HBVdb

Dataset for protein LHBs of genotype G

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  * : .     * ***..*****:********* **:*********:** **:*::**.**:***************  
-MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKDPWPEANKVGVGAYGPGFTPPHGGLLGWSPQ
mg wtskprkgm t   vp     f         g  s         n  h  q hq  a  f               lp
             r                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:** **.:** **.******* ****** **********:***** .:****:* :**** *******   .*.*.*** 
SQGTLTTLPADPPPASTNRQSGRQPTPIsPPLRDSHPQAMQWNSTAfHQALQNPKVRGLYfPAGGSSSGIVNPVPTIASH
a  i  nv  v  t       r      f          l     tvy    d ri    l       etqs a n   l
                                             q        t     -         ae        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ****:. *. *.********:****** **  *:**.::***************** ..** * **********  ***
ISSIFsRIGDPAPNMENITSGFLGPLLVlQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCP
t    tkt gl t        l      s  vy v  kff                 eat  l q          lt   
     a                          v                                             
                                c                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* ******* **********************************.**********.***************** * *: *
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGN
 i       w                                  s          r                 i l er 
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************:***.********.********** *****.: *: ****.**  * **:******:******
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAiwMMWYWGPNLYNILSPFiPLLPIFfCLWVYI
                 d   a        a          h     vml il    s  xt r  l      l      
                                                 s                            
                                                                                

 
.
 
-
q
 
 
© 1998-2019