HBVdb

Dataset for protein HBc of genotype A

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  ..    :*:  .:  .*  . :*   :   :        *         *.*              :  * . *    
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLATWVGNNLeDP
           sa       a  y  a          f ds       t     i   vv  vdvt n gs   t  q q
                                                                             d  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ..     ::.   .         .  .  **   .  ::   * *:     :    .**:.  *:    *         
ASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDR-GRSP
    q          i             dv              p   q          ca i c g      
                                 qi                                             

       170       180        
....:....|....:....|....:...
     :       **   .         
RRRTPSPRRRRSQSPRRRRSQSRESQC-
                       gp-- 
                            
© 1998-2019