HBVdb

Dataset for protein HBSP of genotype G

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********.*****:*** *********: . * ***:**:*   *** **.** *:*******************:**
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRT
         k     d   l         epsp s   k  n knl   p  a  h e                   f  
                              kg           g                                    

        90       100       110 
....:....|....:....|....:....|.
******************* *.*.** ****
EIAPVFPSHHLGLSQNTYGSGPQSVSlGSVY
                   i s p  h    
                   t      p    
© 1998-2019