HBVdb

Dataset for protein Pol of genotype A

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  ***  *   ::.:      * : :   * *     . :.   :*    *.:. * : *.  ****   .     *  *
MPLSYQHFRKLLLLDDgT-EAGPLEEELPRLADaDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTP
        l      vea  v    d       e   h          p                   s  v   d    
               e                                                       n        
                                                                       s        
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ** * *. .:   *  : *    :*.   .   **       .*  *   *   *      ***  .:*:  *.  * :
SFPKIHLqEDIiNRCQQFVGPLTVNEKRRLKLIMPARFYPthTKYLPLDKGIKPYYPDqVVNHYFQTRHYLHTLWKAGIL
       h   ad        a                ns    h        ehi     ka             
           sh                            r                                      
           v                                                                    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :  :*   *    **           .   . :    :  *:  ..  *. :  :  :     :  :  :     
YKRETTRSASFCGSPYSWEQELqHGRLVikTSQRHGDEsFCSQpSGILSRSSVGPCIRSQlKQSRLGLQPHQGPLAsSQp
    s                 h ---dtqa       pi pksa       sg            r rs  t  s
                           -sn         v f             r              q     n   
                            -                                                   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .      .      ..                 *.                                      
GRSGSIRARvHpsTRRcFGVEPSGSGHIdhSvnnSSSCLHQSAVRKAAYSHLSTSKR--QSSSGHAVEfHclPPSSAgSQ
      wp a sp   ys         vgyfassa h  r   d tt ht f        p   rt dl sfssnatrp 
                 l         t ni g          a                    n     n     e   
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          . *.   **  : ::.     .  *** .  :  *    :*  :*. :::* *.*:*  : .***:*   
SQGsVfSCWWLQFRNskPCSeYCLSHLVNLrEDWGPCdEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQF
g  p sp        tq   k   ii  ld     ad       t k                   t           
               i    n                tn                                         
                    q                v                                          
                                     f                                          
                                     g                                          

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .    *.*..** ** *****:  . *.*:* *.**** *:****: **.*:: *  *:  :  *:    .        
SRGiTRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPA-AMPHLLIGSSGLSRYVARLSSNSRInNNQyGT
   ts                                                 v ta  pg          nh h h n
   l                                                                            
   v                                                                            
   s                                                                            
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .:*  *:   * .::**   :* : *:   *  :. **  **:. **  ::: ..   *      *. :.: * :* :
mQNLHDSCSRQLYVSLMLLYKTYGwKLHLYSHPIvLGFRKIPMGVGLSPFLlAQFTSAICSVVRRAFPHCLAFSYmDDVV
d     h     l   q   r         i         l      m                       v  i 
                                                                           i  l 
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :               *: ::* ::.  ** .***:*    : *  *  :*:    .    *:   * :   **. **
LGAKSVQHrEsLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYiIGSWGTLPQDHIVQKIKhCFRKLPVNRPIDWKVCQ
    ta  l a f       f                  h    v     s   e  i  l n      id  v      
                                                              c                 
                                                              q                 
                                                              d                 
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :..:*.:  . :** ***  ***: :::. :   * . ..:*   *     ..*:*  :*** **  * * . . *   
RIVGLLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSkQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQR
                             r             nq  ld                             
                                           rt                                   
                                                                                
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: . :    . * .    . :*    *  :*  ** *  .   :..*.::    *.:*  *      * **    **   
MRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGR
                            n                       a                           
                            t                                                   
                                                                                
                                                                                
                                                                                

       810       820       830       840       850
....:....|....:....|....:....|....:....|....:....|
     *                   * ** . .       *         
LGLsRPLLRLPfqPTTGRTSLYAVSPSVPSHLPvRVHFASPLHVAWRPP-
   y       yr          d         d            k   
                                                  
                                                  
                                                  
                                                  
© 1998-2019