HBVdb

Dataset for protein HBc of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**** :**:*** ** :**. *  *. ***: ** .*.*  * *.:* :  * .:*:    * *:   .   * :*:   
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPnHTALRQAILCWGELMTLASWVGNNLEDPA
            a       t  y  a   i   t  f          shh   i  vvv  n vtif     h  d  g
            l       x     i   f                             t   n         q   
                    l                                                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *     ***  :***   :* ** *.  **   *:: **  **** **  *   ****** ***  : *      :   
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRR--RGRSPRR
    x     ih      r        im   dv             lp   q           a i g     t   
                                q                                               
                                                                                

       170       180     
....:....|....:....|....:
***:     *: *  . *:** . *
RTPSPRRRRSQSPRRRRSQSPASQC
               k     s r 
                         
                         
© 1998-2019