HBVdb

Dataset for protein LHBs of genotype A

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             .*    :  .: .  :*. .*  .: . *   :           :    : *   ** *       :
MGGWSsKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKDHWPaANQVGVGAFGPGlTPPHGGiLGWSPQ
    lpt                 l                     hv     q            f      v      
    ia                                         t     t                          
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .  * .                                           . *         .    
AQGiLtTVstiPPPASTNRQSGRQPTPISPPLRD--SHPQAMQWNSTAFHQALQDPRVRGLYfPAGGSSSGTvNPaPNIA
   m aklpav  t  a   t                    t  t  t   t l  k k   l        il  vqttv
   t  p  v          p                    v           k                  f       
                                         i                                      
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           .      .                     :  :    .     :          * .*  *  *.  * 
SHISSISaRTGDPvtNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGsPVCLGQNSQSPTSNHSPTS
     t sti   apt       l r                             s   epte r               
              l                                             a                   
              s                                                                 
              a                                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .    .   : **   :    *   *    *   . ..   * .    .    :          .*.. .   *  *  
CPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLDYQGMLPVCPLIPGSTTTST--GPCKTCTTPAQGNSMFPSCCCTK
   t                                c  i         ta       t r   s    t  i       
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .  *      .      **    . :      ..:.. :              :  ..            :   *  
PTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSaiWMMWYWGPSLYsIvsPFIPLLPIFFC
 maa               f  g   a               a        lvm  i   r fntlr      l  lf
                      d                                     n h               
                                                                                
                                                                                

     
....:
 *   
LWVYI
  a  
     
     
     
© 1998-2019