P-A of FT:mat_peptide JQ514284_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1714). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514285_SHBs_P-A Product feature CHAIN JQ514285_SHBs_P-A of FT:mat_peptide JQ514285_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H260). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514286_SHBs_P-A Product feature CHAIN JQ514286_SHBs_P-A of FT:mat_peptide JQ514286_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H1026). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514287_SHBs_P-A Product feature CHAIN JQ514287_SHBs_P-A of FT:mat_peptide JQ514287_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNGTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|JQ514288_SHBs_P-A Product feature CHAIN JQ514288_SHBs_P-A of FT:mat_peptide JQ514288_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H329). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514289_SHBs_P-A Product feature CHAIN JQ514289_SHBs_P-A of FT:mat_peptide JQ514289_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H725). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514290_SHBs_P-A Product feature CHAIN JQ514290_SHBs_P-A of FT:mat_peptide JQ514290_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H775). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNGTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514291_SHBs_P-A Product feature CHAIN JQ514291_SHBs_P-A of FT:mat_peptide JQ514291_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H876). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514292_SHBs_P-A Product feature CHAIN JQ514292_SHBs_P-A of FT:mat_peptide JQ514292_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H1331). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTWIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514293_SHBs_P-A Product feature CHAIN JQ514293_SHBs_P-A of FT:mat_peptide JQ514293_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H1480). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
TIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNGTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514294_SHBs_P-A Product feature CHAIN JQ514294_SHBs_P-A of FT:mat_peptide JQ514294_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H1925). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514295_SHBs_P-A Product feature CHAIN JQ514295_SHBs_P-A of FT:mat_peptide JQ514295_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H1939). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSGVSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514296_SHBs_P-A Product feature CHAIN JQ514296_SHBs_P-A of FT:mat_peptide JQ514296_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H2084). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSTTTSTGPCKTCTSPAQGNSIFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514297_SHBs_P-A Product feature CHAIN JQ514297_SHBs_P-A of FT:mat_peptide JQ514297_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H900). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSMGPCKTCTTPAQGNSMFPSCCCTKPTDGNGTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514380_SHBs_P-A Product feature CHAIN JQ514380_SHBs_P-A of FT:mat_peptide JQ514380_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1611). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514381_SHBs_P-A Product feature CHAIN JQ514381_SHBs_P-A of FT:mat_peptide JQ514381_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1461). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIXMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514382_SHBs_P-A Product feature CHAIN JQ514382_SHBs_P-A of FT:mat_peptide JQ514382_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H372). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514383_SHBs_P-A Product feature CHAIN JQ514383_SHBs_P-A of FT:mat_peptide JQ514383_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1533). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514384_SHBs_P-A Product feature CHAIN JQ514384_SHBs_P-A of FT:mat_peptide JQ514384_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H1921). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514385_SHBs_P-A Product feature CHAIN JQ514385_SHBs_P-A of FT:mat_peptide JQ514385_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H671). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514386_SHBs_P-A Product feature CHAIN JQ514386_SHBs_P-A of FT:mat_peptide JQ514386_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H1061). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCGCTKPTDGNCTCIPIPSSWGFAK
YLWEWASVRFSWLSLLVPFVQWFEGLSPTVWLSAILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514387_SHBs_P-A Product feature CHAIN JQ514387_SHBs_P-A of FT:mat_peptide JQ514387_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11/H669). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514388_SHBs_P-A Product feature CHAIN JQ514388_SHBs_P-A of FT:mat_peptide JQ514388_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H545). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514389_SHBs_P-A Product feature CHAIN JQ514389_SHBs_P-A of FT:mat_peptide JQ514389_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H708). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514390_SHBs_P-A Product feature CHAIN JQ514390_SHBs_P-A of FT:mat_peptide JQ514390_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H918). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514391_SHBs_P-A Product feature CHAIN JQ514391_SHBs_P-A of FT:mat_peptide JQ514391_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H824). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514392_SHBs_P-A Product feature CHAIN JQ514392_SHBs_P-A of FT:mat_peptide JQ514392_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1950). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|JQ514393_SHBs_P-A Product feature CHAIN JQ514393_SHBs_P-A of FT:mat_peptide JQ514393_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H329). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514394_SHBs_P-A Product feature CHAIN JQ514394_SHBs_P-A of FT:mat_peptide JQ514394_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H1343). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514395_SHBs_P-A Product feature CHAIN JQ514395_SHBs_P-A of FT:mat_peptide JQ514395_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H135). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514396_SHBs_P-A Product feature CHAIN JQ514396_SHBs_P-A of FT:mat_peptide JQ514396_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H159). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514397_SHBs_P-A Product feature CHAIN JQ514397_SHBs_P-A of FT:mat_peptide JQ514397_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H157). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514398_SHBs_P-A Product feature CHAIN JQ514398_SHBs_P-A of FT:mat_peptide JQ514398_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1532). