HBVdb

Dataset for protein LHBs of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***** ***.  *** :.   **  *:***** * **: .**** **  ::*  ..:***.:* .* :* **.::* .* 
MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQ
               q  s     l         k   k     n      d            l         s   
               y                            l        a                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *     *  .*  *  .   * ***** .** *    :  *   *.:             .**    .. ** .: * 
AQGMLkTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYfPAGGSSSGTVNPVPTTASL
   iqtmv tn                            i   yka   t    k k---l      f   s     v  
     qs                                v                t   -                   
     n                                                                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *.  *  *  . .:   ** :* **  ** **  * * *.**:.******** ::*  *   *** .   ..*   *.*
ISSIFSRIGDPAPNMEsITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPtSnHSPTSCP
          l    dg                         n        s   es   r   l   i s  l    
                n                                         t   p                 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   ** * *  **:  :***** ***    *    *:*  *.  * ..*. :*  *:*** .:  *  * *** *.:  *
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGN
 t                                h i      l   p            p            l      
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*** *******  *:** **  *   :. **  ..**.***  . * . **** *.  *      *  *  *   **.: 
CTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
                 g                r  v    i             rr n t     l xl      a  
                 v                                       n                      
                                                                                
© 1998-2019