HBVdb

Dataset for protein HBe of genotype B

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           . .    .:      .    . . *          .  : . .        :         :     . 
-MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
 lr      v                  xd    t      ta         t    nv       t  h          
                                  h       m                       a             
                                          g                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :  .    .     *. .   .*         *   .        .   .      *        *.  *  :  
SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVsYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRT
t       vv  dd  t    e n  d  s  da  g   t   i l  i            d               
                                      n         v                               
                                                                                

       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
   * *   * *. :    :          *                         
PPAYRPpNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC-
 tp   qx          a i q c t                     k   p   
 sg                   g                                 
                                                        
© 1998-2019