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514399_SHBs_P-A Product feature CHAIN JQ514399_SHBs_P-A of FT:mat_peptide JQ514399_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H577). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|JQ514400_SHBs_P-A Product feature CHAIN JQ514400_SHBs_P-A of FT:mat_peptide JQ514400_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H302). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514401_SHBs_P-A Product feature CHAIN JQ514401_SHBs_P-A of FT:mat_peptide JQ514401_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H301). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQSNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPRLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514405_SHBs_P-A Product feature CHAIN JQ514405_SHBs_P-A of FT:mat_peptide JQ514405_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H260). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514500_SHBs_P-A Product feature CHAIN JQ514500_SHBs_P-A of FT:mat_peptide JQ514500_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1826). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPIIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514501_SHBs_P-A Product feature CHAIN JQ514501_SHBs_P-A of FT:mat_peptide JQ514501_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H1550). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLPPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514502_SHBs_P-A Product feature CHAIN JQ514502_SHBs_P-A of FT:mat_peptide JQ514502_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H1081). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514503_SHBs_P-A Product feature CHAIN JQ514503_SHBs_P-A of FT:mat_peptide JQ514503_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H1268). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTSTTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514504_SHBs_P-A Product feature CHAIN JQ514504_SHBs_P-A of FT:mat_peptide JQ514504_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H656). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514505_SHBs_P-A Product feature CHAIN JQ514505_SHBs_P-A of FT:mat_peptide JQ514505_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 07/H547). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514506_SHBs_P-A Product feature CHAIN JQ514506_SHBs_P-A of FT:mat_peptide JQ514506_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 08/H402). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514507_SHBs_P-A Product feature CHAIN JQ514507_SHBs_P-A of FT:mat_peptide JQ514507_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H497). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514531_SHBs_P-A Product feature CHAIN JQ514531_SHBs_P-A of FT:mat_peptide JQ514531_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 10/H2389). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTEGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514532_SHBs_P-A Product feature CHAIN JQ514532_SHBs_P-A of FT:mat_peptide JQ514532_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11/H670). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ514533_SHBs_P-A Product feature CHAIN JQ514533_SHBs_P-A of FT:mat_peptide JQ514533_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 09/H1818). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ687529_SHBs_P-A Product feature CHAIN JQ687529_SHBs_P-A of FT:mat_peptide JQ687529_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ687533_SHBs_P-A Product feature CHAIN JQ687533_SHBs_P-A of FT:mat_peptide JQ687533_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 210). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707299_SHBs_P-A Product feature CHAIN JQ707299_SHBs_P-A of FT:mat_peptide JQ707299_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707300_SHBs_P-A Product feature CHAIN JQ707300_SHBs_P-A of FT:mat_peptide JQ707300_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707301_SHBs_P-A Product feature CHAIN JQ707301_SHBs_P-A of FT:mat_peptide JQ707301_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707302_SHBs_P-A Product feature CHAIN JQ707302_SHBs_P-A of FT:mat_peptide JQ707302_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707303_SHBs_P-A Product feature CHAIN JQ707303_SHBs_P-A of FT:mat_peptide JQ707303_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707304_SHBs_P-A Product feature CHAIN JQ707304_SHBs_P-A of FT:mat_peptide JQ707304_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707305_SHBs_P-A Product feature CHAIN JQ707305_SHBs_P-A of FT:mat_peptide JQ707305_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVPFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707307_SHBs_P-A Product feature CHAIN JQ707307_SHBs_P-A of FT:mat_peptide JQ707307_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707308_SHBs_P-A Product feature CHAIN JQ707308_SHBs_P-A of FT:mat_peptide JQ707308_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707309_SHBs_P-A Product feature CHAIN JQ707309_SHBs_P-A of FT:mat_peptide JQ707309_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707310_SHBs_P-A Product feature CHAIN JQ707310_SHBs_P-A of FT:mat_peptide JQ707310_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707311_SHBs_P-A Product feature CHAIN JQ707311_SHBs_P-A of FT:mat_peptide JQ707311_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707312_SHBs_P-A Product feature CHAIN JQ707312_SHBs_P-A of FT:mat_peptide JQ707312_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707313_SHBs_P-A Product feature CHAIN JQ707313_SHBs_P-A of FT:mat_peptide JQ707313_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707314_SHBs_P-A Product feature CHAIN JQ707314_SHBs_P-A of FT:mat_peptide JQ707314_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707315_SHBs_P-A Product feature CHAIN JQ707315_SHBs_P-A of FT:mat_peptide JQ707315_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707316_SHBs_P-A Product feature CHAIN JQ707316_SHBs_P-A of FT:mat_peptide JQ707316_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707317_SHBs_P-A Product feature CHAIN JQ707317_SHBs_P-A of FT:mat_peptide JQ707317_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707318_SHBs_P-A Product feature CHAIN JQ707318_SHBs_P-A of FT:mat_peptide JQ707318_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=226 residues).
VDNVTSVFKGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707319_SHBs_P-A Product feature CHAIN JQ707319_SHBs_P-A of FT:mat_peptide JQ707319_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707320_SHBs_P-A Product feature CHAIN JQ707320_SHBs_P-A of FT:mat_peptide JQ707320_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707321_SHBs_P-A Product feature CHAIN JQ707321_SHBs_P-A of FT:mat_peptide JQ707321_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707322_SHBs_P-A Product feature CHAIN JQ707322_SHBs_P-A of FT:mat_peptide JQ707322_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707323_SHBs_P-A Product feature CHAIN JQ707323_SHBs_P-A of FT:mat_peptide JQ707323_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707324_SHBs_P-A Product feature CHAIN JQ707324_SHBs_P-A of FT:mat_peptide JQ707324_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707325_SHBs_P-A Product feature CHAIN JQ707325_SHBs_P-A of FT:mat_peptide JQ707325_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTHAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707326_SHBs_P-A Product feature CHAIN JQ707326_SHBs_P-A of FT:mat_peptide JQ707326_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707328_SHBs_P-A Product feature CHAIN JQ707328_SHBs_P-A of FT:mat_peptide JQ707328_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707330_SHBs_P-A Product feature CHAIN JQ707330_SHBs_P-A of FT:mat_peptide JQ707330_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707331_SHBs_P-A Product feature CHAIN JQ707331_SHBs_P-A of FT:mat_peptide JQ707331_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707332_SHBs_P-A Product feature CHAIN JQ707332_SHBs_P-A of FT:mat_peptide JQ707332_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707333_SHBs_P-A Product feature CHAIN JQ707333_SHBs_P-A of FT:mat_peptide JQ707333_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707336_SHBs_P-A Product feature CHAIN JQ707336_SHBs_P-A of FT:mat_peptide JQ707336_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707337_SHBs_P-A Product feature CHAIN JQ707337_SHBs_P-A of FT:mat_peptide JQ707337_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707338_SHBs_P-A Product feature CHAIN JQ707338_SHBs_P-A of FT:mat_peptide JQ707338_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707339_SHBs_P-A Product feature CHAIN JQ707339_SHBs_P-A of FT:mat_peptide JQ707339_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGTCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707341_SHBs_P-A Product feature CHAIN JQ707341_SHBs_P-A of FT:mat_peptide JQ707341_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707342_SHBs_P-A Product feature CHAIN JQ707342_SHBs_P-A of FT:mat_peptide JQ707342_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTSPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707343_SHBs_P-A Product feature CHAIN JQ707343_SHBs_P-A of FT:mat_peptide JQ707343_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707344_SHBs_P-A Product feature CHAIN JQ707344_SHBs_P-A of FT:mat_peptide JQ707344_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPLSWAFAK
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707345_SHBs_P-A Product feature CHAIN JQ707345_SHBs_P-A of FT:mat_peptide JQ707345_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707346_SHBs_P-A Product feature CHAIN JQ707346_SHBs_P-A of FT:mat_peptide JQ707346_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707347_SHBs_P-A Product feature CHAIN JQ707347_SHBs_P-A of FT:mat_peptide JQ707347_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707348_SHBs_P-A Product feature CHAIN JQ707348_SHBs_P-A of FT:mat_peptide JQ707348_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707349_SHBs_P-A Product feature CHAIN JQ707349_SHBs_P-A of FT:mat_peptide JQ707349_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707350_SHBs_P-A Product feature CHAIN JQ707350_SHBs_P-A of FT:mat_peptide JQ707350_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707351_SHBs_P-A Product feature CHAIN JQ707351_SHBs_P-A of FT:mat_peptide JQ707351_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707352_SHBs_P-A Product feature CHAIN JQ707352_SHBs_P-A of FT:mat_peptide JQ707352_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707353_SHBs_P-A Product feature CHAIN JQ707353_SHBs_P-A of FT:mat_peptide JQ707353_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707354_SHBs_P-A Product feature CHAIN JQ707354_SHBs_P-A of FT:mat_peptide JQ707354_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707355_SHBs_P-A Product feature CHAIN JQ707355_SHBs_P-A of FT:mat_peptide JQ707355_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707356_SHBs_P-A Product feature CHAIN JQ707356_SHBs_P-A of FT:mat_peptide JQ707356_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707357_SHBs_P-A Product feature CHAIN JQ707357_SHBs_P-A of FT:mat_peptide JQ707357_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707358_SHBs_P-A Product feature CHAIN JQ707358_SHBs_P-A of FT:mat_peptide JQ707358_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFLCLWVYI
>gnl|hbvpro|JQ707359_SHBs_P-A Product feature CHAIN JQ707359_SHBs_P-A of FT:mat_peptide JQ707359_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707360_SHBs_P-A Product feature CHAIN JQ707360_SHBs_P-A of FT:mat_peptide JQ707360_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707361_SHBs_P-A Product feature CHAIN JQ707361_SHBs_P-A of FT:mat_peptide JQ707361_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707362_SHBs_P-A Product feature CHAIN JQ707362_SHBs_P-A of FT:mat_peptide JQ707362_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707363_SHBs_P-A Product feature CHAIN JQ707363_SHBs_P-A of FT:mat_peptide JQ707363_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707364_SHBs_P-A Product feature CHAIN JQ707364_SHBs_P-A of FT:mat_peptide JQ707364_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707365_SHBs_P-A Product feature CHAIN JQ707365_SHBs_P-A of FT:mat_peptide JQ707365_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707366_SHBs_P-A Product feature CHAIN JQ707366_SHBs_P-A of FT:mat_peptide JQ707366_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707367_SHBs_P-A Product feature CHAIN JQ707367_SHBs_P-A of FT:mat_peptide JQ707367_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707368_SHBs_P-A Product feature CHAIN JQ707368_SHBs_P-A of FT:mat_peptide JQ707368_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRRMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707369_SHBs_P-A Product feature CHAIN JQ707369_SHBs_P-A of FT:mat_peptide JQ707369_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707370_SHBs_P-A Product feature CHAIN JQ707370_SHBs_P-A of FT:mat_peptide JQ707370_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSTTTSTGTCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707371_SHBs_P-A Product feature CHAIN JQ707371_SHBs_P-A of FT:mat_peptide JQ707371_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707372_SHBs_P-A Product feature CHAIN JQ707372_SHBs_P-A of FT:mat_peptide JQ707372_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTATSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCVPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707373_SHBs_P-A Product feature CHAIN JQ707373_SHBs_P-A of FT:mat_peptide JQ707373_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707374_SHBs_P-A Product feature CHAIN JQ707374_SHBs_P-A of FT:mat_peptide JQ707374_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=226 residues).
VENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707375_SHBs_P-A Product feature CHAIN JQ707375_SHBs_P-A of FT:mat_peptide JQ707375_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707376_SHBs_P-A Product feature CHAIN JQ707376_SHBs_P-A of FT:mat_peptide JQ707376_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707377_SHBs_P-A Product feature CHAIN JQ707377_SHBs_P-A of FT:mat_peptide JQ707377_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707378_SHBs_P-A Product feature CHAIN JQ707378_SHBs_P-A of FT:mat_peptide JQ707378_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707379_SHBs_P-A Product feature CHAIN JQ707379_SHBs_P-A of FT:mat_peptide JQ707379_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707380_SHBs_P-A Product feature CHAIN JQ707380_SHBs_P-A of FT:mat_peptide JQ707380_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707381_SHBs_P-A Product feature CHAIN JQ707381_SHBs_P-A of FT:mat_peptide JQ707381_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707382_SHBs_P-A Product feature CHAIN JQ707382_SHBs_P-A of FT:mat_peptide JQ707382_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707383_SHBs_P-A Product feature CHAIN JQ707383_SHBs_P-A of FT:mat_peptide JQ707383_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707385_SHBs_P-A Product feature CHAIN JQ707385_SHBs_P-A of FT:mat_peptide JQ707385_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707386_SHBs_P-A Product feature CHAIN JQ707386_SHBs_P-A of FT:mat_peptide JQ707386_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707387_SHBs_P-A Product feature CHAIN JQ707387_SHBs_P-A of FT:mat_peptide JQ707387_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707388_SHBs_P-A Product feature CHAIN JQ707388_SHBs_P-A of FT:mat_peptide JQ707388_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707389_SHBs_P-A Product feature CHAIN JQ707389_SHBs_P-A of FT:mat_peptide JQ707389_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707390_SHBs_P-A Product feature CHAIN JQ707390_SHBs_P-A of FT:mat_peptide JQ707390_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707391_SHBs_P-A Product feature CHAIN JQ707391_SHBs_P-A of FT:mat_peptide JQ707391_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLSPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707392_SHBs_P-A Product feature CHAIN JQ707392_SHBs_P-A of FT:mat_peptide JQ707392_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707393_SHBs_P-A Product feature CHAIN JQ707393_SHBs_P-A of FT:mat_peptide JQ707393_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707394_SHBs_P-A Product feature CHAIN JQ707394_SHBs_P-A of FT:mat_peptide JQ707394_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707395_SHBs_P-A Product feature CHAIN JQ707395_SHBs_P-A of FT:mat_peptide JQ707395_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707396_SHBs_P-A Product feature CHAIN JQ707396_SHBs_P-A of FT:mat_peptide JQ707396_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707397_SHBs_P-A Product feature CHAIN JQ707397_SHBs_P-A of FT:mat_peptide JQ707397_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRRMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707398_SHBs_P-A Product feature CHAIN JQ707398_SHBs_P-A of FT:mat_peptide JQ707398_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=226 residues).
MVNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVALSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707399_SHBs_P-A Product feature CHAIN JQ707399_SHBs_P-A of FT:mat_peptide JQ707399_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707400_SHBs_P-A Product feature CHAIN JQ707400_SHBs_P-A of FT:mat_peptide JQ707400_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707402_SHBs_P-A Product feature CHAIN JQ707402_SHBs_P-A of FT:mat_peptide JQ707402_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707403_SHBs_P-A Product feature CHAIN JQ707403_SHBs_P-A of FT:mat_peptide JQ707403_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707404_SHBs_P-A Product feature CHAIN JQ707404_SHBs_P-A of FT:mat_peptide JQ707404_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707405_SHBs_P-A Product feature CHAIN JQ707405_SHBs_P-A of FT:mat_peptide JQ707405_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707406_SHBs_P-A Product feature CHAIN JQ707406_SHBs_P-A of FT:mat_peptide JQ707406_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707407_SHBs_P-A Product feature CHAIN JQ707407_SHBs_P-A of FT:mat_peptide JQ707407_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707408_SHBs_P-A Product feature CHAIN JQ707408_SHBs_P-A of FT:mat_peptide JQ707408_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707409_SHBs_P-A Product feature CHAIN JQ707409_SHBs_P-A of FT:mat_peptide JQ707409_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707410_SHBs_P-A Product feature CHAIN JQ707410_SHBs_P-A of FT:mat_peptide JQ707410_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707411_SHBs_P-A Product feature CHAIN JQ707411_SHBs_P-A of FT:mat_peptide JQ707411_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707412_SHBs_P-A Product feature CHAIN JQ707412_SHBs_P-A of FT:mat_peptide JQ707412_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707413_SHBs_P-A Product feature CHAIN JQ707413_SHBs_P-A of FT:mat_peptide JQ707413_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707414_SHBs_P-A Product feature CHAIN JQ707414_SHBs_P-A of FT:mat_peptide JQ707414_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707415_SHBs_P-A Product feature CHAIN JQ707415_SHBs_P-A of FT:mat_peptide JQ707415_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707416_SHBs_P-A Product feature CHAIN JQ707416_SHBs_P-A of FT:mat_peptide JQ707416_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707417_SHBs_P-A Product feature CHAIN JQ707417_SHBs_P-A of FT:mat_peptide JQ707417_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707418_SHBs_P-A Product feature CHAIN JQ707418_SHBs_P-A of FT:mat_peptide JQ707418_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707419_SHBs_P-A Product feature CHAIN JQ707419_SHBs_P-A of FT:mat_peptide JQ707419_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707420_SHBs_P-A Product feature CHAIN JQ707420_SHBs_P-A of FT:mat_peptide JQ707420_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707531_SHBs_P-A Product feature CHAIN JQ707531_SHBs_P-A of FT:mat_peptide JQ707531_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707532_SHBs_P-A Product feature CHAIN JQ707532_SHBs_P-A of FT:mat_peptide JQ707532_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSKTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFYLWVYI
