HBVdb

Dataset for protein HBc of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**** *******.* * ***.**:**:*** ***:**:*:*****:**:*  **:**.: ** *:  :..***:**:* .
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPnHTALRQAILCWGELMTLASWVGNNLEDPA
    l       a x x   t  y  i   x   t  h e     d  s sx  i  vvs  r vtnfgd   h  q qg
                    n                                           d         n   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********. ::******:** *** *****: *:**** ** *****  ***********:**  *:******** **
ARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRT
         sahi      f  x   x     di i    x  g     xg           i  cc i        g  
          n                                       p                             

       170       180   
....:....|....:....|...
********:******* * :*:*
PSPRRRRSQSPRRRRSQSPASQC
        k       p rs k 
                       
© 1998-2019