HBVdb

Dataset for protein HBSP of genotype B

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *    *     :      * .    :    :.   :                   .  *   :          .  *.
MPLSYQHFRKLLLLDeeAGPLEEELPRLADEGLNRRVAEDLNLG-NLNDHQqPAPDHAkPAqLLLKEPLCFPHVAVQNLR
      r  r    edd         h    d  h   de     dp  prp  r   eh rr  e   r        
               kg                                r r       x   t              
               n                                                                
               q                                                                

        90       100       110   
....:....|....:....|....:....|...
   * :*.*          *   * **   .  
TETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY-
m i l     rp     s         h   
                                 
                                 
                                 
© 1998-2019