>gnl|hbvpro|JQ707533_SHBs_P-A Product feature CHAIN JQ707533_SHBs_P-A of FT:mat_peptide JQ707533_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707534_SHBs_P-A Product feature CHAIN JQ707534_SHBs_P-A of FT:mat_peptide JQ707534_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707535_SHBs_P-A Product feature CHAIN JQ707535_SHBs_P-A of FT:mat_peptide JQ707535_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707536_SHBs_P-A Product feature CHAIN JQ707536_SHBs_P-A of FT:mat_peptide JQ707536_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSKTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707537_SHBs_P-A Product feature CHAIN JQ707537_SHBs_P-A of FT:mat_peptide JQ707537_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707538_SHBs_P-A Product feature CHAIN JQ707538_SHBs_P-A of FT:mat_peptide JQ707538_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707539_SHBs_P-A Product feature CHAIN JQ707539_SHBs_P-A of FT:mat_peptide JQ707539_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707540_SHBs_P-A Product feature CHAIN JQ707540_SHBs_P-A of FT:mat_peptide JQ707540_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707541_SHBs_P-A Product feature CHAIN JQ707541_SHBs_P-A of FT:mat_peptide JQ707541_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707542_SHBs_P-A Product feature CHAIN JQ707542_SHBs_P-A of FT:mat_peptide JQ707542_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707543_SHBs_P-A Product feature CHAIN JQ707543_SHBs_P-A of FT:mat_peptide JQ707543_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707544_SHBs_P-A Product feature CHAIN JQ707544_SHBs_P-A of FT:mat_peptide JQ707544_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707545_SHBs_P-A Product feature CHAIN JQ707545_SHBs_P-A of FT:mat_peptide JQ707545_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707546_SHBs_P-A Product feature CHAIN JQ707546_SHBs_P-A of FT:mat_peptide JQ707546_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707547_SHBs_P-A Product feature CHAIN JQ707547_SHBs_P-A of FT:mat_peptide JQ707547_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPVIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707548_SHBs_P-A Product feature CHAIN JQ707548_SHBs_P-A of FT:mat_peptide JQ707548_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707549_SHBs_P-A Product feature CHAIN JQ707549_SHBs_P-A of FT:mat_peptide JQ707549_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMIWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707550_SHBs_P-A Product feature CHAIN JQ707550_SHBs_P-A of FT:mat_peptide JQ707550_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFAQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707551_SHBs_P-A Product feature CHAIN JQ707551_SHBs_P-A of FT:mat_peptide JQ707551_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707552_SHBs_P-A Product feature CHAIN JQ707552_SHBs_P-A of FT:mat_peptide JQ707552_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707553_SHBs_P-A Product feature CHAIN JQ707553_SHBs_P-A of FT:mat_peptide JQ707553_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707554_SHBs_P-A Product feature CHAIN JQ707554_SHBs_P-A of FT:mat_peptide JQ707554_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSTFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707555_SHBs_P-A Product feature CHAIN JQ707555_SHBs_P-A of FT:mat_peptide JQ707555_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707556_SHBs_P-A Product feature CHAIN JQ707556_SHBs_P-A of FT:mat_peptide JQ707556_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707557_SHBs_P-A Product feature CHAIN JQ707557_SHBs_P-A of FT:mat_peptide JQ707557_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707558_SHBs_P-A Product feature CHAIN JQ707558_SHBs_P-A of FT:mat_peptide JQ707558_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707559_SHBs_P-A Product feature CHAIN JQ707559_SHBs_P-A of FT:mat_peptide JQ707559_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707560_SHBs_P-A Product feature CHAIN JQ707560_SHBs_P-A of FT:mat_peptide JQ707560_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707561_SHBs_P-A Product feature CHAIN JQ707561_SHBs_P-A of FT:mat_peptide JQ707561_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707562_SHBs_P-A Product feature CHAIN JQ707562_SHBs_P-A of FT:mat_peptide JQ707562_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707563_SHBs_P-A Product feature CHAIN JQ707563_SHBs_P-A of FT:mat_peptide JQ707563_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707564_SHBs_P-A Product feature CHAIN JQ707564_SHBs_P-A of FT:mat_peptide JQ707564_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWPLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707565_SHBs_P-A Product feature CHAIN JQ707565_SHBs_P-A of FT:mat_peptide JQ707565_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707566_SHBs_P-A Product feature CHAIN JQ707566_SHBs_P-A of FT:mat_peptide JQ707566_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707567_SHBs_P-A Product feature CHAIN JQ707567_SHBs_P-A of FT:mat_peptide JQ707567_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707568_SHBs_P-A Product feature CHAIN JQ707568_SHBs_P-A of FT:mat_peptide JQ707568_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707569_SHBs_P-A Product feature CHAIN JQ707569_SHBs_P-A of FT:mat_peptide JQ707569_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707570_SHBs_P-A Product feature CHAIN JQ707570_SHBs_P-A of FT:mat_peptide JQ707570_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707571_SHBs_P-A Product feature CHAIN JQ707571_SHBs_P-A of FT:mat_peptide JQ707571_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C7). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707572_SHBs_P-A Product feature CHAIN JQ707572_SHBs_P-A of FT:mat_peptide JQ707572_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707573_SHBs_P-A Product feature CHAIN JQ707573_SHBs_P-A of FT:mat_peptide JQ707573_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707575_SHBs_P-A Product feature CHAIN JQ707575_SHBs_P-A of FT:mat_peptide JQ707575_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707576_SHBs_P-A Product feature CHAIN JQ707576_SHBs_P-A of FT:mat_peptide JQ707576_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707577_SHBs_P-A Product feature CHAIN JQ707577_SHBs_P-A of FT:mat_peptide JQ707577_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707578_SHBs_P-A Product feature CHAIN JQ707578_SHBs_P-A of FT:mat_peptide JQ707578_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMIPYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707579_SHBs_P-A Product feature CHAIN JQ707579_SHBs_P-A of FT:mat_peptide JQ707579_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707580_SHBs_P-A Product feature CHAIN JQ707580_SHBs_P-A of FT:mat_peptide JQ707580_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFGLWVYI
