HBVdb

Dataset for protein HBSP of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****  .*  ::********************** ******:*:**** ***** **.*******:***** ..******
MPLSYQhFRRLLLLDNEAGPLEEELPRLADEDLNhRVAEDLNLQLPNDlQPPARDPAKPAPLLLKEPLCFPpAAVPNLRT
    cpr lsvv                      l      h h    q     v  r       d     lvv      
      q                           r             x                               

        90       100       110 
....:....|....:....|....:....|.
*********.********* ****** ****
EIAPVFPSHHLGLSENTYGSGPQPVSLGSVY
         r         t      h    
                   i           
© 1998-2019