HBVdb

Dataset for protein MHBs of genotype D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .             .          .                   .*    :  *  *  : *        
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTaSpiSSIFSRIGDpALNMENITSGFLGPLLVLQAGFFLLTRI
i  tyk    a    k k   l     t eaa   l  v hll    k  glvp   s    l           s   k 
                 s                       t           q                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *    .:*   *        . *      * * ..      .                .*   *  :   .   
LTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
    k         s    n   r                          y                        r    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *          ..                         *    . * * :***    .:*. *        .  .  .
VCPLIP--GS---STTStGPCRTCtTpaQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFV
   ml            v s k  mitvr a  f     i  l r             a    a  l      n      
                 a        l                                                     
                          i                                                     

       250       260       270       280      
....:....|....:....|....:....|....:....|....:.
.                   .                         
QWFVGLSPTVWLSVIWMMWYWGPSLYsILSPFLPLLPIFFCLWVYI
        i   l ml       n frt r  il     ls  a  
               s       r cn                   
                          t                   
© 1998-2019