>gnl|hbvpro|JQ707581_SHBs_P-A Product feature CHAIN JQ707581_SHBs_P-A of FT:mat_peptide JQ707581_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTEPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707583_SHBs_P-A Product feature CHAIN JQ707583_SHBs_P-A of FT:mat_peptide JQ707583_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMISYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707585_SHBs_P-A Product feature CHAIN JQ707585_SHBs_P-A of FT:mat_peptide JQ707585_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707586_SHBs_P-A Product feature CHAIN JQ707586_SHBs_P-A of FT:mat_peptide JQ707586_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707587_SHBs_P-A Product feature CHAIN JQ707587_SHBs_P-A of FT:mat_peptide JQ707587_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFFLWVYI
>gnl|hbvpro|JQ707589_SHBs_P-A Product feature CHAIN JQ707589_SHBs_P-A of FT:mat_peptide JQ707589_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPIVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707590_SHBs_P-A Product feature CHAIN JQ707590_SHBs_P-A of FT:mat_peptide JQ707590_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWPLAMWMMWYWAPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707592_SHBs_P-A Product feature CHAIN JQ707592_SHBs_P-A of FT:mat_peptide JQ707592_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707594_SHBs_P-A Product feature CHAIN JQ707594_SHBs_P-A of FT:mat_peptide JQ707594_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707595_SHBs_P-A Product feature CHAIN JQ707595_SHBs_P-A of FT:mat_peptide JQ707595_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHLPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCPWVYI
>gnl|hbvpro|JQ707596_SHBs_P-A Product feature CHAIN JQ707596_SHBs_P-A of FT:mat_peptide JQ707596_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYPWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707599_SHBs_P-A Product feature CHAIN JQ707599_SHBs_P-A of FT:mat_peptide JQ707599_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707601_SHBs_P-A Product feature CHAIN JQ707601_SHBs_P-A of FT:mat_peptide JQ707601_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYT
>gnl|hbvpro|JQ707603_SHBs_P-A Product feature CHAIN JQ707603_SHBs_P-A of FT:mat_peptide JQ707603_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPHVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707604_SHBs_P-A Product feature CHAIN JQ707604_SHBs_P-A of FT:mat_peptide JQ707604_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWPSAIWMISYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707605_SHBs_P-A Product feature CHAIN JQ707605_SHBs_P-A of FT:mat_peptide JQ707605_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGGLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707606_SHBs_P-A Product feature CHAIN JQ707606_SHBs_P-A of FT:mat_peptide JQ707606_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707607_SHBs_P-A Product feature CHAIN JQ707607_SHBs_P-A of FT:mat_peptide JQ707607_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMISYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707608_SHBs_P-A Product feature CHAIN JQ707608_SHBs_P-A of FT:mat_peptide JQ707608_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWGWASVRFSWLSLLVPFVQWFVGLSPTVWPLAMWMMWYWGPSLYSIVRPFIPLLLIFFCLWVYI
>gnl|hbvpro|JQ707609_SHBs_P-A Product feature CHAIN JQ707609_SHBs_P-A of FT:mat_peptide JQ707609_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707610_SHBs_P-A Product feature CHAIN JQ707610_SHBs_P-A of FT:mat_peptide JQ707610_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707611_SHBs_P-A Product feature CHAIN JQ707611_SHBs_P-A of FT:mat_peptide JQ707611_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707612_SHBs_P-A Product feature CHAIN JQ707612_SHBs_P-A of FT:mat_peptide JQ707612_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707613_SHBs_P-A Product feature CHAIN JQ707613_SHBs_P-A of FT:mat_peptide JQ707613_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707614_SHBs_P-A Product feature CHAIN JQ707614_SHBs_P-A of FT:mat_peptide JQ707614_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707615_SHBs_P-A Product feature CHAIN JQ707615_SHBs_P-A of FT:mat_peptide JQ707615_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707616_SHBs_P-A Product feature CHAIN JQ707616_SHBs_P-A of FT:mat_peptide JQ707616_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707617_SHBs_P-A Product feature CHAIN JQ707617_SHBs_P-A of FT:mat_peptide JQ707617_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707618_SHBs_P-A Product feature CHAIN JQ707618_SHBs_P-A of FT:mat_peptide JQ707618_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707619_SHBs_P-A Product feature CHAIN JQ707619_SHBs_P-A of FT:mat_peptide JQ707619_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707620_SHBs_P-A Product feature CHAIN JQ707620_SHBs_P-A of FT:mat_peptide JQ707620_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707621_SHBs_P-A Product feature CHAIN JQ707621_SHBs_P-A of FT:mat_peptide JQ707621_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707622_SHBs_P-A Product feature CHAIN JQ707622_SHBs_P-A of FT:mat_peptide JQ707622_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707623_SHBs_P-A Product feature CHAIN JQ707623_SHBs_P-A of FT:mat_peptide JQ707623_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707624_SHBs_P-A Product feature CHAIN JQ707624_SHBs_P-A of FT:mat_peptide JQ707624_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707625_SHBs_P-A Product feature CHAIN JQ707625_SHBs_P-A of FT:mat_peptide JQ707625_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707626_SHBs_P-A Product feature CHAIN JQ707626_SHBs_P-A of FT:mat_peptide JQ707626_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707627_SHBs_P-A Product feature CHAIN JQ707627_SHBs_P-A of FT:mat_peptide JQ707627_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707629_SHBs_P-A Product feature CHAIN JQ707629_SHBs_P-A of FT:mat_peptide JQ707629_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707630_SHBs_P-A Product feature CHAIN JQ707630_SHBs_P-A of FT:mat_peptide JQ707630_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707631_SHBs_P-A Product feature CHAIN JQ707631_SHBs_P-A of FT:mat_peptide JQ707631_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707632_SHBs_P-A Product feature CHAIN JQ707632_SHBs_P-A of FT:mat_peptide JQ707632_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707633_SHBs_P-A Product feature CHAIN JQ707633_SHBs_P-A of FT:mat_peptide JQ707633_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707634_SHBs_P-A Product feature CHAIN JQ707634_SHBs_P-A of FT:mat_peptide JQ707634_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707635_SHBs_P-A Product feature CHAIN JQ707635_SHBs_P-A of FT:mat_peptide JQ707635_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNGTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707636_SHBs_P-A Product feature CHAIN JQ707636_SHBs_P-A of FT:mat_peptide JQ707636_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707637_SHBs_P-A Product feature CHAIN JQ707637_SHBs_P-A of FT:mat_peptide JQ707637_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707638_SHBs_P-A Product feature CHAIN JQ707638_SHBs_P-A of FT:mat_peptide JQ707638_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707639_SHBs_P-A