HBVdb

Dataset for protein MHBs of genotype A

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      . *         .               .      .                     :
MQWNSTAFHQALQDPRVRGLYfPAGGSSSGTvNPaPNIASHISSISaRTGDPvtNMENITSGFLGPLLVLQAGFFLLTRI
t- t  t   t l  k k   l        il  v ttv     t sti   apt       l r             k 
v           k                  f                     l                          
i                                                    s                          
-                                                    a                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :    .     :          * .   *  *.  *  .    .   : *.   :    *   *    *     ..  
LTIPQSLDSWWTSLNFLGGsPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLDYQGML
              s   ep e r                  t                                c    
                   a                                                            
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * .         :           *.. .   *  *     .  *      .      **    . :      ..:.. 
PVCPLIPGSTTTST--GPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQW
         a       t r        t  i        maa               f  g   a              
                                                             d                  
                                                                                
                                                                                

       250       260       270       280     
....:....|....:....|....:....|....:....|....:
:              :   .            :   *   *    
FVGLSPTVWLSaiWMMWYWGPSLYsIvsPFIPLLPIFFCLWVYI-
 a        lvm  il    r hntlr      l  lf  a   
                s    n f                     
                                             
                                             
© 1998-2019