HBVdb

Dataset for protein LHBs of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********************************************:****.******.*.******************
MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKDNWPMANKVGVGGFGPGFTPPHGGLLGWSPQ
                                               d    a      a a                  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****:** ** *****.*************************** *********.*****:************.***.**
AQGILTTsPPDPPPASTNRRSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIaSL
    m  l  v     n                           i         k     l            v   v  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********.***:******* ** ***.* * ***: ***:************ ********* ********  ***
TSSIFSKTGDPaMNMENITSGLLGPLLVLQAVCFLLTKILTIPqSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCP
           v   k       r  p   g f s   vx   k            e         x        qi   
                                       r                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******.*************** ************************************ ***.******** ******
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGN
       r               g                                    x   p        i      
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********:*:***:************. *.******** **  .:**:******* .** ****************
CTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
           l n   d            ap a        i  psam  m       yn  r                
                                                                                

 
.
 
-
x
 
© 1998-2019