HBVdb

Dataset for protein SHBs of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:    *    **  :*  :  *   *  *   .:* **:   *  *   *         *    .*    * .    *  
MEsITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVClGQNSQSPtSnHSPTSCPPICPGYRWMCLRRF
  g   r      a              n        s   es   r   l   i s        t            
  n                                        xv   p                               
  x                                         t   x                               
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *   *              :   *.  *  ...  *  .:**      *  * ***  .   .***  ** **    
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
 x                 sh        l                p              e                
                                              x                                 
                                                                                
                                                                                

       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
 ** .   *             *   *                 :         *      **    
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPsLYNILSPFIPLLPIFFCLWVYI-
   g          s     r  v    i   l m       rn   twr   l xl  l   a   
   v                        x             xr                       
                                           x                       
                                           g                       
© 1998-2019