HBVdb

Dataset for protein MHBs of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:  *   *.:             .**    .. ** .: *  *.  *  *. . .:   ** :* **  ** **  * * 
MQWNSTTFHQALQDPRVRGLYfPAGGSSSGTVNPVPTTASLISSIFSRIGDPAPNMEsITSGFLGPLLVLQAGFFLLTKI
i    ka   t    k k   l      f   s     v            l    dg   r                
v                    -                                   n                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*.**:.******** ::*  *   *** .   ..*   *.*   **:* *  **:  :***** ***    *    *:* 
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPtSnHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
     n        s   es   r   l   i s  l     t                                h i  
                   v   p                                                        
                   t                                                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *.  * .... :*  *:*** .:  *  * *** *.   **** *******  *:** **  *   :. **  ..**.*
VCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAG
    l   p            p            l                       g                r  v 
                                                          v                     
                                                                                

       250       260       270       280 
....:....|....:....|....:....|....:....|.
**  . * . **** *.  *   :  *  *  *   **.: 
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
   i             rr n t     l xl      a  
                  n                      
                                         
© 1998-2019