HBVdb

Dataset for protein MHBs of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  ..   **          *   *. **. * : .  ** * **    **  . .*:.  *     * *  .       :
MQWNSTQFHQALLDPRVRALYfPAGGSSSeTQNPAPTIASLTSSIFsKTGGPAmNMdNITSGLLGPLLVLQAVCFLLTKI
  tsk   t    k k  cl       g    v    x    tslt  al t  ests    r       gfss i  
                  sx                       yx      x                   s      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *  *: **** .**   . * **** ******* * ** ******  .  * **** *** ** *****:* .*:**
LTIPQSLDSWWTSLNFLGGlPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
rkm rn        s  eet                                                    v       
                  a                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***   *   *:** *. **. *  * *.*****:.**:*************:**:** *.*  **** *** ****** 
VCPLlPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
    in ---                        t                               n           
    t                                                               x           

       250       260       270       280 
....:....|....:....|....:....|....:....|.
*** **** : *****          *  *: ** * * * 
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
         m           n                g  
                                         
© 1998-2019