HBVdb

Dataset for protein HBe of genotype C

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       ::  *      :    :      *                                  .     :        
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCSP
il            s             d    t       a        a     v   i   t  h          t 
                            s    h                                              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .            *..*   *            :.                               ..     :  
HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVsYVNVNMGLKiRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPp
        vv  v          g  d q   d i g   i     l  i            d                t
                                                                               l

       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
 *    :                       . . .    ..      .        
AYRPPNAPILSTLPETTVV--RRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC-
p   q             i   q c t                     k  gp   
                      c                                 
© 1998-2019