HBVdb

Dataset for protein HBc of genotype G

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*** *********************** *****************:* ****:***  *.****:** ************
MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTL
   i                       x                 t x    a   fv s    a  s            
                                                         e                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************.*******:************************************ ****************:*
ATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTV
                a       l                                    l                a 
                                                                                

       170       180       190     
....:....|....:....|....:....|....:
****.************.******* **:* ****
VRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
    d            q       k  t q    
                         g    s    
© 1998-2019