HBVdb

Dataset for protein SHBs of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     *                  :   *  *: *  *   *     * **** ** **     ** ******  .    
MdNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGlPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
 es               fss i  rk  rn  l     s  eet                                   
                  x                      a                                    
                                           x                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** * **   * *** * * .*: .***       * ** *.  *  *  . *.***** .* : .* ******* * *.
IIFLFILLLCLIFLLVLLDYQGMLPVCPLlPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
                 v           i         q r                 t                    
                                                                                
                                                                                

       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
 ** * *  *     :* :*.* .  ** * *    * *:*                         
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
             n                    m           nt                y 
                                                                  
                                                                  
© 1998-2019