HBVdb

Dataset for protein SHBs of genotype D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              : .       .       
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
  s    l           s   k     k         s   en   r                          y    
       x                     x                                                  
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   .        .   
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIP--GSSTTStGPCRTCTTpaQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
 x                  h        l         v s k  m tvr    f     i  l               
                    r        x         a t      l      x                        
                                                i                               
                                                                                

       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
    .                                       .                          
GKFLWEWASARFSWLSLLVPFVQWFVGLS--PTVWLSVIWMMWYWGPsLYsILSPFLPLLPIFFCLWVYI-
a        v      s        a      i   l ml       r cnt r  i      l   a   
                                x   x          n xrx    x              
                                               x fx                    
                                                  t                    
© 1998-2019