HBVdb

Dataset for protein HBSP of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****   :   *:**  :* ::: ** * :  *  .* .:**     * .         *.  :   *  *:. .*.   
MPLSYQHFRRiLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQPPVRDPAEPARLLLKEPLCFPHVAVQNLRT
     p  lsl         d   h             fhv d p   a   v               a       
         k                l                   t                                 

        90       100       110 
....:....|....:....|....:....|.
: * * **.* **  *:** **  ** .*: 
EIALVFPSHHHGLSENSYGSGPQPVSPGSVY
                   g      l    
                               
© 1998-2019