HBVdb

Dataset for protein SHBs of genotype A

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :                        .        .           .         
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGsPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
       l r             k               s   eat  r                  t            
                                           xp                      x            
                                            x                                   
                                            t                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            .                                                   
IIFLFILL-LCLIFLLVLLDYQGMLPVCPLIPGSTTTST--GPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWA
                    c             a       t r        t           s              
                                  s                                             
                                                                                
                                                                                

       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            :         ..                                 :            
FAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSaiWMMWYWGPSLYsIvsPFIPLLPIFFCLWVYI-
   f  g   a             x a    i   lvml ilf   n cntlr  l   l  l   a   
   x  d                                       x  x  x                 
                                              r                       
                                                                      
© 1998-2019