Product feature CHAIN JQ707639_SHBs_P-A of FT:mat_peptide JQ707639_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707640_SHBs_P-A Product feature CHAIN JQ707640_SHBs_P-A of FT:mat_peptide JQ707640_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707641_SHBs_P-A Product feature CHAIN JQ707641_SHBs_P-A of FT:mat_peptide JQ707641_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707642_SHBs_P-A Product feature CHAIN JQ707642_SHBs_P-A of FT:mat_peptide JQ707642_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707643_SHBs_P-A Product feature CHAIN JQ707643_SHBs_P-A of FT:mat_peptide JQ707643_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707644_SHBs_P-A Product feature CHAIN JQ707644_SHBs_P-A of FT:mat_peptide JQ707644_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707645_SHBs_P-A Product feature CHAIN JQ707645_SHBs_P-A of FT:mat_peptide JQ707645_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707646_SHBs_P-A Product feature CHAIN JQ707646_SHBs_P-A of FT:mat_peptide JQ707646_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707647_SHBs_P-A Product feature CHAIN JQ707647_SHBs_P-A of FT:mat_peptide JQ707647_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707648_SHBs_P-A Product feature CHAIN JQ707648_SHBs_P-A of FT:mat_peptide JQ707648_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707649_SHBs_P-A Product feature CHAIN JQ707649_SHBs_P-A of FT:mat_peptide JQ707649_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707650_SHBs_P-A Product feature CHAIN JQ707650_SHBs_P-A of FT:mat_peptide JQ707650_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707651_SHBs_P-A Product feature CHAIN JQ707651_SHBs_P-A of FT:mat_peptide JQ707651_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707652_SHBs_P-A Product feature CHAIN JQ707652_SHBs_P-A of FT:mat_peptide JQ707652_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707653_SHBs_P-A Product feature CHAIN JQ707653_SHBs_P-A of FT:mat_peptide JQ707653_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707654_SHBs_P-A Product feature CHAIN JQ707654_SHBs_P-A of FT:mat_peptide JQ707654_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707655_SHBs_P-A Product feature CHAIN JQ707655_SHBs_P-A of FT:mat_peptide JQ707655_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707656_SHBs_P-A Product feature CHAIN JQ707656_SHBs_P-A of FT:mat_peptide JQ707656_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707658_SHBs_P-A Product feature CHAIN JQ707658_SHBs_P-A of FT:mat_peptide JQ707658_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707659_SHBs_P-A Product feature CHAIN JQ707659_SHBs_P-A of FT:mat_peptide JQ707659_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707661_SHBs_P-A Product feature CHAIN JQ707661_SHBs_P-A of FT:mat_peptide JQ707661_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707662_SHBs_P-A Product feature CHAIN JQ707662_SHBs_P-A of FT:mat_peptide JQ707662_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707663_SHBs_P-A Product feature CHAIN JQ707663_SHBs_P-A of FT:mat_peptide JQ707663_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVYPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707664_SHBs_P-A Product feature CHAIN JQ707664_SHBs_P-A of FT:mat_peptide JQ707664_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707665_SHBs_P-A Product feature CHAIN JQ707665_SHBs_P-A of FT:mat_peptide JQ707665_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707667_SHBs_P-A Product feature CHAIN JQ707667_SHBs_P-A of FT:mat_peptide JQ707667_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707669_SHBs_P-A Product feature CHAIN JQ707669_SHBs_P-A of FT:mat_peptide JQ707669_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707670_SHBs_P-A Product feature CHAIN JQ707670_SHBs_P-A of FT:mat_peptide JQ707670_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707672_SHBs_P-A Product feature CHAIN JQ707672_SHBs_P-A of FT:mat_peptide JQ707672_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707674_SHBs_P-A Product feature CHAIN JQ707674_SHBs_P-A of FT:mat_peptide JQ707674_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707675_SHBs_P-A Product feature CHAIN JQ707675_SHBs_P-A of FT:mat_peptide JQ707675_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707676_SHBs_P-A Product feature CHAIN JQ707676_SHBs_P-A of FT:mat_peptide JQ707676_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ707681_SHBs_P-A Product feature CHAIN JQ707681_SHBs_P-A of FT:mat_peptide JQ707681_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811853_SHBs_P-A Product feature CHAIN JQ811853_SHBs_P-A of FT:mat_peptide JQ811853_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMC29). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFQGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811854_SHBs_P-A Product feature CHAIN JQ811854_SHBs_P-A of FT:mat_peptide JQ811854_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB157). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811855_SHBs_P-A Product feature CHAIN JQ811855_SHBs_P-A of FT:mat_peptide JQ811855_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMC3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYSGGTLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811856_SHBs_P-A Product feature CHAIN JQ811856_SHBs_P-A of FT:mat_peptide JQ811856_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB93). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811857_SHBs_P-A Product feature CHAIN JQ811857_SHBs_P-A of FT:mat_peptide JQ811857_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB127). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811858_SHBs_P-A Product feature CHAIN JQ811858_SHBs_P-A of FT:mat_peptide JQ811858_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB96). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811859_SHBs_P-A Product feature CHAIN JQ811859_SHBs_P-A of FT:mat_peptide JQ811859_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811860_SHBs_P-A Product feature CHAIN JQ811860_SHBs_P-A of FT:mat_peptide JQ811860_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMC31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811861_SHBs_P-A Product feature CHAIN JQ811861_SHBs_P-A of FT:mat_peptide JQ811861_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSHVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811862_SHBs_P-A Product feature CHAIN JQ811862_SHBs_P-A of FT:mat_peptide JQ811862_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPLCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYIK
