HBVdb

Dataset for protein Pol of genotype G

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********.*****:*:* *********: . * ******:*   * ******************:*****:*******
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFP
         k     d t l         epsp s      n gnl d                  v     e       
                               g           k                                    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****:*** .*:***********   :*:*****:** *********** ****:.*****::*********:******
NIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKR
     e   nr q           ---q i     y  r           -    qa     ka         t      
         d                 n                           h                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:********** .**: *** . :  ..* *.*.*  *** * ***.**..:.*: :*******.*:**** . .***
ETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQSSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRS
  t          yr  ep   rvviqtsk h d s ct   g s   s  scvr qlk       p q    tsps   
             s         ldfhp e       rs     l        l                          
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *:.:*****:**. ***** *** *: :* *: **:**:** ** **:**::** *** ** *: :****: *:.*   
WSLWTRVHPSTRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGHAVELYSIPPSSTKSQSQGPV
g ira     s  sv     g   i krt s sh  n  a  t  n  i  se  x   p  - hpv    sx hn ---
r             s     i      c              k  h                   nl     r       
                                                                 h              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ********:: .**:*****::** :*****.*:**:*** ********** * ***  ***:**************. 
fSCWWLQFRDSEPCSDYCLSHLVNLLQDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
s        ntkt  e     ii  re     n y  y   t          i r   il   t              nt
-          r             hk                         g                          n
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************:**** *****:****************** ******.: *** **:**:**** 
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDsRILDHQYGTLQNLHD
                         i    f     l                  x      pnf   h  h  m    v
                              a                                                 
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************.*******************:******:***********************:**********
SCSRQLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLlAQFTSAICSVVRRAFPHCLAFSYmDDVVLGAKSV
                  q                   l      m                       i          
                                                                     v          
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ***:::*******:*******  ********* **************:** :**. ** *******:******** ***
QHLESLyTAVTNFLLSLGIHLNpNKTKRWGYSLNFMGYVIGSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLL
x   aif       f       ht         x              d  ik  rx  g       v        s   
                      sd                           a                        v   
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************.****************** *****.*********************:**********
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
                      v                  r     v                     m          
                                         l                                      
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********:* ***********.:****************** *****   * ********:*********.****: **
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLcRP
        d r           ti                  q     tst s        t         w    iy  
          i           n                         i                               
                                                                                

       810       820       830       840   
....:....|....:....|....:....|....:....|...
**.*.: * *****:** * *** *********** **:*.**
LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
  h syr x     i  d r   f           s  a r  
        s                                  
        p                                  
© 1998-2019