HBVdb

Dataset for protein Pol of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *   :   *:**    :* ::: ** * :  *  .* .:**      .** . *** .:*:**:    *:   :.  
MPLSYQHFRRiLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPS
     p  lsl    d        d   h              hv d                 t l i  sh  p f
         k                  l                                             s     
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** ***: *:: .* ::******::.***.*  **.*:*  *:* *  :* *.**   : *****.**** ***  * **
FPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILY
  n         r                k            f  d    s   e l                   
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.*  :  *** *  * .*  : **.*   .: : *::     : *   *. **. .  ::  .*** :*.** *   : *
KRETTRSASFcGSPYSWEQELHHGAFLDGPSRM-GEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDrSQQG
    s     f     hd    t v         klv lk f      s    veypq    s  h  s  gr   
          y                           i                l          q             
          w                                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**  :     . ...  * * :** :    *           ..  * .: : :*  .*.    *   *.  *:      
RSGSIrAgVHSPTRRPFGVEPSGSRHAkNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNIPPSSAGSQSKR
   c w way  aw  s m s     vnyv nk                a     a p rtm lqs s n t   g--
       r    p              t s                                                ng
                           e                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ***.**.*: **:.*::*: * *: **** *   * :. * ****:***:*******:*: ******** *:.**
PVfSCWWLQFRNSEPCSDYCLTHLVNLLEDWGPCTEHGkHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
--sp         k       s i              r y         i   i                         
s -                                   q                                         
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 **:.****************** *:*********::* ***** ***** ******  :**: . . * .::      :
SSRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNL
i                      d              i                          t   l   h   s  
n                                                                    t          
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:  *. *   ****:*:  .*****.**:* ********:****** ******:******:*********:******: 
HDSCSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
                                                                               r
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   **::::*: ****::***::*. : *****.  ***  *.*:***** **  **  ***:** .* :***. * :.*
SVQHLESLYTSVTNFLLSLGIHLNpNKTKRWGYSLnFMGYVIGSWGSLPQeHIrmKIKDCFRKLPVNRPIDWKVCQRIVG
te    a   a             s          h    i         d  kl                    l  
                        a          q                                          
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************:***:*:*:. :  :** *** **:**  **  *:* .*:* .***************.:.  *  * 
LLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCkQYlNLYPVARQRPGLCQVFADATPTGWGLAIGHQRmRGT
                  i t th          t   q  mt        s                 m    
                                      t   d        q                        
                                        n                                     

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* :*   : *:*:***:* * :** :***:******** *:***:**  ***:* ***: :* *.:  .*** .*.**  
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGiy
    m                   n                       t                             vs
                        t                                                      f
                                                                               c

       810       820       830       840     
....:....|....:....|....:....|....:....|....:
.* * * : . * .* :*. *   .   . *  *.**  *:* * 
RPLLRLPFqPTTGRTSLYAVSPSVPSHLPdRVHFASPLHVAWRPP
        r s             atrp v            k  
        h                    g               
                             a               
© 1998-2019