>gnl|hbvpro|JQ811863_SHBs_P-A Product feature CHAIN JQ811863_SHBs_P-A of FT:mat_peptide JQ811863_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB141). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ811888_SHBs_P-A Product feature CHAIN JQ811888_SHBs_P-A of FT:mat_peptide JQ811888_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SCB97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ911742_SHBs_P-A Product feature CHAIN JQ911742_SHBs_P-A of FT:mat_peptide JQ911742_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX096952_SHBs_P-A Product feature CHAIN JX096952_SHBs_P-A of FT:mat_peptide JX096952_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX096953_SHBs_P-A Product feature CHAIN JX096953_SHBs_P-A of FT:mat_peptide JX096953_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX125364_SHBs_P-A Product feature CHAIN JX125364_SHBs_P-A of FT:mat_peptide JX125364_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I-NUK622). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLSILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX125367_SHBs_P-A Product feature CHAIN JX125367_SHBs_P-A of FT:mat_peptide JX125367_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Y-PUR1550). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX125368_SHBs_P-A Product feature CHAIN JX125368_SHBs_P-A of FT:mat_peptide JX125368_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Y-PUR333). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX154579_SHBs_P-A Product feature CHAIN JX154579_SHBs_P-A of FT:mat_peptide JX154579_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQSMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX154580_SHBs_P-A Product feature CHAIN JX154580_SHBs_P-A of FT:mat_peptide JX154580_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQSMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX154581_SHBs_P-A Product feature CHAIN JX154581_SHBs_P-A of FT:mat_peptide JX154581_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQSMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX154582_SHBs_P-A Product feature CHAIN JX154582_SHBs_P-A of FT:mat_peptide JX154582_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQSMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310721_SHBs_P-A Product feature CHAIN JX310721_SHBs_P-A of FT:mat_peptide JX310721_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310722_SHBs_P-A Product feature CHAIN JX310722_SHBs_P-A of FT:mat_peptide JX310722_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVSFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310723_SHBs_P-A Product feature CHAIN JX310723_SHBs_P-A of FT:mat_peptide JX310723_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSALLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310724_SHBs_P-A Product feature CHAIN JX310724_SHBs_P-A of FT:mat_peptide JX310724_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310725_SHBs_P-A Product feature CHAIN JX310725_SHBs_P-A of FT:mat_peptide JX310725_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310730_SHBs_P-A Product feature CHAIN JX310730_SHBs_P-A of FT:mat_peptide JX310730_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310731_SHBs_P-A Product feature CHAIN JX310731_SHBs_P-A of FT:mat_peptide JX310731_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX310732_SHBs_P-A Product feature CHAIN JX310732_SHBs_P-A of FT:mat_peptide JX310732_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849294_SHBs_P-A Product feature CHAIN JX849294_SHBs_P-A of FT:mat_peptide JX849294_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO088_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849295_SHBs_P-A Product feature CHAIN JX849295_SHBs_P-A of FT:mat_peptide JX849295_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO092_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849296_SHBs_P-A Product feature CHAIN JX849296_SHBs_P-A of FT:mat_peptide JX849296_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO100_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849297_SHBs_P-A Product feature CHAIN JX849297_SHBs_P-A of FT:mat_peptide JX849297_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO101_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLXDYQGMLPVCPLIPGSTTTSTGPCKTCTXPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMILYWGPSLYSIVXPFIPLLXIFFCLWVYI
>gnl|hbvpro|JX849298_SHBs_P-A Product feature CHAIN JX849298_SHBs_P-A of FT:mat_peptide JX849298_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO104_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMIPSCCCTKPTDANCTCIPIPSSWAFAK
YLWEWASVRFFWLSSLAPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVRPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849299_SHBs_P-A Product feature CHAIN JX849299_SHBs_P-A of FT:mat_peptide JX849299_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO108_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849300_SHBs_P-A Product feature CHAIN JX849300_SHBs_P-A of FT:mat_peptide JX849300_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO111_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSTTTSTGPCKTCTTPAQGNSMFPXCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849301_SHBs_P-A Product feature CHAIN JX849301_SHBs_P-A of FT:mat_peptide JX849301_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO113_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFVK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNISSPFIPLLPIFXCLWVYI
>gnl|hbvpro|JX849305_SHBs_P-A Product feature CHAIN JX849305_SHBs_P-A of FT:mat_peptide JX849305_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO121_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSXGPCKTCTTPAQGXSMFPSCCCTKPXDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPRLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849306_SHBs_P-A Product feature CHAIN JX849306_SHBs_P-A of FT:mat_peptide JX849306_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO124_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGXCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFXK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849307_SHBs_P-A Product feature CHAIN JX849307_SHBs_P-A of FT:mat_peptide JX849307_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO126_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGXLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQXPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIXLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFXK
XLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNIXSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849308_SHBs_P-A Product feature CHAIN JX849308_SHBs_P-A of FT:mat_peptide JX849308_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO131_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMXXYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849309_SHBs_P-A Product feature CHAIN JX849309_SHBs_P-A of FT:mat_peptide JX849309_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ICO132_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLYILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX849311_SHBs_P-A Product feature CHAIN JX849311_SHBs_P-A of FT:mat_peptide JX849311_SHBs_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PTV006_A). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTXPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFXCLXVYI
>gnl|hbvpro|JX