HBVdb

Dataset for protein HBe of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  **  ****  : ** ** *:.****  * **.:* ***:     * * *** *: **: *. :*  :*::* :* :  
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
              l          xd           se              k         e        t  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*  :.:. :***    : **** :*:*  ..: :*.*.*   .:** :** :* * :*:**: . :* ** *  * **  
HTALRQAILCWGeLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
            dv ni     a          g     v                   d  l             
               s      g                                         v             

       170       180       190       200       210     
....:....|....:....|....:....|....:....|....:....|....:
*** **** ** **  *:*.*   *...* :.** . *::* *  ****  .   
YRPPNAPILSTLPENTVVRRR--GRSPRRRTPSPRRRRSQSPRRRRSQSpaSQC-
                                               re k  
                                                       
© 1998-2019