HBVdb

Dataset for protein MHBs of genotype G

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:***** .:****:* :**** *******   .*.*.***  ****:. *. *.********:****** **  *:**.:
MQWNSTAfHQALQNPKVRGLYfPAGGSSSGIVNPVPTIASHISSIFsRIGDPAPNMENITSGFLGPLLVlQAGFFLLTRI
l     tvy    d ri    l       etqs a n   lt    tkt gl t        l      s  vy v  kf
      q        t     -         ae             a                          v      
                                                                         c      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:***************** ..** * **********  **** ******* *****************************
LTIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
f                 eat  l q          lt    i       w                             
                                                                              
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****.**********.***************** * *: ******************:***.********.********
VCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
     s          r                 i l er                  d   a        a        
                                                                                
                                                                                

       250       260       270       280  
....:....|....:....|....:....|....:....|..
** *****.: *: ****.**  * **:******:****** 
LSPTVWLSAiwMMWYWGPNLYNILSPFiPLLPIFfCLWVYI-
  h     vml il    s  xt r  l      l      q
          s                             
                                          
© 1998-2019