HBVdb

Dataset for protein HBe of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: ******** *****************.**** *******.* * ***.**:**:*** ***:**:*:*****:**:* 
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
ix        x                 d    l       a x x   t  y  i   x   t  h e     d  s s
fl                                               n                             h

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 **:**.: ** *:  :..***:**:* .*********. ::******:** *** *****: *:**** ** *****  
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
x  i  vvs  r vtnfgd   h  q qg         sahi      f  x   x     di i    x  g     xp
               d         n             n                                       g

       170       180       190       200       210  
....:....|....:....|....:....|....:....|....:....|..
***********:**  *:******** **********:******* * :*:*
YRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
           i  cc i        g          k       p rs k 
                                                    
© 1998-2019